Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B002908.843ON54254223950.0
NDAI0E002808.843ON54951720940.0
KNAG0G034308.843ON54249017440.0
YML116W (ATR1)8.843ON54246916060.0
Skud_13.258.843ON53747315990.0
Smik_13.188.843ON54547415850.0
NCAS0A02540singletonON53950515660.0
Suva_13.278.843ON55347415500.0
KNAG0J002608.843ON55047615190.0
KAFR0A028408.843ON52046715100.0
NCAS0C004008.843ON51749814900.0
CAGL0B02343g8.843ON53747114880.0
KAFR0B03930singletonON55549114740.0
SAKL0D01386g8.843ON52147914610.0
Suva_13.4678.843ON54350714600.0
NDAI0K004008.843ON55345314570.0
KLTH0C03806g8.843ON52550014470.0
Kwal_27.102458.843ON51546414390.0
TDEL0B005508.843ON53747214320.0
YMR279C8.843ON54049614290.0
Skud_13.4518.843ON53949714180.0
Kpol_541.168.843ON52847013950.0
Smik_13.4928.843ON54349713950.0
KAFR0B039408.843ON54750313920.0
CAGL0M03003g8.843ON55846413800.0
TBLA0D032708.843ON55050113600.0
TBLA0D03280singletonON58047013201e-177
TPHA0C047908.843ON55648313091e-175
TBLA0C01160singletonON6004859861e-126
KLTH0C10560gna 1ON5154627512e-92
Smik_15.560na 1ON5164757354e-90
Suva_8.435na 1ON5154767312e-89
YOR378Wna 1ON5154417277e-89
KLLA0B00352gna 1ON4984537187e-88
Kwal_23.6547na 1ON5114797197e-88
Skud_15.545na 1ON5164407093e-86
TDEL0G04950singletonON5124717084e-86
SAKL0C06116gsingletonON1851904311e-49
KNAG0D00130na 1ON5654634484e-48
KAFR0C04860na 1ON5344453692e-37
CAGL0L02519gna 1ON5294513481e-34
NCAS0A05720na 1ON5634583421e-33
NDAI0K02730singletonON6045192882e-26
KLLA0C18931gna 2ON5532491295e-07
Kwal_34.15746na 2ON5182431198e-06
NCAS0C03460na 3ON6302171181e-05
NDAI0D010202.242ON5922011117e-05
SAKL0A08228gsingletonON5691461101e-04
SAKL0C05588gsingletonON6771431072e-04
SAKL0A00726gsingletonON5982001063e-04
TDEL0G03260singletonON6121671054e-04
Smik_13.2722.473ON5611321045e-04
Smik_6.24na 4ON5442471036e-04
YMR088C (VBA1)2.473ON5621021037e-04
TDEL0A024902.473ON554791010.001
ABL040W2.473ON567781000.001
SAKL0D04510gna 5ON5311671000.001
KLLA0F13684g2.473ON571102990.002
SAKL0F00440gsingletonON544462990.002
NDAI0A02050singletonON617484980.002
Skud_13.2442.473ON562102980.002
TDEL0C045802.241ON557227980.003
Suva_13.2652.473ON561102980.003
ZYRO0G00352gsingletonON494106970.003
Skud_6.16na 4ON549240970.003
YPR198W (SGE1)singletonON543235970.003
SAKL0E02992g2.473ON57098970.003
Suva_10.11singletonON540236950.006
SAKL0E08778g2.241ON600230950.006
Skud_7.560na 3ON642199950.007
TBLA0G025502.242ON613237940.007
KLTH0D16962gsingletonON571147940.007
AGR076C8.272ON686273940.008
NDAI0H022002.473ON57183930.011
Skud_16.503singletonON543228920.014
Smik_17.11singletonON544280920.015
NCAS0A078102.473ON568124920.015
KLTH0C10142gsingletonON573127920.015
SAKL0E08756g2.242ON565223910.021
Kwal_14.728singletonON568145900.026
CAGL0J01375g2.473ON56483900.027
YKR105C (VBA5)singletonON582175900.027
KLLA0A04631g8.272ON579114890.031
YGR224W (AZR1)na 3ON613127890.032
Smik_16.81na 3ON625133880.040
KNAG0E025602.473ON57879880.041
KLTH0H16214gsingletonON551153880.042
KLLA0E24113g8.570ON575124880.043
KAFR0J009302.242ON566236870.054
KLTH0E03234gsingletonON52191870.054
KLTH0B00132gsingletonON568208870.056
TDEL0C045902.242ON529204870.061
CAGL0B02079gna 3ON624133860.076
ZYRO0E10230gsingletonON558194860.079
Kpol_416.6singletonON59790860.084
Kpol_543.448.272ON643269850.088
NDAI0B037702.242ON571224850.095
ZYRO0G03234g2.473ON56279850.097
NDAI0D016805.284ON516128840.11
TDEL0F039908.272ON63161840.13
TPHA0B00180singletonON633317840.14
ZYRO0C01430g8.272ON59074820.21
TPHA0M00120singletonON619180820.25
KLTH0F03652g1.136ON90374820.28
NCAS0A065805.284ON528128810.30
TPHA0G031502.473ON60078810.33
NCAS0D02350na 6ON634163810.33
SAKL0B12716gsingletonON632149810.34
KNAG0B049005.284ON516128800.43
TBLA0E038002.242ON608228790.50
YIL120W (QDR1)2.242ON563243790.54
AFR628C1.136ON86974790.54
KLTH0H05456gna 7ON568141790.56
Skud_14.2672.242ON562234790.56
ZYRO0D11946g5.503ON967129790.57
KLTH0C10120gsingletonON651130790.59
Skud_18.3singletonON590195780.62
Suva_9.712.241ON561232780.70
TDEL0D06610singletonON49787770.80
YNL065W (AQR1)2.242ON586227770.89
Kwal_23.48142.241ON529134770.93
Kwal_26.9616singletonON562176770.96
Smik_11.368singletonON580200771.0
Smik_8.1175.284ON514128761.1
Kpol_416.5singletonON60773761.2
NCAS0G029902.242ON581236761.3
KLLA0C19019gna 8ON511106751.4
Kpol_1003.112.241ON581221751.5
SAKL0H16808g8.272ON65765751.7
TBLA0B044808.570ON60884741.8
Smik_14.2622.242ON561227741.9
SAKL0F00198gsingletonON537153742.1
TDEL0D038003.245ON640189742.2
KLTH0G09504gna 9ON624181742.3
YHR048W (YHK8)5.284ON514128732.4
Smik_11.370singletonON44083732.4
Suva_4.2753.245ON683164732.7
Kwal_27.116388.446ON72380732.8
KLTH0B00594gsingletonON618145733.0
Skud_8.1075.284ON522128723.1
Suva_5.2na 6ON62777723.8
NDAI0A082303.211ON249970723.8
TDEL0B019008.446ON687101724.0
Kpol_358.4na 6ON61787714.1
CAGL0G08624g2.242ON583231714.5
Skud_5.24na 6ON62781714.5
Kpol_513.33singletonON626106714.7
NDAI0E038007.44ON62165705.5
CAGL0J00363g5.284ON498129705.5
KLLA0E16083g5.113ON1969101715.7
Kwal_14.782na 8ON491113705.8
NCAS0I00110na 10ON45281696.6
ADL258W2.242ON534202696.8
NDAI0C056708.570ON500110696.9
KLLA0C03454g1.136ON90077706.9
TPHA0A014108.357ON94788697.8
Kwal_23.5241na 11ON59180697.9
ZYRO0G07414gsingletonON70783698.3
Kpol_1048.458.570ON648184698.7
KLLA0F03311g2.242ON542109689.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B00290
         (542 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      927   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      811   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   676   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   623   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   620   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   615   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   607   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   601   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   589   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   586   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      578   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   577   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   572   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   567   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   566   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               565   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   561   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   558   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   556   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   555   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   550   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   541   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   541   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   540   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   536   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   528   0.0  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   513   e-177
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   508   e-175
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   384   e-126
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   293   2e-92
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   287   4e-90
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   286   2e-89
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   284   7e-89
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   281   7e-88
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   281   7e-88
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   277   3e-86
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   277   4e-86
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   170   1e-49
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   177   4e-48
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     146   2e-37
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   138   1e-34
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            136   1e-33
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   115   2e-26
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    54   5e-07
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    50   8e-06
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    50   1e-05
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    47   7e-05
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    47   1e-04
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    46   2e-04
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    45   3e-04
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               45   4e-04
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    45   5e-04
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    44   6e-04
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    44   7e-04
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    44   0.001
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    43   0.001
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    43   0.001
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    43   0.002
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    43   0.002
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...    42   0.002
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    42   0.002
TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.2...    42   0.003
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    42   0.003
ZYRO0G00352g Chr7 (27042..28526) [1485 bp, 494 aa] {ON} weakly s...    42   0.003
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    42   0.003
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    42   0.003
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    42   0.003
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    41   0.006
SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {...    41   0.006
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    41   0.007
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    41   0.007
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    41   0.007
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    41   0.008
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    40   0.011
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    40   0.014
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    40   0.015
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    40   0.015
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    40   0.015
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    40   0.021
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    39   0.026
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    39   0.027
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    39   0.027
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    39   0.031
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    39   0.032
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    39   0.040
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    39   0.041
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    39   0.042
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    39   0.043
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    38   0.054
KLTH0E03234g Chr5 complement(293162..294727) [1566 bp, 521 aa] {...    38   0.054
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    38   0.056
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    38   0.061
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    38   0.076
ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {...    38   0.079
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...    38   0.084
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    37   0.088
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    37   0.095
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    37   0.097
NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {O...    37   0.11 
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    37   0.13 
TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON}       37   0.14 
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    36   0.21 
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}                36   0.25 
KLTH0F03652g Chr6 (318194..320905) [2712 bp, 903 aa] {ON} simila...    36   0.28 
NCAS0A06580 Chr1 (1303456..1305042) [1587 bp, 528 aa] {ON} Anc_5...    36   0.30 
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    36   0.33 
NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON}               36   0.33 
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    36   0.34 
KNAG0B04900 Chr2 (940751..942301) [1551 bp, 516 aa] {ON}               35   0.43 
TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.2...    35   0.50 
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    35   0.54 
AFR628C Chr6 complement(1577155..1579764) [2610 bp, 869 aa] {ON}...    35   0.54 
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...    35   0.56 
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    35   0.56 
ZYRO0D11946g Chr4 complement(1012082..1014985) [2904 bp, 967 aa]...    35   0.57 
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    35   0.59 
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    35   0.62 
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    35   0.70 
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    34   0.80 
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    34   0.89 
Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W...    34   0.93 
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    34   0.96 
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    34   1.0  
Smik_8.117 Chr8 (181800..183344) [1545 bp, 514 aa] {ON} YHR048W ...    34   1.1  
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    34   1.2  
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    34   1.3  
KLLA0C19019g Chr3 (1689555..1691090) [1536 bp, 511 aa] {ON} simi...    33   1.4  
Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON} (33230....    33   1.5  
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    33   1.7  
TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON} Anc_8...    33   1.8  
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    33   1.9  
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    33   2.1  
TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.2...    33   2.2  
KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {...    33   2.3  
YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presum...    33   2.4  
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...    33   2.4  
Suva_4.275 Chr4 complement(487620..489671) [2052 bp, 683 aa] {ON...    33   2.7  
Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199...    33   2.8  
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    33   3.0  
Skud_8.107 Chr8 (179754..181322) [1569 bp, 522 aa] {ON} YHR048W ...    32   3.1  
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)       32   3.8  
NDAI0A08230 Chr1 (1882144..1889643) [7500 bp, 2499 aa] {ON} Anc_...    32   3.8  
TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {O...    32   4.0  
Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...    32   4.1  
CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {...    32   4.5  
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)    32   4.5  
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...    32   4.7  
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44      32   5.5  
CAGL0J00363g Chr10 (27627..29123) [1497 bp, 498 aa] {ON} highly ...    32   5.5  
KLLA0E16083g Chr5 complement(1432567..1438476) [5910 bp, 1969 aa...    32   5.7  
Kwal_14.782 s14 (42720..44195) [1476 bp, 491 aa] {ON} YGR260W (T...    32   5.8  
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}         31   6.6  
ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic ho...    31   6.8  
NDAI0C05670 Chr3 complement(1310115..1311617) [1503 bp, 500 aa] ...    31   6.9  
KLLA0C03454g Chr3 (311611..314313) [2703 bp, 900 aa] {ON} simila...    32   6.9  
TPHA0A01410 Chr1 (276357..279200) [2844 bp, 947 aa] {ON} Anc_8.3...    31   7.8  
Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL06...    31   7.9  
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...    31   8.3  
Kpol_1048.45 s1048 (117855..119801) [1947 bp, 648 aa] {ON} (1178...    31   8.7  
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    31   9.0  

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  927 bits (2395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/542 (88%), Positives = 477/542 (88%)

Query: 1   MFRIFNRKSHRXXXXXXXXXXXXXXXXXXXKHGDIEEIEKDVISQTETPQLEHSKWQNPD 60
           MFRIFNRKSHR                   KHGDIEEIEKDVISQTETPQLEHSKWQNPD
Sbjct: 1   MFRIFNRKSHRSEEIMESAASSITEETSIIKHGDIEEIEKDVISQTETPQLEHSKWQNPD 60

Query: 61  YFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGS 120
           YFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGS
Sbjct: 61  YFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGS 120

Query: 121 FILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILP 180
           FILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILP
Sbjct: 121 FILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILP 180

Query: 181 NVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIA 240
           NVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIA
Sbjct: 181 NVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIA 240

Query: 241 SAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIXX 300
           SAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYII  
Sbjct: 241 SAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIAL 300

Query: 301 XXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWXXXXXXXXXXXXXLL 360
                       TYEVKYAESPLLPVEVTKNRHIIMILAALFLGW             LL
Sbjct: 301 LVVSVFFLALFFTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLL 360

Query: 361 NLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPV 420
           NLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPV
Sbjct: 361 NLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPV 420

Query: 421 DQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGM 480
           DQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGM
Sbjct: 421 DQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGM 480

Query: 481 GTTVERQINKSGNDLLKGYRGAEXXXXXXXXXXXXXXXXXXXEILWGKRKQHLAANVVPD 540
           GTTVERQINKSGNDLLKGYRGAE                   EILWGKRKQHLAANVVPD
Sbjct: 481 GTTVERQINKSGNDLLKGYRGAEYLGIGLAGLGIIITAIYLGEILWGKRKQHLAANVVPD 540

Query: 541 LS 542
           LS
Sbjct: 541 LS 542

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  811 bits (2094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/517 (78%), Positives = 435/517 (84%), Gaps = 8/517 (1%)

Query: 34  DIEEIEKDVISQTETPQLE--------HSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAA 85
            I + E + +S+ E P  E        HSKWQNPDYFQN+WQEYLFIFSCMMSQLLNQAA
Sbjct: 33  SITKEENNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAA 92

Query: 86  TPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFF 145
           TPQTLSIMNIITDSF SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTL+GGY+FF
Sbjct: 93  TPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFF 152

Query: 146 IIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIG 205
           IIWS+ISG T YSH+D FFI+SRAFQGL IAFILPNVMGIVGNIYKPD+ RKNIVISMIG
Sbjct: 153 IIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIG 212

Query: 206 ASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAM 265
           ASAPIGAF GSLFAGLIGTE+P QWPWAFYAFAIASA NLAISIYSIPN++PTN+HGFAM
Sbjct: 213 ASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNNIPTNIHGFAM 272

Query: 266 DWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLP 325
           DWIGS++AVIGLILLNFVWNQGPIVGWQ AYII              TYE+KYA+SP+LP
Sbjct: 273 DWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIKYAKSPILP 332

Query: 326 VEVTKNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAA 385
           VEVTKNRHIIMILAALFLGW             LLNLRHYSALWAGTTYFMFAIWGTVAA
Sbjct: 333 VEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVAA 392

Query: 386 VIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPA 445
           VIVGAFIK+ISA+ ILF SM+AFNIG+IMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPA
Sbjct: 393 VIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPA 452

Query: 446 AAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEXX 505
           AAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSG ++LKGYR AE  
Sbjct: 453 AAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYL 512

Query: 506 XXXXXXXXXXXXXXXXXEILWGKRKQHLAANVVPDLS 542
                            E+LW KRK+ L++N   D+S
Sbjct: 513 GVGLAGLGIVISGIYMAEVLWAKRKERLSSNRDHDMS 549

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/490 (67%), Positives = 382/490 (77%)

Query: 53  HSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIA 112
           + KWQ+  YFQN+WQEY+F+ +CMMSQLLNQA  PQTLS+MNI+T SF+S    +TWL+A
Sbjct: 53  NCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMA 112

Query: 113 SFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQG 172
           SFPLVSGSFILISGR+GDIYGLK +LVGG IFFIIW++ISG T Y+HSDTFFIVSR+FQG
Sbjct: 113 SFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQG 172

Query: 173 LSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPW 232
           L +AFILPNVMG VGNIYKP++ RKNIVIS+IGA AP+GAF G+ FAGLIGT++PD WPW
Sbjct: 173 LGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPW 232

Query: 233 AFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGW 292
           +FYA AIAS   L  ++YSIPN +PTNVHGF+MDWIGS LAV+GLILLNFVWNQGPI GW
Sbjct: 233 SFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGW 292

Query: 293 QTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWXXXXXXX 352
             AYII               YEV YA SPLLP  +T+NRH++MIL ALFLGW       
Sbjct: 293 GKAYIIVLLIVSVFVLTLFFIYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFS 352

Query: 353 XXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGI 412
                 LLNLRHYS +WAG TYFMFAIWG VA+V+VG  I+KISA+ ILF SM+AF++GI
Sbjct: 353 FYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGI 412

Query: 413 IMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNY 472
           IMLSVTPV QTYFRMNLGTMIILSFGMDMSFPAAAIILSD L  QYQGMAGSLANTMVNY
Sbjct: 413 IMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNY 472

Query: 473 SMSLCLGMGTTVERQINKSGNDLLKGYRGAEXXXXXXXXXXXXXXXXXXXEILWGKRKQH 532
           SMSLCLGMG+TVE QIN++G DLLKGYR AE                   E LW  RK+ 
Sbjct: 473 SMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKER 532

Query: 533 LAANVVPDLS 542
           + +    +LS
Sbjct: 533 MESTSETNLS 542

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/469 (64%), Positives = 363/469 (77%), Gaps = 1/469 (0%)

Query: 36  EEIEKDVISQTETPQLE-HSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMN 94
           E +     +Q+E   ++ + KWQNP+YF+  WQEYLFIF+CM+SQLLNQA T QTLSIMN
Sbjct: 35  ESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMN 94

Query: 95  IITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGL 154
           I++DSF SEG  ++WL+ASFPLVSGSFILISGR+GDIYGLKK L+ GY+  IIWS+I G+
Sbjct: 95  ILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGI 154

Query: 155 TKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFF 214
           TKYS SDTFFI+SRAFQGL IAF+LPNV+GI+GNIY   + RKNIVIS +GA APIGA  
Sbjct: 155 TKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATL 214

Query: 215 GSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAV 274
           G LFAGLIGTEDP QWPWAFYA++IA+  N  +SIY+IP+++PTN+H F+MDWIGSVL V
Sbjct: 215 GCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSVLGV 274

Query: 275 IGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHI 334
           IGLILLNFVWNQ PI GW  AYII               YE+++A++PLLP  V K+RH+
Sbjct: 275 IGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYEIRFAKTPLLPRAVIKDRHM 334

Query: 335 IMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKK 394
           I I+ ALF GW              LN+R Y+ALWAG TYFMF IWG +AA++VG  IK 
Sbjct: 335 IQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKN 394

Query: 395 ISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGL 454
           +S +  LF SMVAFN+G IM SVTPV +TYFR  LGTMIILSFGMD+SFPA++II SD L
Sbjct: 395 VSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNL 454

Query: 455 TMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAE 503
            M+YQGMAGSL NT+VNYSMSLCLGMG TVE Q+N  G  LLKGYRGA+
Sbjct: 455 PMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQ 503

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/473 (63%), Positives = 356/473 (75%)

Query: 31  KHGDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTL 90
           +H   EE         E   ++  +WQNP+YF+N W EYLFIF+CM+SQLLNQA T QTL
Sbjct: 32  RHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTL 91

Query: 91  SIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSI 150
           SIMNII +SF S     TWL+ASFPLVSGSFILISGR+GDIYGLKK L  GY+  IIWS+
Sbjct: 92  SIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSL 151

Query: 151 ISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPI 210
           I GLTKYS SDTFFI+SRAFQGL IAF+LPNV+GI+GNIY   + RKNIVIS++GA AP+
Sbjct: 152 ICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPV 211

Query: 211 GAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGS 270
           GA  G LFAGLIGT++P QWPWAFYA+ I S  NLA+S+YSIPN++PTN+  F+MDWIGS
Sbjct: 212 GATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFSMDWIGS 271

Query: 271 VLAVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTK 330
            L VIGL+L+NFVWNQ PI GW  AYII               YE ++A+SPLLP  V K
Sbjct: 272 ALGVIGLVLMNFVWNQAPISGWDQAYIIVLLVISVVFLVVFIIYENRFAKSPLLPRAVLK 331

Query: 331 NRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGA 390
           +RH+I I+ ALF GW              LN+RHYSA+WAG TYFMF IWG +AA++VG 
Sbjct: 332 DRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGI 391

Query: 391 FIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIIL 450
           +IKK+S +  LF+SM+AFNIG IM SVTPV +TYFR  LGTMIILSFGMD SFPA++II 
Sbjct: 392 YIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSIIF 451

Query: 451 SDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAE 503
           SD L M+YQGMAGSL NT+VNYSMSLCLGMG TVE  ++  G  +LKGYRGA+
Sbjct: 452 SDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRGAQ 504

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/474 (64%), Positives = 360/474 (75%), Gaps = 1/474 (0%)

Query: 31  KHGDIEEIEKDVISQTETPQLE-HSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQT 89
            +G  E +     +  E   +E + KWQNP YF+  WQEYLFIF+CM+SQLLNQA T QT
Sbjct: 33  DNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQT 92

Query: 90  LSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWS 149
           LSIMNI++DSF SEG  ++WL+ASFPLVSGSFILISGR+GDIYGLKK L+ GY+  IIWS
Sbjct: 93  LSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWS 152

Query: 150 IISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAP 209
           +I G+T YS SDTFFI+ RAFQGL IAF+LPNV+GI+GNIY   + RKNIVIS +GA AP
Sbjct: 153 LICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAP 212

Query: 210 IGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIG 269
           IGA  G LFAGLIGTE+P+QWPWAFYAF+IAS  N  +SIY+IPN++PTN+H F+MDWIG
Sbjct: 213 IGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIG 272

Query: 270 SVLAVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVT 329
           SVL VIGLILLNFVWNQ PI GW  AYII               YE+ +A+SPLLP  V 
Sbjct: 273 SVLGVIGLILLNFVWNQAPISGWSQAYIIVILIISVIFLAVFIIYEMWFAKSPLLPHAVI 332

Query: 330 KNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVG 389
           K+ H+I I+ ALF GW              LN+RHY+ALWAG TYFMF IWG +AA++VG
Sbjct: 333 KDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVG 392

Query: 390 AFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAII 449
             IK +S +  LF SMVAFN+G IM SVTPV +TYFR  LGTMIILSFGMD+SFPA++II
Sbjct: 393 FTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSII 452

Query: 450 LSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAE 503
            SD L M+YQGMAGSL NT+VNYSMSLCLGMG TVE Q++  G  LLKGYRGA+
Sbjct: 453 FSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQ 506

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/505 (59%), Positives = 364/505 (72%), Gaps = 1/505 (0%)

Query: 31  KHGDIEEIEKDVISQTETPQLEH-SKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQT 89
           +  +I   EK+V S +    L+  S WQNP+YF ++++EY FIF+CM++ LLNQA   Q 
Sbjct: 24  EDKNISHNEKEVYSNSTDSVLDDDSPWQNPNYFSSKYKEYFFIFTCMVANLLNQAGQTQV 83

Query: 90  LSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWS 149
           LS MN+I++SF+S+ GK+TWL+ASFPLVSGSFILISGRIGDIYGLKKT++GGYIF IIWS
Sbjct: 84  LSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWS 143

Query: 150 IISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAP 209
           ++ G   ++H+DTFFIV RAFQGL I+FILPNVMG++GNIYK  + RKNIVISMIG +AP
Sbjct: 144 LLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLRKNIVISMIGLTAP 203

Query: 210 IGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIG 269
            GA  G+L+ GLI TE+  QWPW FYA+A+    NL +++YS+PN +PTNVH FAMDWIG
Sbjct: 204 TGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNCIPTNVHNFAMDWIG 263

Query: 270 SVLAVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVT 329
           S++ V+GLIL NFVWNQGP+ GW  AYII               YE+KY  SPLLPVEVT
Sbjct: 264 SIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYELKYPISPLLPVEVT 323

Query: 330 KNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVG 389
           KN  I+ IL+ LFLGW              LNLR YS +W G TYFMF IWGT+AA+IV 
Sbjct: 324 KNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFMFIIWGTIAALIVA 383

Query: 390 AFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAII 449
             IKK+  A +LF S + F +G +MLSVTP+ Q Y+RMNLG  IIL FGMD+SFPA++II
Sbjct: 384 FTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILCFGMDLSFPASSII 443

Query: 450 LSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEXXXXXX 509
           LSD L MQYQGMAGSL NT++NY+ SLCLGMGTTVERQINKSG DLLKGYR A       
Sbjct: 444 LSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDLLKGYRSALYLAVGL 503

Query: 510 XXXXXXXXXXXXXEILWGKRKQHLA 534
                          LW KR+  LA
Sbjct: 504 GGLGSCIAFINLCYTLWMKRRDRLA 528

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/474 (62%), Positives = 358/474 (75%), Gaps = 4/474 (0%)

Query: 31  KHGDIEEIEKDVISQTETPQLE-HSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQT 89
           K G +  I   V++ +E   ++   KWQNP+YF+  WQEYLFIF+CM+SQLLNQ+ T QT
Sbjct: 44  KEGALTTI---VLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQT 100

Query: 90  LSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWS 149
           LSIMNI+ DSF S+    +WL+ASFPLVSGSFILISGR+GDI+GLK  L+ GY+  IIWS
Sbjct: 101 LSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWS 160

Query: 150 IISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAP 209
           +I GLTKYS SDTFFIVSRAFQGL IAF+LPNV+GI+GN+Y   + RKNIVIS IGA AP
Sbjct: 161 LICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAP 220

Query: 210 IGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIG 269
           IGA  G  FAGLIGT +P+QWPWAFYA+ I +  NL +SIY+IPN++PTNVH F+MDWIG
Sbjct: 221 IGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIG 280

Query: 270 SVLAVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVT 329
           S L VIGL+LLN VWNQ PI GW  AYII               YE+ +A+SPLLP  V 
Sbjct: 281 SGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLIISVLFLVLFGVYEIHFAKSPLLPQAVM 340

Query: 330 KNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVG 389
           K+RH+I I+ +LF GW              LN+RHY+ LWAG +YFMF IWG +AA++VG
Sbjct: 341 KDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVG 400

Query: 390 AFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAII 449
             IK++S +  LF +MVAFN+G IM SVTPV +TYFRM +GTMIILSFGMD+SFPA++II
Sbjct: 401 FSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSII 460

Query: 450 LSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAE 503
            SD L M+YQGMAGSL NT+VNYSMSLCLGMG TVE Q++  G  +LKGYRGA+
Sbjct: 461 FSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQ 514

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/476 (59%), Positives = 350/476 (73%), Gaps = 8/476 (1%)

Query: 34  DIEEIEKDVISQTETPQLEHSK-------WQNPDYFQNQWQEYLFIFSCMMSQLLNQAAT 86
           ++EE +K+  +++E      S+       WQNP YF N+WQEY FI +CM++QLLNQA  
Sbjct: 34  NVEE-KKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTCMLAQLLNQAGQ 92

Query: 87  PQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFI 146
            Q  + MNI+ D+FNS   K+TWL+ASFPLVSGSFIL+SGRIGDIYGLKKTL+GGY+  +
Sbjct: 93  AQATAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVL 152

Query: 147 IWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGA 206
           IWS+I G   Y+H+D FFI+ RAFQGL IAFILPNVMG++GNIYK ++ RKN VIS +G 
Sbjct: 153 IWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGM 212

Query: 207 SAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMD 266
            APIGA  G +++GLI  E+P QWPW FYA+AI  A N+ ++IYSIP++VPTN+HGF MD
Sbjct: 213 CAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMD 272

Query: 267 WIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPV 326
           W GS + V+G+IL NFVWNQGPI GW   YII               YE+K+A+SPLLP 
Sbjct: 273 WTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPP 332

Query: 327 EVTKNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAV 386
           EV KNRHI MIL A+F+GW              LNLRHYSA+WAG T+FMF IWGT+AA 
Sbjct: 333 EVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAF 392

Query: 387 IVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAA 446
           +V   IK++  + +L  SM  F +G IMLSVTPV Q+Y++MNLG  IILSFGMD+SFPA+
Sbjct: 393 LVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPAS 452

Query: 447 AIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGA 502
           +IILSD L  QYQGMAGSL NTMVNYS SLCLG+G+T E Q+NK+G D LKGYR A
Sbjct: 453 SIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAA 508

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/467 (63%), Positives = 350/467 (74%)

Query: 37  EIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNII 96
            I+K    + E    E SKWQ+P YF+N +QEYLF+ SCM +QLLNQA TPQTLSIMN++
Sbjct: 18  SIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVL 77

Query: 97  TDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTK 156
           +DSFNS    +TWL+ASFPLV+GSFILISGRIGDIYGLKKTL+GGYIF IIWS+I G T 
Sbjct: 78  SDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTY 137

Query: 157 YSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGS 216
           YS SDTF I++RAFQGL IAF LPNV+G +GNIY   S RKN+VIS+I ASAP+GA  G 
Sbjct: 138 YSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVGAAIGG 197

Query: 217 LFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIG 276
            FAGLI TE P QWPW+FYAFAIA +FNL ISIYSIP+++PTNV+GF MDWIGS L V G
Sbjct: 198 AFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSALIVTG 257

Query: 277 LILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHIIM 336
           LIL NF WNQGPIVGW  AYII              TYE+ +A SPL+  E+T +R++I+
Sbjct: 258 LILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPSPLIAREITHSRNMII 317

Query: 337 ILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKIS 396
            +  LFLGW             +LNLRHYS +WAG +YF+F I+G +A+  VG  IKKI+
Sbjct: 318 TIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISIKKIT 377

Query: 397 AAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTM 456
           A  IL  SMV F +G  +LSV PVDQ+YF++ L  M IL  G+D SFPAA IILSDGL M
Sbjct: 378 APVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPM 437

Query: 457 QYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAE 503
           +YQGMAGSLA TMVNYSMSLCLGMG TVERQINK G D+LKGYR AE
Sbjct: 438 EYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAE 484

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/498 (57%), Positives = 354/498 (71%), Gaps = 6/498 (1%)

Query: 36  EEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNI 95
           + +  D + +  TP      WQN  YFQ+  +EY FIF+CM + LLNQA   Q LS MN+
Sbjct: 14  KTLSCDSLLENSTP------WQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNV 67

Query: 96  ITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLT 155
           I++SF+S+ G +TWL+ASFPLVSGSFILISGRIGDIYGLKKT++GGYIF IIW+++ G  
Sbjct: 68  ISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFA 127

Query: 156 KYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFG 215
            Y+HSDTFFIV RAFQGL I+FILPN+MG+VGNIYK  + RKNIVIS+IG +AP GA  G
Sbjct: 128 DYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMG 187

Query: 216 SLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVI 275
           +L+ GLI TE   QWPW FYA+A+A+  NL ++IYS+P +VPTNVH FAMDW+G+++ V+
Sbjct: 188 ALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVV 247

Query: 276 GLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHII 335
           GLIL NFVWNQGP+ GW   YII               YE+K+  SPLLP EVTKN  I+
Sbjct: 248 GLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREVTKNGQIL 307

Query: 336 MILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKI 395
            IL  LFLGW              LNLR+YS LWAG T+FMF IWG++AA IVG  I ++
Sbjct: 308 TILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRV 367

Query: 396 SAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLT 455
             A +LF S + F +G +MLSVTP+ QTY+RMN+G  IILSFGMD+SFPA++IILSD L 
Sbjct: 368 GPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLP 427

Query: 456 MQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEXXXXXXXXXXXX 515
           MQYQGMAGSL NT++NYS SLCLGMGTTVERQINK+G +LL+GYR A             
Sbjct: 428 MQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVGLGGLGAC 487

Query: 516 XXXXXXXEILWGKRKQHL 533
                    LW KRK  L
Sbjct: 488 VAFLNLCYDLWRKRKSRL 505

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/471 (60%), Positives = 355/471 (75%), Gaps = 4/471 (0%)

Query: 36  EEIEKDVIS--QTETPQLE-HSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSI 92
           ++   D++   Q +T  ++ + KWQNP+YF +  +EYLF+ SC +SQLLNQA   QT  I
Sbjct: 27  KQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPI 86

Query: 93  MNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIIS 152
           MNI+ DS +S+ GK+ WL+A+FPL+SGSFILISGRIGDIYGLKKTL+ GY+F I+WS+I 
Sbjct: 87  MNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLIC 146

Query: 153 GLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGA 212
           GLTKY+HSD+FFIVSRAFQGL I+ ILPN++GIVG+IY   S RKN+VIS+IG  APIGA
Sbjct: 147 GLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGA 206

Query: 213 FFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVL 272
             G++F+GLIGTED +QWPWAFY++AI +A N  +SI+ IPN++PTNVHG  MDWIGS L
Sbjct: 207 TLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGL 266

Query: 273 AVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAE-SPLLPVEVTKN 331
            V+GLI+LNFVWNQ PI GW +AY+I               YE+ +   +PLLP EV K+
Sbjct: 267 GVVGLIMLNFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKS 326

Query: 332 RHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAF 391
              I++L ALF GW              LNLRHY+ LWAG TYFMF IWG VAA++VG  
Sbjct: 327 PKTIIVLFALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFT 386

Query: 392 IKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILS 451
           IKK+  + ILF+SMVAFN G I++SVTP+ QTYFR +LG MIILSFGMD+SFPA++I+LS
Sbjct: 387 IKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLS 446

Query: 452 DGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGA 502
           D L +QYQGMAGSL NTMVNYSMS CLG+   VE+ +N  G D+LKGYRGA
Sbjct: 447 DKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGA 497

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/491 (57%), Positives = 345/491 (70%)

Query: 52  EHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLI 111
            ++ WQNP YF ++W+EYLFI +CM+S LLNQA   Q  S MN+I  +FN++   +TWL+
Sbjct: 65  NNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLM 124

Query: 112 ASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQ 171
           ASFPLVSGSFIL+SGRIGDIYGLK+T++GG I  IIWS+I G   YS S TFFI+ RAFQ
Sbjct: 125 ASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQ 184

Query: 172 GLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWP 231
           GL IAF+LPNVMG+VGNIYK  S RKNIVIS IG  AP GA FG+ +AGLI T+   QWP
Sbjct: 185 GLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWP 244

Query: 232 WAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVG 291
           W FYA+A A   NL ++IYSIP++VP NVHGF+MDW GSV+ VIGLIL NFVWN+ PIVG
Sbjct: 245 WIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVG 304

Query: 292 WQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWXXXXXX 351
           W+ AYII               YE+K+A+SPLLP  VT N +IIMIL+A+F+GW      
Sbjct: 305 WEKAYIIVLLIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIW 364

Query: 352 XXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIG 411
                  LLNLR Y+ L AG ++ MF +WGT+AA  V   IK++  + +LF SMVAF +G
Sbjct: 365 TFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVG 424

Query: 412 IIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVN 471
            IMLS+TPV QTY++M  G  IIL+FGMD+SFPA++IILSD L M+YQGMAGSL NT+VN
Sbjct: 425 SIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVN 484

Query: 472 YSMSLCLGMGTTVERQINKSGNDLLKGYRGAEXXXXXXXXXXXXXXXXXXXEILWGKRKQ 531
           YS SLCLGMGTT E Q+NK+G DLLKGYR A                    E L  KR +
Sbjct: 485 YSTSLCLGMGTTAEIQVNKNGTDLLKGYRAALYVGIGLGVVGVIIAALFLFESLRQKRGR 544

Query: 532 HLAANVVPDLS 542
             A     D+S
Sbjct: 545 TAALTAKKDMS 555

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/479 (59%), Positives = 351/479 (73%), Gaps = 11/479 (2%)

Query: 34  DIEEIEKDVISQTETPQLEHS-------KW---QNPDYFQNQWQEYLFIFSCMMSQLLNQ 83
            +    K++ +Q+ T   EHS       KW   Q+P YF   W+EYLFIF+ MMSQLLNQ
Sbjct: 9   SVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQ 68

Query: 84  AATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYI 143
           A T QTLS++NI++ +F+S   ++TWL+ASFPLVSGSFIL+SG+IGDIYGLKKTL+ GY+
Sbjct: 69  AGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYV 128

Query: 144 FFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISM 203
             IIWS+I GLT Y+ S  FFI+SRAFQGL IAFILPN+MGIVGNIY   + RKN+VIS+
Sbjct: 129 VTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISL 188

Query: 204 IGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGF 263
           IGA APIGA  G LF+GLIGT   ++W W FYA+ I +A N+ +SI+ IPN++PTNV G 
Sbjct: 189 IGACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGS 247

Query: 264 AMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPL 323
           +MDWIGS + ++G+IL NFVWNQGPIVGW TAYII               YE KYA  PL
Sbjct: 248 SMDWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKYANDPL 307

Query: 324 LPVEVTKNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTV 383
           +P     N  ++M L A+F GW             +LNLR Y+ LWAG +YFMF IWG +
Sbjct: 308 IPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGII 367

Query: 384 AAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSF 443
           AA+ VG  IK+I  + ILF+SM+AF+ G IMLSVTPVDQTYFRM LG MIILSFGMD+SF
Sbjct: 368 AAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSF 427

Query: 444 PAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGA 502
           PA++IILSD L M+ QGMAGSL +TM+NYSMS+CLG+  TVE QINK+G+DLLKGYR A
Sbjct: 428 PASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAA 486

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/507 (56%), Positives = 354/507 (69%)

Query: 36  EEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNI 95
           E++     S   T     S WQ+P YF +  +E +FI +CM++QLLNQA     L+IMN+
Sbjct: 37  EDVTTVASSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNV 96

Query: 96  ITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLT 155
           ++ SFNSE  K+ WL+ASFPLV+GSFILISGR+GDIYGLKK L+ GY+  I+WS+I GL+
Sbjct: 97  LSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLS 156

Query: 156 KYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFG 215
           KYS++D FFI  RAFQGL IAFILPNVMG+VG++YK  S RKN+VIS IGA AP G  FG
Sbjct: 157 KYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAGGMFG 216

Query: 216 SLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVI 275
            LF GLI  ED +QWPW FYAFAIA   N+ ++ YSIPN++PTNVHGF+MDW GSVLAVI
Sbjct: 217 GLFGGLIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVI 276

Query: 276 GLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHII 335
           GLIL NFVWNQ P  GW TAYII               YEVKYA+ PLLP  VTKNRH+I
Sbjct: 277 GLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMI 336

Query: 336 MILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKI 395
           MIL A+FLGW              LNLRHYS +W G TYF+F I+GT+AA +V   IK++
Sbjct: 337 MILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRV 396

Query: 396 SAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLT 455
             AF+L  ++VAF++G IM SV PV Q+++++N G   IL FGMD+SFPA++IILSDGL 
Sbjct: 397 GPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLP 456

Query: 456 MQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEXXXXXXXXXXXX 515
           M+YQGMAGSL NT++NYS SLCLGMG TVE QINK+G DLLKGYRGA             
Sbjct: 457 MEYQGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVL 516

Query: 516 XXXXXXXEILWGKRKQHLAANVVPDLS 542
                  E  W  R+     +V+ ++S
Sbjct: 517 ISFTYMLETFWNNRRDRQKDSVITEMS 543

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/453 (62%), Positives = 344/453 (75%)

Query: 50  QLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETW 109
           Q  +S WQNPDYF + ++EY+F+ +CM++ LLNQA   Q LS MN+I+DSF+S  G +TW
Sbjct: 57  QENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTW 116

Query: 110 LIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRA 169
           L+ASFPLVSGSFILISGR+GDIYGLK+ ++GG+IF IIWS+I G T Y+HSDTFFIV+RA
Sbjct: 117 LMASFPLVSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARA 176

Query: 170 FQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQ 229
           FQGL I+FILPNVMG+VGNIYK  + RKN+VIS+IG  AP G+ FG+L+ GLI TE+P Q
Sbjct: 177 FQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQ 236

Query: 230 WPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPI 289
           WPW FYA+A+A+A  L +  Y++P+++PTNV+GF MDWIGSVL VIGLIL NFVWNQGPI
Sbjct: 237 WPWIFYAYAVAAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPI 296

Query: 290 VGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWXXXX 349
           VGW+ AYII               YE+KYA+ PLLP  VT+N HI+ IL  LFLGW    
Sbjct: 297 VGWEKAYIIVLLIVSVIFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFG 356

Query: 350 XXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFN 409
                     LNLR YS +W+G T+F+F I+GTVAA  V   IKK+  A +LF S + F 
Sbjct: 357 IWTFYYFAFQLNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFT 416

Query: 410 IGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTM 469
            G I++SVTPV QTY+R   G  IIL FGMD+ FPA++IILSD L MQYQGMA SL NT+
Sbjct: 417 CGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTI 476

Query: 470 VNYSMSLCLGMGTTVERQINKSGNDLLKGYRGA 502
           VNYS SLCLGMGTTVERQINKSG+DLLKGYR A
Sbjct: 477 VNYSTSLCLGMGTTVERQINKSGDDLLKGYRAA 509

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  561 bits (1447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/500 (55%), Positives = 349/500 (69%), Gaps = 4/500 (0%)

Query: 36  EEIEKDVISQTETPQL---EHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSI 92
            +I + V+   E   +     S+ QNPDYF  QW+EYLF+ S M+SQLLNQAA  Q   +
Sbjct: 15  SDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQAAALQANPL 74

Query: 93  MNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIIS 152
            +++++   ++  ++ WL+ASFPLVSGSFIL+SG++GDIYGLKKTL+GGY   +IWS+I 
Sbjct: 75  FDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLIC 134

Query: 153 GLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGA 212
           GL+ Y+H+  FFIV+R+FQGL IAF+LPNV GIVGNIYKP++  KN+V SMIGA APIGA
Sbjct: 135 GLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGA 194

Query: 213 FFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVL 272
             G LF+GLIGTE  + W W FYA+ I +A N  I+ Y IP+++PTNVH F MDW+GS L
Sbjct: 195 TLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFL 253

Query: 273 AVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNR 332
            V GLI+ NFVWNQ P  GW +AYII               +E ++A+ PLLP  V  NR
Sbjct: 254 GVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAKEPLLPRAVLFNR 313

Query: 333 HIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFI 392
            ++MILA+LFLGW             +LNLRHY+ LWAG +YFMFAI+GT+AA +VG  I
Sbjct: 314 KLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTI 373

Query: 393 KKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSD 452
            K   A IL  S++AF++G IMLSVTPVDQTYFRM+LGTM+ILSFGMD+SFPA++IILSD
Sbjct: 374 HKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSD 433

Query: 453 GLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEXXXXXXXXX 512
            L  QYQGMAGSL NTM+NYSMSLCLG+  T ERQ+NK G DLLKGYR A          
Sbjct: 434 QLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASV 493

Query: 513 XXXXXXXXXXEILWGKRKQH 532
                     E  W +R++ 
Sbjct: 494 GIFVSGAYAIEDWWTRRRER 513

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/464 (58%), Positives = 346/464 (74%), Gaps = 4/464 (0%)

Query: 39  EKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITD 98
           E+D  ++   P+   S+ QNPDYF   W+EY+F+ S M+SQLLNQAAT QT  + ++++ 
Sbjct: 24  ERDGQTEAIGPK---SRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSK 80

Query: 99  SFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYS 158
             N++  ++ WL+ASFPLVSGSFIL+SG++GDIYGLKKTL+GGY+  +IWS+I GL+ Y+
Sbjct: 81  DLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYA 140

Query: 159 HSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLF 218
           H+  FF+V+R+FQGL IAF+LPNVMGIVGNIYKP++  KN+V S+IGA APIGA  G +F
Sbjct: 141 HNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVF 200

Query: 219 AGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLI 278
           +GLIG    D W W FYA+AI +A N  ++++ IPN++PTNV+ + MDWIGS + V GLI
Sbjct: 201 SGLIGART-DLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLI 259

Query: 279 LLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHIIMIL 338
           L NFVWNQ PI GW +AYII              TYE+++A+ PLLP  V  NR ++MIL
Sbjct: 260 LFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFAKQPLLPHSVLFNRKLMMIL 319

Query: 339 AALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAA 398
           ++LF GW             +LNLRHYS LWAG TYFMFAIWG VA+++VG  I K   A
Sbjct: 320 SSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPA 379

Query: 399 FILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQY 458
            ILF+SMVAF+ G IML+VTPV QTYFRM LG MIILSFGMD+SFPAA+IILSD L  QY
Sbjct: 380 VILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQY 439

Query: 459 QGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGA 502
           QGMAGSL +TM++YSMSLCLG+  T E Q+NK+G DLLKGY+ A
Sbjct: 440 QGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAA 483

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/472 (57%), Positives = 342/472 (72%), Gaps = 3/472 (0%)

Query: 34  DIEEIEKDVISQTETP---QLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTL 90
           ++   +K + ++ E P   +   S WQ+P+YF+ +W E LF+ SCMM QLLNQA +  TL
Sbjct: 26  NLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTL 85

Query: 91  SIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSI 150
           S M ++    +S   K +WL+ASFPLVSGSFILISGR+GDIYGLKK L+ GYI+  IWS+
Sbjct: 86  STMKVLERELDSSSAKSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSL 145

Query: 151 ISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPI 210
           I GL+ +SH+DTFFI SRAFQGL I+F+LPN++GIVGNIYKP + RKNIVIS+IG  API
Sbjct: 146 ICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPI 205

Query: 211 GAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGS 270
           GA FG LFAG++       WPWAFYA+ IA+     IS + IPNS+P NV+ FAMDWIGS
Sbjct: 206 GATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGS 265

Query: 271 VLAVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTK 330
            L V GL+L NFVWNQ  +VGW T YII               +E+KYA+ PLLP EVT+
Sbjct: 266 ALGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIFLIALFFIFEIKYAKVPLLPKEVTE 325

Query: 331 NRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGA 390
           +R IIMILA+L  GW             +L LR+YS +WAG T+FM +I G +AA+ VG 
Sbjct: 326 SRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGF 385

Query: 391 FIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIIL 450
            IK++  A +LF SM+AF  G I+LSVTPV +TYFR  LG M+ILSFGMD+SFPAA+IIL
Sbjct: 386 SIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIIL 445

Query: 451 SDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGA 502
           SD L+MQYQGMAGSL NT+VNYSMSL LG+G T+ERQINKSG+ LL+G+R A
Sbjct: 446 SDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAA 497

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/496 (57%), Positives = 346/496 (69%)

Query: 36  EEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNI 95
           EE+   V S   T     S WQ+P YF +  +E +FI +CM++QLLNQA     L IMN+
Sbjct: 37  EEVTTIVSSTKSTQVTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNV 96

Query: 96  ITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLT 155
           ++ SFNSE   + WL+ASFPL +GSFILISGR+GDIYGLKK L+ GY+  I+WSIISGL+
Sbjct: 97  LSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLS 156

Query: 156 KYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFG 215
           KYS+SD FFI SRAFQG+ IAFILPN+MG+VG++YK  S RKNIVIS IGA AP G  FG
Sbjct: 157 KYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTGGMFG 216

Query: 216 SLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVI 275
            LF GLI TEDP+QWPW FYAF IA+  +L ++ YSIPN+VPTN+HG +MDW GS LA+I
Sbjct: 217 GLFGGLIVTEDPNQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAII 276

Query: 276 GLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHII 335
           GLIL NFVWNQ PIVGW   YII               YE KYAE PLLP  +TKNRH+I
Sbjct: 277 GLILFNFVWNQAPIVGWDKPYIIVLLIISVIFLVAFFVYESKYAEVPLLPRAMTKNRHMI 336

Query: 336 MILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKI 395
           MIL A+FLGW              LNLRHYS +W G TYF+F I+G++AA  V   IK++
Sbjct: 337 MILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRL 396

Query: 396 SAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLT 455
             A +L  S++AF+ G IM SV PV+Q+Y+++N     IL FGMD+SFPA++IILSDGL 
Sbjct: 397 GPALLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLP 456

Query: 456 MQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEXXXXXXXXXXXX 515
           MQYQGMAGSL NT++NYS SLCLGMG TVE QINKSGNDLLKGYR A             
Sbjct: 457 MQYQGMAGSLVNTVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVV 516

Query: 516 XXXXXXXEILWGKRKQ 531
                  E LW + ++
Sbjct: 517 ISVTYMLENLWNRHRK 532

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/497 (55%), Positives = 353/497 (71%), Gaps = 1/497 (0%)

Query: 36  EEIEKDVISQTETPQLEH-SKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMN 94
           +E    V S +++ Q+ + S WQ+P YF +  +E +FI +CM++QLLNQA     L IMN
Sbjct: 35  DEEVTTVASSSKSNQISNDSPWQDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMN 94

Query: 95  IITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGL 154
           +++ SF SE   + WL+ASFPL +GSFILISGR+GDIYGLKK L+ GY+  I+WSIISGL
Sbjct: 95  VLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMIGYVIIIVWSIISGL 154

Query: 155 TKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFF 214
           +KYS++D+FFI  RAFQG+ IAFILPN+MG+VG++YK  S RKN+VIS+IGA  P GA F
Sbjct: 155 SKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALF 214

Query: 215 GSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAV 274
           G +F GLI TEDP+QWPW FYAF IA+  ++ ++ YSIPN+VPTNVHG +MDW GSVLAV
Sbjct: 215 GGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAV 274

Query: 275 IGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHI 334
           IGLIL NFVWN+ PI GW  AYII               YE+KYAE PLLP  VTKNRH+
Sbjct: 275 IGLILFNFVWNEAPIAGWDKAYIIVLLVVSVFFLVAFFVYEIKYAEVPLLPHAVTKNRHM 334

Query: 335 IMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKK 394
           IMIL A+F+GW              LNLRHYS +W G TYF+FAI+GT+AA  V   IK+
Sbjct: 335 IMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKR 394

Query: 395 ISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGL 454
           +  A +L  +++AF+ G IM SV PV+Q+Y+++N     +L FGMD+SFPA++IILSDGL
Sbjct: 395 LGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGL 454

Query: 455 TMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEXXXXXXXXXXX 514
            MQYQGMAGSL NT++NYS SLCLGMG TVE QINKSG ++L+GYR A            
Sbjct: 455 PMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGV 514

Query: 515 XXXXXXXXEILWGKRKQ 531
                   E +W +RK+
Sbjct: 515 LISVTYMLETVWNERKK 531

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/470 (56%), Positives = 339/470 (72%), Gaps = 3/470 (0%)

Query: 36  EEIEKDVI-SQTETP--QLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSI 92
           E I  D   +  E+P  +L++S  +NPDYF +  QEY FIFSCM+SQLLN A T QTLSI
Sbjct: 19  ETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSI 78

Query: 93  MNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIIS 152
           MN++T   +S    + WL+ASFPLVSGSFIL+SGR+GDIYGLKK L+ GY+  +IWS+I+
Sbjct: 79  MNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLIT 138

Query: 153 GLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGA 212
           GL+ YSHS  FFI++RAFQGL I+ +LPNV+G++G IYKP + +KN+VIS++GA +PIGA
Sbjct: 139 GLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGA 198

Query: 213 FFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVL 272
             G LF+GL+ TE    WPWAFYA+ +A+  N  IS YSIPN++PTNV+  +MDWIGS  
Sbjct: 199 TLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFT 258

Query: 273 AVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNR 332
            V+GLIL NFVWNQ P  GW +AY+I               YE++YAE+PLLP E+ +NR
Sbjct: 259 GVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYELRYAENPLLPSEIIRNR 318

Query: 333 HIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFI 392
            +IMIL A+  GW             +LNLR+YS LWAG +YF+F I GT+ A+  G  +
Sbjct: 319 QLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLM 378

Query: 393 KKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSD 452
           KKI  A +L  SMV FN+G I+ SVTPV QTYFR  LGTMIIL  GMD+SFPA++IILSD
Sbjct: 379 KKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSD 438

Query: 453 GLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGA 502
            L  Q+QGMAGSL NT++NYS SL LG+  TVE+  NK+G DLL+GYRGA
Sbjct: 439 NLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGA 488

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/497 (57%), Positives = 350/497 (70%), Gaps = 1/497 (0%)

Query: 36  EEIEKDVISQTETPQLEH-SKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMN 94
           +E    V S  E+ Q+ + S WQ+P YF +  +E +FI +CM++QLLNQA     L IMN
Sbjct: 36  DEEVTTVTSSNESNQVTNDSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMN 95

Query: 95  IITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGL 154
           +++ SFNSE   + WL+ASFPL +GSFILISGR+GDIYGLKK L+ GY+  IIWSIISGL
Sbjct: 96  VLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLLIGYVIIIIWSIISGL 155

Query: 155 TKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFF 214
           +KYS+SD FFI  RAFQGL IAFILPN+MG+VG++YK  S RKN+VIS+IGA AP G  F
Sbjct: 156 SKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAGGMF 215

Query: 215 GSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAV 274
           G +F GLI TEDP+QWPW FYAF+IA+  +L ++ YSIPN+VPTNVHG +MDW GS LAV
Sbjct: 216 GGVFGGLIVTEDPEQWPWVFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAV 275

Query: 275 IGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHI 334
           +GLIL NFVWNQ PI GW  AYII               YE+KYAE PLLP  VTKNRH+
Sbjct: 276 LGLILFNFVWNQAPIAGWGEAYIIVLLILSVFFLIAFFVYEIKYAEVPLLPHAVTKNRHM 335

Query: 335 IMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKK 394
           IMIL A+FLGW              LNLRHYS +W G TYF+F I+G++AA  V   IK+
Sbjct: 336 IMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKR 395

Query: 395 ISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGL 454
           +  A +L  +++AF+ G IM SV PV+Q+Y+++N     IL FGMD+SFPA++IILSDGL
Sbjct: 396 LGPAILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGL 455

Query: 455 TMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEXXXXXXXXXXX 514
            MQYQGMAGSL NT++NYS SLCLGMG TVERQINKSG +LLKGYR A            
Sbjct: 456 PMQYQGMAGSLVNTVINYSASLCLGMGVTVERQINKSGQNLLKGYRAAIYLGIGLASLGL 515

Query: 515 XXXXXXXXEILWGKRKQ 531
                   E  W K K+
Sbjct: 516 LISVTYMLENFWNKHKE 532

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/503 (54%), Positives = 341/503 (67%), Gaps = 6/503 (1%)

Query: 36  EEIEKDVISQTE---TPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSI 92
           + ++KD IS T+   +    +SKWQ+P YF++ WQEY FI +CM++ LLNQA   QTLS 
Sbjct: 38  DSVKKDQISITDDDVSSISNNSKWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLST 97

Query: 93  MNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIIS 152
           MN++ DS NS+G  +TWL+ASF L SGSFIL+SGRIGDIYGLK T +GG I F IWSI+ 
Sbjct: 98  MNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILC 157

Query: 153 GLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGA 212
           G++KY+ + TFFI+ RAFQGL +AF+LPNVMG+VGNIY   S RKNIVIS IG  AP+G 
Sbjct: 158 GVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQ 217

Query: 213 FFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVL 272
            FG ++ GLI   + DQWPW F+A AIA   NL + IYSIPN VPTN++   MDWIGS+L
Sbjct: 218 TFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWIGSLL 277

Query: 273 AVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNR 332
            VIGLIL+NFVWNQ PI GW  AYII               YE+K AESPLLP EVTKNR
Sbjct: 278 GVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFIYELKKAESPLLPPEVTKNR 337

Query: 333 HIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFI 392
           HI+ I+ +LFLGW              LNLRH+S LWAG+T+F+F I+G++ A+ V   I
Sbjct: 338 HIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTI 397

Query: 393 KKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSD 452
            K+  + +  +S + F  G I+ SVT  DQTY+R +LG  IIL+ GMD+SFP ++IILSD
Sbjct: 398 NKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSD 457

Query: 453 GLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEXXXXXXXXX 512
            L MQYQGM+GSL NT+ NY+ SLCLGMGTT E Q N  G D+LKGYR A          
Sbjct: 458 LLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGAL 517

Query: 513 XXXXXXXXXXEILW---GKRKQH 532
                     E LW    KR+Q+
Sbjct: 518 GFAFSFSYMAEDLWIRYRKRRQN 540

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/464 (61%), Positives = 336/464 (72%)

Query: 39  EKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITD 98
            K  I   +      S +QNP+YF+  ++E +FI SCM++QLLNQA   Q+LS MN++ D
Sbjct: 56  SKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLAD 115

Query: 99  SFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYS 158
            F S   K+ WL+ASFPLVSGSFILISGR+GDIYGLKK L  GYI   +WSII GL KY+
Sbjct: 116 YFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYT 175

Query: 159 HSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLF 218
           +SD FFIV R+FQGL IAFILPN+MG+VGNIYK  + RKNIVIS IG  AP GA  G+LF
Sbjct: 176 NSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALF 235

Query: 219 AGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLI 278
            GLI TED +QWPW FYAF IAS  N+ +++YSIPN+VPTN++   MDWIGS+L V GL+
Sbjct: 236 GGLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTNLNNLNMDWIGSLLGVSGLL 295

Query: 279 LLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHIIMIL 338
           LLN VWNQ PIVGW  AYII               YE+KYA SPLLP  V +N+ I+MIL
Sbjct: 296 LLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMIL 355

Query: 339 AALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAA 398
           AALF GW              LNLR Y+ LWAG T+FMF IWGTVAA +V   IKK+  A
Sbjct: 356 AALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPA 415

Query: 399 FILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQY 458
            +L  SMVAF+ G IMLSVTPV QTY+RMN+G  IILSFGMD+SFPA++IILSD L MQY
Sbjct: 416 VLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQY 475

Query: 459 QGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGA 502
           QGMAGSL NT+VNYS SLCLGMG TVE+Q N  G DLLKGYR A
Sbjct: 476 QGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSA 519

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/501 (52%), Positives = 331/501 (66%)

Query: 41  DVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSF 100
            V+S       E S +QNPDYF+N++QE+ FIFS M+ QLL+QA   QTLSIMN++    
Sbjct: 47  QVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKEL 106

Query: 101 NSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHS 160
           +S   ++ WL++SFPL  GSFIL+SGR+GDIYGLKK L+GGYI   +WSII GL+ Y+H+
Sbjct: 107 DSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHN 166

Query: 161 DTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAG 220
           D FFI +RAFQGL +AF LPN++G++G IY+P   RKN++IS+IGA +P GA  G LFAG
Sbjct: 167 DAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFAG 226

Query: 221 LIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILL 280
           L    D   WPW+FYAF + S  NL IS Y IPNS+PTN+HG  MDW+GSVL V GLI+L
Sbjct: 227 LTVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIIL 286

Query: 281 NFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHIIMILAA 340
           NFV+NQ PIVGWQ+AYII               YEVKYA++PL+P  ++ NR ++MIL +
Sbjct: 287 NFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFS 346

Query: 341 LFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFI 400
           LF GW              LNLRHYS LWAG++YF+F I G+  A++ G  IKKI  + +
Sbjct: 347 LFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVL 406

Query: 401 LFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQG 460
              SM+ F  G I+ + TPV+QT+FR  LG M +L  GMD SFPA++IILSD L MQYQG
Sbjct: 407 FCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQG 466

Query: 461 MAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEXXXXXXXXXXXXXXXXX 520
           MAGSL NT++NYS S+CLGM  TVE + N  G DLL GYR A                  
Sbjct: 467 MAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGY 526

Query: 521 XXEILWGKRKQHLAANVVPDL 541
             E LW  R   L  N   D+
Sbjct: 527 MIECLWKDRVLSLEENKQTDI 547

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  513 bits (1320), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 244/470 (51%), Positives = 330/470 (70%), Gaps = 1/470 (0%)

Query: 33  GDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSI 92
           G I  +  D    +E  Q E+ K  +P YF+N+  EYLFI SCM+SQ ++QA   Q LSI
Sbjct: 64  GSISSVSNDSDINSENLQSEN-KVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSI 122

Query: 93  MNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIIS 152
           MNI+ +  N+E  ++ WL+ASF L  GSFIL+SGR+GDIYGLKK L+GGY    IWS+I 
Sbjct: 123 MNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLIC 182

Query: 153 GLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGA 212
           G + YSH+D FFI SRAFQGL +AF+LPN +G++G IY+P S +KN++I  +GA +PIGA
Sbjct: 183 GFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGA 242

Query: 213 FFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVL 272
             G LFAG+IGT+DP QWPW+FY+F I S  N+ +S YSIPN++PTN++  +MDWIG++L
Sbjct: 243 TLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWIGAIL 302

Query: 273 AVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNR 332
            + GL++LNFV+NQ PIVGWQ+AYII               YEVKYA++PL+P  ++ NR
Sbjct: 303 GIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNR 362

Query: 333 HIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFI 392
            ++MIL ALF GW             +LN+R Y+A WAG +YF+F + G   A + G  +
Sbjct: 363 GMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMM 422

Query: 393 KKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSD 452
           KK+  + IL++SM+ F  G +ML+VTP+ Q+YF+  LG M +L  G+D+SFPAA+IILSD
Sbjct: 423 KKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSD 482

Query: 453 GLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGA 502
            L +QYQGMAGSL  T+ NYS S+CLGM  +VE   N +G ++LKGYR A
Sbjct: 483 ALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNA 532

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  508 bits (1309), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 254/483 (52%), Positives = 316/483 (65%), Gaps = 2/483 (0%)

Query: 57  QNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPL 116
           Q P YF ++  E+ FIF+C+M QLLNQA T Q++SIMNII + F SE  K+ WL ASFPL
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125

Query: 117 VSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIA 176
           VSGSFIL+ GR GDIYGLKK L+ GY    IWSII GLT Y+HSD FFIV++AFQGL ++
Sbjct: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185

Query: 177 FILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYA 236
           FILPN++G+VG IY+P S +KNI IS IGA AP+GA FG LF+G++  +D   WPW FYA
Sbjct: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245

Query: 237 FAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAY 296
           FAI S        + +P++VPTN +   MDWIGS + V+GL+L +FVWNQ P+ GW  AY
Sbjct: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAY 305

Query: 297 IIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWXXXXXXXXXXX 356
           II               YE+ YAE PLLP  +T NRHIIMIL A+F+GW           
Sbjct: 306 IIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365

Query: 357 XXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLS 416
              LNLRH+S +W G  YF F + G   A  VG  IK I  + IL +S+  F +G ++ +
Sbjct: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFA 425

Query: 417 VTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSL 476
           VTP DQTY+R   G M++L  GMD+SFPA++IILSD L  +YQGMAGSL NTMVNYS S 
Sbjct: 426 VTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485

Query: 477 CLGMGTTVERQINKSGNDLLKGYRGAEXXXXXXXXXXXXXXXXXXXEILWG--KRKQHLA 534
           CLG+ TTVE+QIN SG+DLLKGYR A                    E  W   K K  LA
Sbjct: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545

Query: 535 ANV 537
            ++
Sbjct: 546 NDI 548

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  384 bits (986), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 195/485 (40%), Positives = 279/485 (57%)

Query: 52  EHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLI 111
           E    + PD F+N++QE+ F+   ++ Q L+Q    Q LS MNI+ +  ++   ++ WL+
Sbjct: 106 ESQNLRRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQPWLM 165

Query: 112 ASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQ 171
           A+FPL  G  ILISGR+GDI+GLKK L+ GYI   IW++I G + Y+HSD  FIVSR FQ
Sbjct: 166 AAFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRTFQ 225

Query: 172 GLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWP 231
           GL +A  LPN+  ++G IYKP   +KN++  +IGA +PIGA  G +FAGL    +   WP
Sbjct: 226 GLGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKNWP 285

Query: 232 WAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVG 291
           W+FY+FAI +  N  I+ + IPN +  N  G  MDWIGS L + GL++LNFV+NQ PI G
Sbjct: 286 WSFYSFAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPIDG 345

Query: 292 WQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWXXXXXX 351
           W +AY+I               YE+  A  PL+P  +  N  +I+IL  LF GW      
Sbjct: 346 WSSAYLIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYRLILILLTLFCGWGGFAIW 405

Query: 352 XXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIG 411
                   LNLRHYS LWA ++ F+  I GT+  +I    ++++    +LF SM+ F  G
Sbjct: 406 TFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSMLGFLGG 465

Query: 412 IIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVN 471
            I+ +VTP+ QT+FR   G+M +   GM  SFP+A+++ ++ L   Y+ MAGSL N  +N
Sbjct: 466 NILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLVNVAIN 525

Query: 472 YSMSLCLGMGTTVERQINKSGNDLLKGYRGAEXXXXXXXXXXXXXXXXXXXEILWGKRKQ 531
           Y+ S+C+GM  +     N  G DLL G+R A                      +W  R Q
Sbjct: 526 YATSICVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGSIWTDRNQ 585

Query: 532 HLAAN 536
            +  N
Sbjct: 586 KMKEN 590

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  293 bits (751), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 172/462 (37%), Positives = 258/462 (55%), Gaps = 15/462 (3%)

Query: 47  ETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEG-G 105
           E  Q  H+  Q P+       E  F+     +QL+ QA   Q+++ ++II DSF +   G
Sbjct: 27  ELSQPHHNGIQKPESLLG---EAAFVGVICGAQLMTQAGLGQSIAPLHIIGDSFGTRNPG 83

Query: 106 KETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFI 165
           + +W  A++ L  G+FILI+GR+GD+YG KK  + G+ ++ +WS+++G + YS+   FF 
Sbjct: 84  QLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWYALWSLLAGFSVYSN-QIFFD 142

Query: 166 VSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTE 225
             RAFQG+  A +LPN + I+G  Y P   RK +++S+ GA+AP G   G++F+ + G  
Sbjct: 143 CCRAFQGIGPALLLPNAIAILGRTYVP-GRRKAMILSLFGATAPAGFVLGAVFSSIFG-- 199

Query: 226 DPDQWPWAFYAFAIASAFNLAISIYSIPN----SVPTNVHGFA-MDWIGSVLAVIGLILL 280
               WPWA++A  I   F     I  IP      + T+V  +  +D  GSV  VIGL+LL
Sbjct: 200 QLTWWPWAYWAMGIVCFFLAVAGILVIPRMPLPELDTSVSTYQRLDIPGSVTGVIGLVLL 259

Query: 281 NFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHIIMILAA 340
           NF WNQGP+VGWQT Y                  E + A  PLLP+    +     +L  
Sbjct: 260 NFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESR-APHPLLPLSALSS-DAAFVLGC 317

Query: 341 LFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFI 400
           +  GW             L  LR +S L     +   AI G  AA+  G  I ++ A+ +
Sbjct: 318 VGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPVAISGLCAALTTGFVITRVRASLV 377

Query: 401 LFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQG 460
           +  +M AF +G I+++  PV Q Y+     ++I++ +GMDMSFPAA I+LSD +  ++QG
Sbjct: 378 MLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQG 437

Query: 461 MAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGA 502
           +A SL N +VNYS+S+ LG+  TVE ++N  G +LLKGYRGA
Sbjct: 438 LAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLKGYRGA 479

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  287 bits (735), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 173/475 (36%), Positives = 271/475 (57%), Gaps = 21/475 (4%)

Query: 34  DIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIM 93
           ++E ++KD    ++   ++  K ++  +      E  F+     +QL+ QA   Q+L+ +
Sbjct: 15  NVETLKKDDEVLSDEFDVQEEKPESLLW------ESAFVGVLCSAQLMTQAGLGQSLAPL 68

Query: 94  NIITDSFNSEG-GKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIIS 152
           +II DSF +   G+ +W  +++ L  G+FILI+GR+GDI+G KK  V G+ ++ +WS+++
Sbjct: 69  HIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLA 128

Query: 153 GLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGA 212
           G + YS+   FF   RAFQG+  AF+LPN + I+G  YKP   RKN+V S+ GASAP G 
Sbjct: 129 GFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAILGRTYKP-GRRKNMVFSLFGASAPGGF 186

Query: 213 FFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAIS-IYSIPNSVPTN--VHGFAM---- 265
             G++F+ ++G      WPWA++   IA  F LA++  Y IP++   N  V  F +    
Sbjct: 187 VLGAVFSSMLG--QLAWWPWAYWLMGIA-CFLLAVAGYYLIPHTPMPNRDVASFKLLERI 243

Query: 266 DWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLP 325
           D+ GSV  V+GLIL NF WNQGP+VGWQT Y                  E + A  PLLP
Sbjct: 244 DFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESR-AAFPLLP 302

Query: 326 VEVTKNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAA 385
                +     +L+ +  GW             + + R  + L +   +   AI G  AA
Sbjct: 303 FAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAA 361

Query: 386 VIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPA 445
           ++ G  +     + ++F +M AF +G I+++  PV QTY+     ++I++ +GMDMSFPA
Sbjct: 362 LMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPA 421

Query: 446 AAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYR 500
           A I+LSD +  ++QG+A SL NT+VNYS+S+ LG+  T+E  +N  G ++LKGYR
Sbjct: 422 ATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYR 476

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  286 bits (731), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 176/476 (36%), Positives = 269/476 (56%), Gaps = 22/476 (4%)

Query: 39  EKDVISQTETPQLEHSKWQNPDYFQNQ------WQEYLFIFSCMMSQLLNQAATPQTLSI 92
           +K++ +  ET + +     N    Q++      W E  F+     +QL+ QA   Q+++ 
Sbjct: 9   QKNLETSAETTKTDDEVLLNQFELQDETPGSLVW-EAAFVGVLCSAQLMTQAGLGQSIAP 67

Query: 93  MNIITDSFNSEG-GKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSII 151
           ++II DSF +   G+ +W  +S+ L  G+FILI+GR+GDI+G +K  + G+ ++ +WS++
Sbjct: 68  LHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSLL 127

Query: 152 SGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIG 211
           +G + YS+   FF   RAFQG+  AF+LPN + I+G  YKP   RKN+V S+ GASAP G
Sbjct: 128 AGFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG-KRKNMVFSLFGASAPGG 185

Query: 212 AFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIY-SIPN-SVPT-NVHGFAM--- 265
              G++F+ ++G      WPWA++   IA  F LA++ Y  IP+  +P+ +   F M   
Sbjct: 186 FVLGAVFSSMLG--QLAWWPWAYWIMGIA-CFLLAVAGYFVIPHVQMPSRDSPSFNMLER 242

Query: 266 -DWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLL 324
            D+ GSV  VIGLIL NF WNQGP+VGW+T Y                  E + A  PLL
Sbjct: 243 VDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESR-AAYPLL 301

Query: 325 PVEVTKNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVA 384
           P     +     +L  +  GW             +   R  S L +   +   AI G  A
Sbjct: 302 PFAALSS-DAAFVLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAISGFCA 360

Query: 385 AVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFP 444
           AV  G  +    A+ ++  +M AF +GII+++  PV QTY+     ++I++ +GMDMSFP
Sbjct: 361 AVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420

Query: 445 AAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYR 500
           AA I+LS+ +  ++QG+A SL NT+VNYS+S+ LG+  T+E Q+N  G + LKGYR
Sbjct: 421 AATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYR 476

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  284 bits (727), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 166/441 (37%), Positives = 251/441 (56%), Gaps = 15/441 (3%)

Query: 68  EYLFIFSCMMSQLLNQAATPQTLSIMNIITDSF-NSEGGKETWLIASFPLVSGSFILISG 126
           E  F+     +QL+ QA   Q+L+ ++II +SF  +  G+ +W  +++ L  G+FILI+G
Sbjct: 42  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAG 101

Query: 127 RIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIV 186
           R+GDI+G KK  V G+ ++ +WS+++G + YS+   FF   RAFQG+  AF+LPN + I+
Sbjct: 102 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAIL 160

Query: 187 GNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLA 246
           G  YKP   RKN+V S+ GASAP G F G++F+ ++G      WPWA++   IA  F LA
Sbjct: 161 GRTYKPG-RRKNMVFSLFGASAPGGFFLGAVFSSMLG--QLAWWPWAYWIMGIA-CFVLA 216

Query: 247 ISIYSIPNSVP---TNVHGFAM----DWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIX 299
           ++ Y +    P    +   F +    D+ GSV  V+GLIL NF WNQGP+VGWQT Y   
Sbjct: 217 VAGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYA 276

Query: 300 XXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWXXXXXXXXXXXXXL 359
                          E + A  PLLP     +     +L+ +  GW             +
Sbjct: 277 LLIVGTFFLVIFAYIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFM 334

Query: 360 LNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTP 419
            + R  + L +   +   AI G  AAV  G  +     + ++  +M AF +G I+++  P
Sbjct: 335 EDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAP 394

Query: 420 VDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLG 479
           V QTY+     ++I++ +GMDMSFPAA I+LSD +  ++QG+A SL NT+VNYS+S+ LG
Sbjct: 395 VHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLG 454

Query: 480 MGTTVERQINKSGNDLLKGYR 500
           +  T+E ++N  G   LKGYR
Sbjct: 455 IAGTIESRVNDGGAKPLKGYR 475

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  281 bits (718), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 165/453 (36%), Positives = 255/453 (56%), Gaps = 14/453 (3%)

Query: 57  QNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEG-GKETWLIASFP 115
           QN   + +  +E   I     +QL+ QA   Q++  + II DSF  +  G+ +W  ++F 
Sbjct: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77

Query: 116 LVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSI 175
           L  G+FILI+GR+GD +G KK  V G++++ +WSI++G + YS+   FF   RAFQG+  
Sbjct: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSN-QIFFDCCRAFQGIGP 136

Query: 176 AFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFY 235
           AF LPN + I+   Y+P   ++N++ S+ GA AP G   G++F+ L+   +   WPWA++
Sbjct: 137 AFTLPNAIAIIARTYRPG-RKQNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYW 193

Query: 236 AFAIASAFNLAISIY-SIPNSVPTNVHGFA-----MDWIGSVLAVIGLILLNFVWNQGPI 289
              I + F L ++ Y  IP+  P +          +D  GSV  V+GLIL NF WNQGP+
Sbjct: 194 IMGI-TCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPV 252

Query: 290 VGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWXXXX 349
           VGW+T+Y                  E + A+ PLLPV    +   I ++  +  GW    
Sbjct: 253 VGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVR-KLSSDTIFVMGCIAAGWSSFG 310

Query: 350 XXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFN 409
                    + NLR    L +   +   AI G  AA+     + + S + ++ ++M+AF 
Sbjct: 311 IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFT 370

Query: 410 IGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTM 469
           +G I+++  PV QTY+     ++I++ +GMDMSFPAA IILS  +   +QG+A SL NT+
Sbjct: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430

Query: 470 VNYSMSLCLGMGTTVERQINKSGNDLLKGYRGA 502
           +NYS+S+ LG   T+E QI+   +DLLKGYRGA
Sbjct: 431 INYSISIGLGFAGTIESQISDGEDDLLKGYRGA 463

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  281 bits (719), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 166/479 (34%), Positives = 262/479 (54%), Gaps = 19/479 (3%)

Query: 34  DIEEIEKDVIS----QTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQT 89
           ++E +E   +     + E+ QL  S  + P   Q+  +E LF+     +QL+ QA   Q+
Sbjct: 4   ELESLEAQFVELKNEEGESLQLVQSHVEKP---QSLMREALFVGILSCAQLMTQAGLAQS 60

Query: 90  LSIMNIITDSFN-SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIW 148
           ++ + II +SF  S  G+ +W  A++ L  G+FILI+GR+GD++G KK  V G++++ +W
Sbjct: 61  IAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLW 120

Query: 149 SIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASA 208
           S+++G + YS+   FF   RA QG+  AF+LPN + I+G  Y P   RK +V S+ GA+A
Sbjct: 121 SLLAGFSVYSN-QIFFDCCRALQGIGPAFLLPNSIAILGRTYTPG-KRKQMVFSIFGATA 178

Query: 209 PIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFA---- 264
           P G   GS+F+ +        WPWA++A   A        I  IP + P  +   A    
Sbjct: 179 PGGFVLGSVFSSIF--SQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILE 236

Query: 265 -MDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPL 323
            +D  G+   ++GL L+NF WNQGP+VGWQT Y                  E + A  PL
Sbjct: 237 RIDAAGATTGILGLALVNFAWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIESR-ARFPL 295

Query: 324 LPVEVTKNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTV 383
           LP        +  +L  +  GW             L + R  S L     +   AI G  
Sbjct: 296 LPFAALST-DLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLC 354

Query: 384 AAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSF 443
           AA+  G  +  + A  ++ ++M+AF +G ++++  P++QTY+     ++II+ +GMDMSF
Sbjct: 355 AALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSF 414

Query: 444 PAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGA 502
           PAA I++S+ +  ++QG+A SL NT+VNYS+SL LG   T+E ++N  G + L+GYRGA
Sbjct: 415 PAATIMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGA 473

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  277 bits (709), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 161/440 (36%), Positives = 245/440 (55%), Gaps = 13/440 (2%)

Query: 68  EYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEG-GKETWLIASFPLVSGSFILISG 126
           E  F+     +QL+ QA   Q+L+ ++II  SF +   G+ +W  +++ L  G+FILI+G
Sbjct: 43  ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAG 102

Query: 127 RIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIV 186
           R+GDI+G KK  V G+ ++ +WS+++G + YS+   FF   RAFQG+  AF+LPN + I+
Sbjct: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 187 GNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLA 246
           G  YK    RKN+V S+ GA AP G   G++F+ L+G      WPWA++   IA  F   
Sbjct: 162 GRTYK-SGKRKNMVFSLFGACAPGGFVLGAVFSSLLG--QLAWWPWAYWIMGIACFFLAI 218

Query: 247 ISIYSIPNSVPTNVHGFA------MDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIXX 300
              + IP++   + H  +      +D+ GSV  VIGLIL NF WNQGP+VGWQT Y    
Sbjct: 219 AGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYIL 278

Query: 301 XXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWXXXXXXXXXXXXXLL 360
                         E + A  PLLP     +     +L+ +  GW             + 
Sbjct: 279 LIVGTVFLAIFAFIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFME 336

Query: 361 NLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPV 420
           + R  + L +   +   A+ G  AA+  G  + +   + ++  +M AF  G I+++  PV
Sbjct: 337 DSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPV 396

Query: 421 DQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGM 480
            QTY+     ++I++ +GMDMSFPAA I+LSD +  ++QG+A SL NT+VNYS+S+ LG+
Sbjct: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456

Query: 481 GTTVERQINKSGNDLLKGYR 500
             T+E  +N  G   LKGYR
Sbjct: 457 AGTIESNVNDGGAKPLKGYR 476

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  277 bits (708), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 161/471 (34%), Positives = 259/471 (54%), Gaps = 15/471 (3%)

Query: 36  EEIEKDVISQTETPQ--LEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIM 93
           E  E+ +    E+ +   +   W     F    +EY F+F+ +M+Q  NQA     L ++
Sbjct: 16  ECTERSISCNQESSKEAYDRCSWLKSSNFHFLCKEYAFVFTGVMAQAFNQAGGTMILPLV 75

Query: 94  NIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISG 153
           N+++DSF+ +     +L+ S+P+V GSF+LI GR+G+++G K+TL+GGYI  I+ S++ G
Sbjct: 76  NVLSDSFHGK-----FLLNSYPMVCGSFMLIGGRLGEVHGYKETLLGGYIILILSSLLGG 130

Query: 154 LTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDS--NRKNIVISMIGASAPIG 211
           L++YS S  F+++ RAFQG+ +A ILPN        Y+  +  +RK I+ ++IG  A  G
Sbjct: 131 LSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHRKTILSTIIGCGASTG 190

Query: 212 AFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGF--AMDWIG 269
           AF G+  +G+  T     W WA+Y + IA+   LA+S YS+P+++          + W  
Sbjct: 191 AFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVPDNITKKNKPCLNGLGWFS 250

Query: 270 SVLAVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVT 329
           +     GL++LN   N   +     ++II               +E+K++E P+   E+ 
Sbjct: 251 N--RSCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFELKFSEDPVFSKELF 308

Query: 330 KNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVG 389
            N  + ++LA++F GW             LLNLR+YS L AG+TY    I G VA + + 
Sbjct: 309 TNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYLTLVIGGYVAEIGIS 368

Query: 390 AFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAII 449
             +K+      L  S + F   II+LSVTP+ Q+YFR  LG+MI L+ G+D SFP++AII
Sbjct: 369 MLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFLALGLDFSFPSSAII 428

Query: 450 LSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYR 500
           L + L  +Y  M   L N + NY++S   G+  +  R +  S  +L+K YR
Sbjct: 429 LQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSL--SSIELIKYYR 477

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  170 bits (431), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 120/190 (63%), Gaps = 34/190 (17%)

Query: 76  MMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLK 135
           MMSQLLNQ  T QTL ++N+++  F S   ++T L+AS PLVSGSFIL+SG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 136 KTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSN 195
            TL+ GY   I+WS I GLT+Y+ S  FF+++RAFQGL +AF+LPNVMG V N+Y   S 
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 196 RKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNS 255
           RKN+V                                  YA+ +A + N+A+ ++++P +
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 256 VPTNVHGFAM 265
           +PTNV G AM
Sbjct: 147 IPTNVRGQAM 156

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 466 ANTMVNYSMSLCLGMGTTVERQINKSGNDLL 496
              M+ YSM +CLG+  TVE +++K G D L
Sbjct: 153 GQAMLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  177 bits (448), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 125/463 (26%), Positives = 213/463 (46%), Gaps = 18/463 (3%)

Query: 34  DIEEIEKDVISQTETPQLEHSKWQNPDYFQNQ--WQEYLFIFSCMMSQLLNQAATPQTLS 91
           D ++   D+      P+         +   N     E +F+     SQ+L  A   Q + 
Sbjct: 42  DSDDNVSDINKSAPAPEEHDPPCTGEEATLNMSLLHEIIFVLLVSSSQVLGLAGAVQGIP 101

Query: 92  IMNIITDSFN-SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSI 150
            M++I + F  +      W    +    GSF+LI+G++GD+ G K   + GY +  +WS+
Sbjct: 102 QMDVIVEWFKLTHPSDSGWCNGGYATTYGSFVLIAGKMGDMNGHKSMFLIGYAWLALWSL 161

Query: 151 ISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPI 210
           ++G ++Y  S  FF   RA QG+  AF   + + I+G  Y P   RKN + S  GA    
Sbjct: 162 LTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSALSILGKSYPP-CKRKNFIFSFFGACGSF 220

Query: 211 GAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSV-----PTNVHGFAM 265
           G   G +F+ L        W WA+++ AIA    + +SI+ IP  V      +NV  F  
Sbjct: 221 GVVLGMVFSALF--TQLAHWSWAYWSMAIACVVIIILSIFFIPGDVVEKHETSNV--FYF 276

Query: 266 DWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLP 325
           D++G+ L V GL+L +  WNQ P  G+   Y+                 E K  + PLLP
Sbjct: 277 DYLGAFLFVTGLVLFSVAWNQAPTYGFGRTYVYVLLIVSVVILALAMYVETK-VDDPLLP 335

Query: 326 -VEVTKNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVA 384
              ++ N   + +L A+F  +              L  +  + L A       A+ G  A
Sbjct: 336 WTHISANT--LKVLLAIFFAYASFTMWAAYTFRFNLMAKGDTLLLAAAKMTPMAVSGVFA 393

Query: 385 AVIVGAFIK-KISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSF 443
           A+     +   +     + +S++AF +  I+++     QTY+     T I++SFG+D+SF
Sbjct: 394 ALFSALLLNIHVQVQIRMLISLLAFLVPPILMATMGAGQTYWGEVFVTTIVISFGLDISF 453

Query: 444 PAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVER 486
           P+A ++LS+ +  +++G+  SL   ++NY+ +L      +V R
Sbjct: 454 PSATLLLSNRIPDKFKGLGASLVGAVLNYATALGPPTAASVLR 496

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  146 bits (369), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 116/445 (26%), Positives = 210/445 (47%), Gaps = 16/445 (3%)

Query: 65  QWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKET---WLIASFPLVSGSF 121
           Q++E + +      Q ++     Q +  M  I  +F+    +     W  A++   + +F
Sbjct: 45  QFKEIIIVLLISSGQFISLLGAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTF 104

Query: 122 ILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSD-TFFIVSRAFQGLSIAFILP 180
           ++I+G++GDI G K   + GY +  +WS+++G +KY+ ++  FF   R  QG+  AF+ P
Sbjct: 105 VIIAGKLGDINGHKNMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTP 164

Query: 181 NVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIA 240
             + ++G  Y P   RKN V S  GA  P G   GS+F+ L        W W +++ A+ 
Sbjct: 165 TGLALLGKHYPP-CKRKNYVFSFYGACGPFGIVAGSVFSALF--TQLTTWAWTYWSMAVT 221

Query: 241 SAFNLAISIYSIP-NSVPTNVHG--FAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYI 297
                 +S   IP ++ P       ++ D++G    + G+IL + VWNQ P+  ++  Y+
Sbjct: 222 CLIITILSYIFIPKDNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYV 281

Query: 298 IXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWXXXXXXXXXXXX 357
                            + +  + PL+P + +   ++I  L  +F G+            
Sbjct: 282 YSLLIVSVVFMTMALIIDSR-VKDPLIPWK-SMCSNVIKALIVVFFGFLGFTIWLFYSWR 339

Query: 358 XLLNLRHYSALWAGTTYFMFAIWGTVAAVI-VGAFIKKISAAFILFMSMVAFNIGIIMLS 416
             L  ++ S L A   +    I G  AA   V    KK+     L  ++ AF I  I++S
Sbjct: 340 FYLVAKNDSLLLAAAKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILIS 399

Query: 417 VTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSL 476
              + +TY+       +I++ G+D++FP+A ++LS+G+  + QG+A +LA T +NY  +L
Sbjct: 400 TMTLQETYWGNAFVATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTAL 459

Query: 477 CLGMGTTVERQINKSGNDLLKGYRG 501
             G+ T +   I    +D L    G
Sbjct: 460 GPGVATLI---ITYQCDDCLARSDG 481

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  138 bits (348), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 121/451 (26%), Positives = 206/451 (45%), Gaps = 32/451 (7%)

Query: 67  QEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSE---GGKETWLIASFPLVSGSFIL 123
           +E   +   + SQL+      Q + I   + + +  E   GG   W  AS+ L S   +L
Sbjct: 37  REIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSAVMVL 96

Query: 124 ISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSD-TFFIVSRAFQGLSIAFILPNV 182
           I+G++GD+ G K+ +V G+I+  IWS+I+G + Y   +  F+  +RA QG+   FI+PN 
Sbjct: 97  IAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFIVPNS 156

Query: 183 MGIVGNIYKPDSNRKNIVISMIGASAP----IGAFFGSLFAGLIGTEDPDQWPWAFYAFA 238
           + I+G  Y     +K I+ S+ G        IG  F SLFA L       +W W ++A A
Sbjct: 157 LAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQL------TKWAWNYWALA 210

Query: 239 IASAFNLAISIYSIP--------NSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIV 290
                    +I  IP        NS P        D++G++  V GL+L +  + Q   +
Sbjct: 211 CVCVLYTVGAILFIPPDNIVHKPNSKPLYKR---FDYLGAITGVSGLVLFDVAFTQASAL 267

Query: 291 GWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWXXXXX 350
           GW   +                  + +  + PL+P++  +   +++IL  ++ G+     
Sbjct: 268 GWSPPHTYITLIIGVILILIAMFVDWR-VDDPLVPLQHLR-ADVVVILICVYFGFLSFVI 325

Query: 351 XXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVI--VGAFIKKISAAFILFMSMVAF 408
                      + + S L         AI G++ A I  V      I A  ++ +SMV F
Sbjct: 326 WANWFWQFYELVHNDSPLRIAAKLVPLAI-GSIPAAIFTVTCLQLNIKAPTMMVISMVCF 384

Query: 409 NI-GIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLAN 467
            +  I+M +VTP + TY+     + II  F +D++ P A ++ SD +  + QG+A SL  
Sbjct: 385 LVPNILMATVTP-NTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLII 443

Query: 468 TMVNYSMSLCLGMGTTVERQINKSGNDLLKG 498
           T+++Y++S+       V   +   GND   G
Sbjct: 444 TVISYAISIGPSYTAMVMWYVAPLGNDSTPG 474

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  136 bits (342), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 116/458 (25%), Positives = 207/458 (45%), Gaps = 34/458 (7%)

Query: 50  QLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKET- 108
           QLE     NP    ++ +E +FI     SQ ++ AA  Q +  M+ IT  F     +   
Sbjct: 56  QLES---MNPPPGPSRLRECMFIVIIASSQFISLAAASQAILQMDAITAWFQLPADRSLE 112

Query: 109 --WLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSD--TFF 164
             W  A+F +  G+FI+ +G++ D+ G K   + GY ++ +WS++ G+++Y+     TFF
Sbjct: 113 AGWANAAFAITCGTFIIPAGKLCDLIGSKTVFIFGYAWYTLWSLLVGISRYAPKGQATFF 172

Query: 165 IVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGT 224
              R  QG+  A + P+ + ++G  Y P S +KNIV S+ G   P+G   G +F+ +   
Sbjct: 173 FFGRGCQGIGAAALFPSSLALLGKYYPP-SCKKNIVFSLYGFCVPLGVVVGGVFSAIF-- 229

Query: 225 EDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNV-------------HGFAMDWIGSV 271
                W W +++ AI SAF   IS + IP   P  +             H    D++G+ 
Sbjct: 230 TQLAHWSWNYWSMAIVSAFFTLISCFYIP---PDEIIKSEEQKKKRAWFHLPKFDYLGTF 286

Query: 272 LAVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKN 331
           L V  L+L    WNQ     +++  +                 E  Y + P++P      
Sbjct: 287 LYVASLLLFAVCWNQATGFKFKSVQVYVTLIVSLVCFVAMVIVEF-YVDDPIIPARKIHP 345

Query: 332 RHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAF 391
           + I  +L  +F  +                +R+ + L     +   +I G +AA+     
Sbjct: 346 QTIKALLV-VFFSYLSFTIWLFYLWKYFTVVRNDTVLLGAAKFVPLSIAGFIAALFSILL 404

Query: 392 IKK-ISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIIL 450
           I   +     L     +F +  I+       ++Y+     T+II+S G+D+SFP+A ++L
Sbjct: 405 ISTAVPVQIRLLAGACSFLLAHILFITLSRTESYWARPFLTIIIISIGLDISFPSATLLL 464

Query: 451 SDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQI 488
           S+G+  + +G++ +L  T +NY      G+G  + + I
Sbjct: 465 SNGVPQELRGISAALVGTALNYGT----GIGPPIAQTI 498

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  115 bits (288), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 103/519 (19%), Positives = 220/519 (42%), Gaps = 69/519 (13%)

Query: 41  DVISQTETPQLEHSKWQNPDYFQNQWQEYL----FIFSCMMSQLLNQAATPQTLSIMNII 96
           + +   ++ ++ HS        Q+    YL    FIF    SQ +  A+  Q +  M+ +
Sbjct: 40  ETVQDQQSHKVTHSSLIRLQKLQSPTNSYLNDIIFIFLICSSQFITLASASQAILQMDSL 99

Query: 97  TDSFN---SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISG 153
           +  F    +   +  W+ ASF +  G+FI+++G++ DI   +   + GY++F +W++I+G
Sbjct: 100 SVWFKIPPTSTLQLGWVNASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWTLITG 159

Query: 154 LTKYSHSDTFFI-VSRAFQGLSIAFILPNVMGIVGNIYK--------------------- 191
              Y   +  F+ + R  QG+  A + P+ + ++   Y                      
Sbjct: 160 FASYVPKNMIFLYICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSP 219

Query: 192 ---------------------PDSN----RKNIVISMIGASAPIGAFFGSLFAGLIGTED 226
                                 DS+     K+I  S+ GA AP+G   G +F+ +     
Sbjct: 220 SHDIEKNLSSDDDNDGDSSIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAIF--TQ 277

Query: 227 PDQWPWAFYAFAIASAFNLAIS----IYSIP----NSVPTNVHGFA-MDWIGSVLAVIGL 277
              WPW +++ +I +     +S    +  IP    +S P ++  +   D++G +L +  L
Sbjct: 278 LATWPWNYWSMSIVTTLLSILSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILGISAL 337

Query: 278 ILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHIIMI 337
           IL    W+Q  +  ++T ++                +E  Y  +P++P+    +   I  
Sbjct: 338 ILFGVSWDQATMYKFKTIHVYLTLLFSLVSFIAMIIWEY-YFNNPIIPIR-QIHPGTIKA 395

Query: 338 LAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVI-VGAFIKKIS 396
           L  +F  +                ++  S +     +   ++ G ++A   +   +K++ 
Sbjct: 396 LLVVFFSYISFTQWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVP 455

Query: 397 AAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTM 456
               L     +F +  I+L    +D +Y+     ++I +S G+D+SFP+A ++L++G+  
Sbjct: 456 VQIRLLAGASSFLLSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPP 515

Query: 457 QYQGMAGSLANTMVNYSMSLCLGMGTT-VERQINKSGND 494
           + QG+  +L  +++NY  ++   +  T ++ Q     +D
Sbjct: 516 EIQGICAALVGSVLNYGTAIGPPIAQTIIQYQCESCMSD 554

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 105/249 (42%), Gaps = 17/249 (6%)

Query: 49  PQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKET 108
           P  +   +     F     ++L     +++  L+ A+    + ++  I   FN    +  
Sbjct: 2   PSEKSVTFPKGSLFHQDTLKHLKFICILIACGLDLASVGAMIVLVTDIETRFNVSHTQSG 61

Query: 109 WLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSR 168
           W + S+ +    FI   GR+GDI G    +    +F +I+ I S L     +   F V R
Sbjct: 62  WALTSYVITFAGFIAFFGRVGDIVGNGIMMC---VFSVIFGIFSLLCAVVPNFIAFTVFR 118

Query: 169 AFQGLSIAFILPNVMGIVGNIYK-PDSNRK-NIVISMIGASAPIGAFFGSLFAGLIGTED 226
           AFQG++ A I+P    +V  +++ P+  R  +I+ S+I A A +G   G  F    G   
Sbjct: 119 AFQGMAGAGIVPCAYALVNKMFQGPNLQRYFSILSSVISAMAGVGFIIGGAF----GETA 174

Query: 227 PDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHG--------FAMDWIGSVLAVIGLI 278
                + ++ FA + A    I +      +  N H         + +D IG +L + G I
Sbjct: 175 LGYKSFFYFLFAASLATAAVICVLIGYPELLLNRHSYKEKFQRVYKLDVIGCLLFISGSI 234

Query: 279 LLNFVWNQG 287
           LL     QG
Sbjct: 235 LLVVGLTQG 243

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 101/243 (41%), Gaps = 32/243 (13%)

Query: 55  KWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASF 114
           K QN  Y Q      L  F C    LLN A     +S++  + +++       +W + S+
Sbjct: 18  KCQNSRY-QLGINITLIFFGCTF-DLLNVAGV---ISVIEDLGETYKLGYTGASWALTSY 72

Query: 115 PLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLS 174
            +    FI   GR+GDI G           F ++S++  + +   +   F V RA QG+S
Sbjct: 73  AITFAGFIAFMGRLGDIVGNSVLFTISCFLFTLFSLLCAVVRDFPT---FAVFRALQGIS 129

Query: 175 IAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIG-----------------AFFGSL 217
            A I+P    ++  + +P   +K   I   G S+ IG                   F   
Sbjct: 130 AAGIVPCGYALIPLLAEPQDIQKFFSIVSCGFSSTIGIGLIVGGAFALTKVGYAGIFYLS 189

Query: 218 FAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGL 277
           FAG++          +FY + I     L + +  IP+  P      ++D++GS++ V G 
Sbjct: 190 FAGMLVVS----IAASFYTYRIEERKFLEVKVEDIPHDHPKVA---SLDFVGSLIFVSGS 242

Query: 278 ILL 280
           +L+
Sbjct: 243 VLI 245

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 88/217 (40%), Gaps = 29/217 (13%)

Query: 32  HGDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYL----FIFSCMMSQLLNQAATP 87
           HG  EE   D      +  +E     N  Y +N   E L     +++C  S  L      
Sbjct: 36  HGINEESGTDA---EVSNHVEKKPNFNSKYGKNAMGEDLPSGIVLYTCAFSLALAIFLAA 92

Query: 88  QTLSIMNIITDSFNSEGG---KETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIF 144
             + I++ I +    + G   K  W+ A + L +    L+ GRI  I G K  ++   I 
Sbjct: 93  LDIMIVSTIIEDVAKKFGAYSKTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIII 152

Query: 145 FIIWSIISGLTKYSHSDTFFIVSRAFQGL------SIAFILPNVMGIVGNIYKPDSNRKN 198
           F I S+ISG+   ++S    I  R   G+      S+AF++ + +         D  R+ 
Sbjct: 153 FEIGSLISGV---ANSMNMLIGGRVIAGVGGSGIQSLAFVIGSNL--------VDERRRG 201

Query: 199 IVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFY 235
           ++I+ + ++  + +  G    G   T     W W FY
Sbjct: 202 LIIACMSSAFAVASVIGPFLGGAFTTH--ATWRWCFY 236

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 88/201 (43%), Gaps = 11/201 (5%)

Query: 67  QEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISG 126
           Q++  +F  +M    +   +P     +  +   FN +  K    +  + L  G    +SG
Sbjct: 99  QKWGMVFLLVMCGFWSSLGSPIYYPALRQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSG 158

Query: 127 RIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIV 186
            + D++G +  ++GG + +++ SI  GL   + S       R  Q + I+  +    G+V
Sbjct: 159 GLADVFGRRPIILGGMVIYVVASI--GLA-CAPSYGVICFLRCIQSIGISPTIAISSGVV 215

Query: 187 GNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWA--FYAFAIASAFN 244
           G     D   K+   + +GA++ +    G  F  LIG     +W W   F+  AI S   
Sbjct: 216 G-----DFTLKHERGTFVGATSGL-VLLGQCFGSLIGAVLTARWDWRAIFWFLAIGSGVA 269

Query: 245 LAISIYSIPNSVPTNVHGFAM 265
           L ++ +++P +  T V   ++
Sbjct: 270 LIVAAFTLPETKRTIVGNLSI 290

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 67/146 (45%), Gaps = 8/146 (5%)

Query: 90  LSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWS 149
           ++I+N I D FN+   K  WLI  + L +  F L+ GR   I+G K TL+   I F I S
Sbjct: 41  VTILNTIADKFNAYS-KIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGS 99

Query: 150 IISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAP 209
           ++  +   S+S    I  R   G   + I   V  I  ++   D + +  +++++  S  
Sbjct: 100 LVIAV---SNSMDMIIGGRVIAGCGASGIQTLVFAIATSLV--DEHTRGTIVTLLSLSYA 154

Query: 210 IGAFFGSLFAGLIGTEDPDQWPWAFY 235
           + +  G    G +   +   W W FY
Sbjct: 155 VASALGPYIGGAL--TEYVTWRWCFY 178

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 65/143 (45%), Gaps = 8/143 (5%)

Query: 93  MNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIIS 152
           + +I + F  +  K  W+++ + L      L+ GR   I G K +L+   + F   S+IS
Sbjct: 142 IEVIAEQFK-DYSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSLIS 200

Query: 153 GLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGA 212
            +   S+S    I  R   G+  + I  ++  ++ +   PD +R  I+IS++  S  + A
Sbjct: 201 AI---SNSMNMLIGGRVVAGIGGSGI-QSLCFVIASTLTPDRSRV-IIISVLSCSYAVAA 255

Query: 213 FFGSLFAGLIGTEDPDQWPWAFY 235
             G    G + T     W W FY
Sbjct: 256 VVGPFLGGALTTH--VTWRWCFY 276

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 85/200 (42%), Gaps = 10/200 (5%)

Query: 39  EKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITD 98
            K++ +Q E+   E  +       Q+Q  +   +++C+ S  L    +   + I++ I +
Sbjct: 9   SKELCTQAESSTSEVVEQNKKVVSQDQVVKGFALYACLGSLTLALFLSALDILIVSTIIE 68

Query: 99  SFN---SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLT 155
           + +   +E  K  WL+  + L +    L+ GR   I G K +++   I F + S++S L 
Sbjct: 69  TVSRDFNEYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVGSLVSAL- 127

Query: 156 KYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFG 215
             ++S    I  R   G+  + +      I+  +    S  + + IS++  S  + +  G
Sbjct: 128 --ANSMNMLIGGRVISGVGGSGLQTLCFLIISTLVNERS--RGMAISVLSCSFAVASIVG 183

Query: 216 SLFAGLIGTEDPDQWPWAFY 235
               G   T     W W FY
Sbjct: 184 PFLGGAFTTH--VTWRWCFY 201

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 78/167 (46%), Gaps = 10/167 (5%)

Query: 72  IFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGG---KETWLIASFPLVSGSFILISGRI 128
           +++C++S +L+       + I++ I ++   E G   K  W+ A + L S    LI GRI
Sbjct: 54  LYACVISLILSIFLAALDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRI 113

Query: 129 GDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGN 188
             + G K +++   I F + S+++ L   ++S    I  R   GL  + I      I+  
Sbjct: 114 AAVCGFKSSMLTAIIIFEVGSLVAAL---ANSMDMLIGGRVIAGLGGSGIQTLCFVIIST 170

Query: 189 IYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFY 235
           +   + +++ ++I+ +G++  I +  G    G   T     W W F+
Sbjct: 171 LV--EESKRGLLIACMGSAFGIASVVGPFLGGAFTTHVT--WRWCFW 213

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 63/132 (47%), Gaps = 8/132 (6%)

Query: 42  VISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFN 101
           V  + ET  LE    Q    +     ++  +FS  +   L+        +IMN + + F 
Sbjct: 13  VPEEVETLPLE----QKFHEYNLALPKFPILFSLWLGSFLSSLDGTIVANIMNRVAEEF- 67

Query: 102 SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSD 161
           SE  ++ W+  SF L + +F  + G++ DI G K  L+  + FF I  +   LT ++ + 
Sbjct: 68  SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAHFFFGIGCL---LTCFARNV 124

Query: 162 TFFIVSRAFQGL 173
           T F ++RA  G+
Sbjct: 125 TEFSIARAICGI 136

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 103/247 (41%), Gaps = 26/247 (10%)

Query: 46  TETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGG 105
           T+  Q   +K Q   Y  N     +F+  C    LLN A+    +S+++ +   +N    
Sbjct: 10  TKALQEIRNKCQKSPYQLNVNVGLIFL-GCTF-DLLNVASM---ISLIDDLAKKYNISYT 64

Query: 106 KETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFII----WSIISGLTKYSHSD 161
             +W + S+ +    FI   GR+GDI       VG  + F I    ++I+S L     + 
Sbjct: 65  TASWSLTSYAVTFAGFIACMGRLGDI-------VGNSVLFTISCSCFAILSLLCAVMPNF 117

Query: 162 TFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGL 221
             F V RA QG+  A ++P    ++  +   +  +K   I   G S+ IG   G +  G 
Sbjct: 118 PAFAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIG--LGLIIGGA 175

Query: 222 IGTEDPDQWPWAFYAFAIAS-----AFNLAISIYSI---PNSVPTNVHGFAMDWIGSVLA 273
                       +  FA+ S     AF    ++ +    P  +       ++D+IGS++ 
Sbjct: 176 FAATKIGYRGIFYLTFAVMSLISVIAFFFTYNVENFDKKPQKIQAQTSVKSLDFIGSLIF 235

Query: 274 VIGLILL 280
           V G IL+
Sbjct: 236 VAGSILI 242

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 53/102 (51%), Gaps = 4/102 (3%)

Query: 72  IFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDI 131
           +FS  +   L+   +    +IMN + + F SE  K+ W+  SF L + +F  + G++ DI
Sbjct: 39  LFSLWLGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 132 YGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGL 173
            G K  L+    FF +  +   LT ++ + T F ++RA  G+
Sbjct: 98  TGRKSALLTAQFFFGLGCL---LTCFARNVTEFSIARAICGI 136

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 4/79 (5%)

Query: 91  SIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSI 150
           +IMN + + F SE  K+ W+  SF L + +F  + G++ D+ G K  L+  Y F +I  +
Sbjct: 57  NIMNRVAEEF-SESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIGCL 115

Query: 151 ISGLTKYSHSDTFFIVSRA 169
           ++ L +   + T F V+RA
Sbjct: 116 LTCLAR---NVTEFAVARA 131

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 4/78 (5%)

Query: 91  SIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSI 150
           +IMN I + F+ E  K+ W+  SF L + +F  + GR  DI G K  L+    FF++ ++
Sbjct: 66  NIMNKIAEEFH-ESDKKQWMATSFLLTNAAFQPLYGRCSDIVGRKCALLIAQSFFLLGTL 124

Query: 151 ISGLTKYSHSDTFFIVSR 168
              LT ++ + T F ++R
Sbjct: 125 ---LTCFARNVTEFAIAR 139

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 73/167 (43%), Gaps = 6/167 (3%)

Query: 89  TLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIW 148
           TL++  I  D F+    + TW I    ++     ++ G IGD YG K + +    F ++ 
Sbjct: 95  TLNVKKISHD-FDVTTKQVTWGITLVLMLRVVGAVLFGYIGDRYGRKVSFIINLFFMMVL 153

Query: 149 SIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASA 208
            II+G  K  H+  +F+++RAF G+ +  I  N      +   P+++  + +        
Sbjct: 154 EIITGFIK--HNFKYFLIARAFFGVVLGGIFGNSAAQCFDDCPPEAH--SFISGFFQQGY 209

Query: 209 PIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNS 255
            +G     +F   +     D+W   F+ FA    F L I    +P +
Sbjct: 210 TLGYLLAVIFTRALADTTKDRWRSCFW-FAAGITFLLIIFRALLPET 255

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 53/102 (51%), Gaps = 4/102 (3%)

Query: 72  IFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDI 131
           ++S  M   L    +    +IMN + + F  E  K+ W++ SF L + +F  + G++ D+
Sbjct: 43  LYSLWMGSFLGSLDSTIVANIMNKVAEEFE-ESDKKQWIVTSFLLTNTAFQPLYGKLSDL 101

Query: 132 YGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGL 173
            G K  L+  + FF++  + + L++   +   F ++RA  G+
Sbjct: 102 AGRKTALMVAHSFFLVGCLFTALSR---NLVEFSIARAVCGM 140

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 97/462 (20%), Positives = 175/462 (37%), Gaps = 38/462 (8%)

Query: 62  FQN-QWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGS 120
           FQN  +  Y+ +   M+S   +       LS    I +++  E    +W + ++ +    
Sbjct: 16  FQNISFHRYINLVLIMVSCAFDLINVTAVLSATRDIENTYQIEFTTASWALTAYAITFAG 75

Query: 121 FILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILP 180
           FI   GR+GDI G     V     F I S+I  +     +   F V RA QG++ A I+P
Sbjct: 76  FIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVVNNFGT---FAVFRALQGIAAAGIVP 132

Query: 181 NVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFF---GSLFAGLIGTEDPDQWPWA-FYA 236
           +   ++  +      +    I   G S   G  F   G+     IG +      +A    
Sbjct: 133 SGYALIPTLSDEHEVQSFFAIVSCGFSTSFGIGFIIGGAFTLTRIGYKGIFYLTFAVMLV 192

Query: 237 FAIASAFNLAISIYSIPNS--VPTNVH---GFAMDWIGSVLAVIGLILLNFVWNQGPIVG 291
            +I S F++  S    P +   P         ++D+IGS + +   IL+     +G    
Sbjct: 193 ISIISYFSIGTSANQKPCTKDSPKTTKWSDALSLDFIGSFMFISSTILIVVGLTEGG-ES 251

Query: 292 WQ--TAYI--IXXXXXXXXXXXXXXTYEV-----KYAESP-----------LLPVEVTKN 331
           W+  +AY+  I               Y V     K A +P           L+P +V   
Sbjct: 252 WKKPSAYVTLIVGIALFVLFFIWNICYGVLVKNLKSASNPKVYNYFRTIQVLIPKDVLMM 311

Query: 332 RHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVG-- 389
           ++ I I  A+F  +                +   S L A        +   +  V++   
Sbjct: 312 KNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVKLLPLVVSMLIPNVVIAIK 371

Query: 390 -AFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAI 448
              I    A  + F  M   +I +I L +   D  Y+++   +  +++FG  + FP +  
Sbjct: 372 SDLISPRKAVVLGFFIMFIGSIILIQLHLI-TDNLYWKIFFCSQSLIAFGAAIFFPYSLN 430

Query: 449 ILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINK 490
           IL      +Y+G+A  +  T   + + +   + T++   IN+
Sbjct: 431 ILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNINE 472

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 99/484 (20%), Positives = 184/484 (38%), Gaps = 76/484 (15%)

Query: 34  DIEEIEKDVISQTETPQLEHSK-----WQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQ 88
           +I E E D +S TE  Q+ +           +Y+    +  LF FS  ++          
Sbjct: 19  EIHEQEIDSVSSTEESQINYDTGVINIEVYSEYYSTTQRRLLFFFSIFLTTYCYTLDKRV 78

Query: 89  TLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIW 148
             +     T S+ +     T +     ++S +  +   R  DI+G    +     F++I 
Sbjct: 79  RSTFQTEATSSYKNHSLMST-VTCITTVISAAGQIAYARAADIFGRTSLVFTAIFFYVIG 137

Query: 149 SII----SGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMI 204
           +++    + +T+Y+    F+ +  A               IV  +    ++  N+   ++
Sbjct: 138 TVVESQATNITRYAVGACFYSLGHA--------------AIVLALEVLAADFSNLNYRIL 183

Query: 205 GASAP-IGAFFGSLFAGLIGTEDPDQWPWAFYAFAI---ASAFNLAISIYSIP------- 253
            ++AP +     +  +G I ++  D W W    +AI        L   ++ +        
Sbjct: 184 ASAAPMLPNVINTWISGNITSDIGDHWQWGIGMWAIIFPVCCIPLLFCLFHMRYLAQYKH 243

Query: 254 --------NSVPTN---------VHGFAMDWIGSVLAVI--GLILLNFVWNQGPIVGWQT 294
                   +++P N         V  + +D +G +L VI    +L+ F         W++
Sbjct: 244 NRRELRSFSTIPPNMTRMEYFIDVFFWRLDILGLLLGVIFFACVLIPFTLAAKATDKWKS 303

Query: 295 AYIIXXXXXXXXXXXXXXTY-EVKYAESPLLPVEVTKNRHII-MILAALFLGWXXXXXXX 352
           A II               + E K+A+ PL P  + K+R +   +L ALFL +       
Sbjct: 304 ASIIVPEVIGWLVALPLYIFWEWKFAKFPLTPWNLVKDRGVYGGLLIALFLDFAYYVQST 363

Query: 353 XXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKI---SAAFILFMSMVAFN 409
                 L++    + L A  T  MF   G + A ++G F+ K    +  FI F       
Sbjct: 364 YKYTVLLVSFDT-TVLAATRTNNMFTFVGVITANLLGIFVAKKLRRTKGFIFF------- 415

Query: 410 IGIIMLSVTPVDQTYFRM----NLGTMI---ILSFGMD-MSFPAAAIILSDGLTMQYQGM 461
            GI M  V+      +R+     +GT++   +L FG   + FPA A I +   T +   +
Sbjct: 416 -GISMYIVSTGLLYRYRIGAHAKVGTIVACCLLGFGNGFLKFPARASIQAAAYTHKNLAI 474

Query: 462 AGSL 465
             SL
Sbjct: 475 ITSL 478

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 53/102 (51%), Gaps = 4/102 (3%)

Query: 72  IFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDI 131
           +FS  +   L+   +    +IMN + + F SE  ++ W+  SF L + +F  + G++ DI
Sbjct: 39  LFSLWLGSFLSSLDSTIVANIMNRVAEDF-SESSRKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 132 YGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGL 173
            G K  L+    FF +  +   LT ++ + T F ++RA  G+
Sbjct: 98  TGRKSALLIAQFFFGLGCL---LTCFARNVTEFSIARAICGI 136

>TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.241
           YIL121W
          Length = 557

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 95/227 (41%), Gaps = 13/227 (5%)

Query: 37  EIEKDVISQTETPQLEHSKWQNPDYFQ-NQWQEYLFIFSCMMSQLLNQAATPQTLSIMNI 95
           ++E+   ++T++ +LE   + +P Y +  + +++L +  C  +   +  A      ++ +
Sbjct: 38  DVEQSSCTRTKSARLE-PHYTSPPYSRFGRREKFLLVVQCAFTGFFSTIAAAIYYPVLTV 96

Query: 96  ITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLT 155
           I D F+    K    +  + +  G    + G + D  G +  ++   + +  +S   GL 
Sbjct: 97  IEDLFDISEEKVNITVVVYFIFQGISPTLMGGLADYLGRRPIVILSVLVY--FSACVGLA 154

Query: 156 KYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFG 215
             S S    I  R  Q   I+ ++    GI+G++    + R   V  + G         G
Sbjct: 155 -CSQSYAQIIALRCLQAAGISPVIAINSGIMGDV-TTRAERGGYVGYVSGCQV-----VG 207

Query: 216 SLFAGLIGTEDPDQWPWA--FYAFAIASAFNLAISIYSIPNSVPTNV 260
           S F  LIG     +W W   F+  AI S   L  ++  +P +  T V
Sbjct: 208 SAFGALIGAGLSSRWGWRSIFWFLAIGSGACLVATVLFLPETKRTVV 254

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 53/102 (51%), Gaps = 4/102 (3%)

Query: 72  IFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDI 131
           +FS  +   L+   +    +IMN + + F SE  K+ W+  SF L + +F  + G++ DI
Sbjct: 39  LFSLWLGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 132 YGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGL 173
            G +  L+    FF +  +   +T ++ + T F ++RA  G+
Sbjct: 98  IGRRPALLTAQFFFGLGCL---MTCFARNVTEFSIARAVCGI 136

>ZYRO0G00352g Chr7 (27042..28526) [1485 bp, 494 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260W
          Length = 494

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 48/106 (45%), Gaps = 6/106 (5%)

Query: 134 LKKTLVGGYIFFII--WSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYK 191
           LK+T V  Y+ F++  WSII+  + +  S    +  R   G       P +  I+  +YK
Sbjct: 114 LKRTNVKYYMSFLVFSWSIITLCSGFVKSHKSLLALRVLLGTFEGGFFPAMTLIISIVYK 173

Query: 192 PDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDP---DQWPWAF 234
           P    K I     G+SA  GAF G +  GL   +D    + W W +
Sbjct: 174 PQEQAKRIAF-FFGSSALSGAFGGLIATGLASVKDAGGLEGWRWLY 218

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 101/240 (42%), Gaps = 26/240 (10%)

Query: 53  HSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIA 112
            +K Q   Y  N     +F+  C    LLN A+    +S+++ +  ++N      +W + 
Sbjct: 17  RNKCQKSRYQLNVNVGLIFL-GCTF-DLLNVASM---ISLIDDLAKTYNISYTTASWSLT 71

Query: 113 SFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFII----WSIISGLTKYSHSDTFFIVSR 168
           S+ +    FI   GR+GDI       +G  + F I    ++++S L     +   F V R
Sbjct: 72  SYAVTFAGFIACMGRLGDI-------IGNSVLFTISCSCFAVLSLLCAVMPNFPAFAVFR 124

Query: 169 AFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPD 228
           A QG+  A ++P    ++  +   +  +K   I   G S+ IG   G +  G   T    
Sbjct: 125 AIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIG--LGLIIGGAFATTKIG 182

Query: 229 QWPWAFYAFAIAS-----AFNLAISIYSI---PNSVPTNVHGFAMDWIGSVLAVIGLILL 280
                +  FA+ +     AF     +  +   P     +    ++D+IGS++ V G IL+
Sbjct: 183 YRGIFYLTFAVMTLISIIAFFFTYGVEKLNKKPQKDQASTSVKSLDFIGSLIFVAGSILI 242

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 87/235 (37%), Gaps = 58/235 (24%)

Query: 105 GKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFF 164
           G   WL+  + L +  F+L+ GR+ +I G K+ L+   I F I S+IS L   S+S    
Sbjct: 43  GNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISAL---SNSMATL 99

Query: 165 IVSRAFQGL------SIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLF 218
           I  R   G       S+AF++   +           N + I+I+ +  S  I    G   
Sbjct: 100 ISGRVVAGFGGSGIESLAFVVGTSI--------VRENHRGIMITALAISYVIAEGVGPFI 151

Query: 219 AGLIGTEDPDQWPWAFYAFAIASAFNLAISIYS-----------IPNSVPT--------- 258
            G     +   W W FY      AF   I  +            +P+ +           
Sbjct: 152 GGAF--NEHLSWRWCFYINLPIGAFAFIILAFCNTSGEPHQKMWLPSKIKKIMNYDYGEL 209

Query: 259 ----------NVHGFAMDWIGSVLAVIGLILL---------NFVWNQGPIVGWQT 294
                      V  F +D +G +L+  G  LL         NF WN G I+ + T
Sbjct: 210 LKASFWKNTFEVLVFKLDMVGIILSSAGFTLLMLGLSFGGNNFPWNSGIIICFFT 264

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 4/98 (4%)

Query: 72  IFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDI 131
           +FS  M   L         +IMN + + F  E  K+ W+  SF L + +F  + G++ DI
Sbjct: 54  VFSLWMGSFLGALDGTIVANIMNRVAEEFQ-ESDKKQWIATSFLLTNTAFQPLYGKLSDI 112

Query: 132 YGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRA 169
            G K  L+  + FF +  +   LT ++ + T F ++RA
Sbjct: 113 TGRKFALLVAHTFFCLGCL---LTCFARNVTEFSIARA 147

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 100/236 (42%), Gaps = 18/236 (7%)

Query: 53  HSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIA 112
            ++ Q   Y  N     +F+  C    LLN A+    +S+++ +   ++      +W + 
Sbjct: 17  RNRCQKSTYQLNVNVALIFL-GCTF-DLLNVASM---ISLIDDLAQKYDISYTTASWSLT 71

Query: 113 SFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQG 172
           S+ +    FI   GR+GDI G          FF I S++  +     +   F V RA QG
Sbjct: 72  SYAVTFAGFIAFMGRLGDIVGNSILFTVSCFFFAILSLLCAVMPNFPA---FAVFRAIQG 128

Query: 173 LSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFF---GSLFAGLIGTEDPDQ 229
           +S A ++P    ++  +   +  +K   I   G S+ IG      G+  A  IG +    
Sbjct: 129 ISAAGLVPCAYALIPMLAPEEEVQKYFSIVSCGFSSTIGLGLIIGGAFAATKIGYKGIFY 188

Query: 230 WPWA--FYAFAIASAFNLAISIYSIP---NSVPTNVHGFAMDWIGSVLAVIGLILL 280
             +A  F    +A  F   +   S P   +     V   ++D+IGS++ V G IL+
Sbjct: 189 LTFAVMFLISIVAFFFTYGVENLSEPPRKDQATNRVR--SLDFIGSLIFVTGSILI 242

>SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121W QDR2 Multidrug transporter required for
           resistance to quinidine barban cisplatin and bleomycin
           member of the major facilitator superfamily of
           transporters conferring multiple drug resistance
           (MFS-MDR)
          Length = 600

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 97/230 (42%), Gaps = 18/230 (7%)

Query: 35  IEEIEKDVISQTETPQLEHSKWQNPDYFQ-NQWQEYLFIFSCMMSQLLNQAATPQTLSIM 93
           IE+I K     +  P  E +  Q P Y +  + ++ +    C  + L +  + P     +
Sbjct: 48  IEQISKP---SSANPNNEKT-CQEPPYSRFGKSEKSILAVLCASAGLFSTISAPIYYPAL 103

Query: 94  NIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISG 153
            II + FN         +  + ++ G   ++ G + D  G +  ++     + +  I  G
Sbjct: 104 TIIEEDFNISQEMVNITVVVYFILQGLAPMLMGGLADKVGRRPIVLCSIALYAVACI--G 161

Query: 154 L-TKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGA 212
           L +  ++ +  F+  R  Q   I+ ++    GI+G+I    + R   +  M G       
Sbjct: 162 LASAQNYGEVLFL--RCLQSAGISPVVAVNNGIIGDITT-KAERGGYLGLMAGTQV---- 214

Query: 213 FFGSLFAGLIGTEDPDQWPWA--FYAFAIASAFNLAISIYSIPNSVPTNV 260
             GS F  LIG     +W W   F+  AI S F+LA++ + +P +  T V
Sbjct: 215 -IGSAFGALIGAGITARWGWRAIFWFLAIGSGFSLAVASFLLPETKRTVV 263

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 82/199 (41%), Gaps = 13/199 (6%)

Query: 39  EKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITD 98
           E+D  S  E    +HS  +N    +     ++   S     L    A   T+ +  II +
Sbjct: 47  EQDAASALENRNAKHSARENSALPKG----FVLYASLTALALSLFLAALDTMIVSTIIEE 102

Query: 99  SFNSEGGKET--WLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTK 156
                G      WL   + L +    LI GRI    G K+T++   + F + S+IS L  
Sbjct: 103 VAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVGSLISAL-- 160

Query: 157 YSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGS 216
            ++S    I  R   G+    I  ++  ++G+    +SNR  ++I+++  S  I +  G 
Sbjct: 161 -ANSMNVLIGGRVIAGVGGCGI-QSLSFVIGSNLVEESNR-GVLIAILSCSFAIASVVGP 217

Query: 217 LFAGLIGTEDPDQWPWAFY 235
              G+  +     W W FY
Sbjct: 218 FLGGVFTSR--VTWRWCFY 234

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/237 (20%), Positives = 90/237 (37%), Gaps = 13/237 (5%)

Query: 32  HGDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLS 91
           H D   I+  +  +  TP  E  +   P    + W ++  +    M    +   +P    
Sbjct: 61  HSDDSSIDTSLDGELSTPDEEAQEHTPPHSMLSYWNKWGMVAVLTMCGFWSSLGSPIYYP 120

Query: 92  IMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSI- 150
            +  +   FN +       +  + +  G    +SG + DIYG +  ++ G + +++ SI 
Sbjct: 121 ALKQLEKKFNVDENLVNVSVVVYLIFQGFAPAVSGGLADIYGRRPVILFGMLVYVVASIG 180

Query: 151 ISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPI 210
           I+    Y       I  R  Q   I+ ++    G VG+ +   + R   V ++ G     
Sbjct: 181 IAACNSYG----VIIFLRCLQSTGISPLIAISSGAVGD-FTVKAERGTFVGAVSGL---- 231

Query: 211 GAFFGSLFAGLIGTEDPDQWPWA--FYAFAIASAFNLAISIYSIPNSVPTNVHGFAM 265
               G  F  LIG      + W   F+  AI     +AI+   +P +  T V   ++
Sbjct: 232 -VLMGQAFGSLIGAALAAAYNWRAIFWFLAIGCGACMAIAGIVLPETKRTLVGNLSV 287

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 68/147 (46%), Gaps = 8/147 (5%)

Query: 89  TLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIW 148
            +++ + I   FN +     WL+A + L +  F+L+ GRI  + GLK +L+   + F   
Sbjct: 27  CITLYDTIGQEFN-DYANVGWLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAG 85

Query: 149 SIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASA 208
           S+++G    ++S    I +R   G   + I   V G+  +I   +   +  VI+++G + 
Sbjct: 86  SLMAG---AANSMGMLIGARVISGFGGSGIESLVYGVGTSIV--EEKHRARVITVLGIAY 140

Query: 209 PIGAFFGSLFAGLIGTEDPDQWPWAFY 235
            +    G    G  G  +   W W FY
Sbjct: 141 MLAEGAGPFVGG--GLAEHVSWRWCFY 165

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 59/273 (21%), Positives = 108/273 (39%), Gaps = 36/273 (13%)

Query: 91  SIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSI 150
           ++++ I   FN E  + +W+  ++ L S +F  + G++ DI+G +  LV   + F + ++
Sbjct: 162 TLLDHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGAL 220

Query: 151 ISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNR---KNIVISMIGAS 207
           I G++K   +    ++ R   G+     L ++  I      P  +R   + I     G  
Sbjct: 221 ICGMSK---NLWVLVLGRFVAGIGGGG-LTSMCSITTTDIVPLRSRALYQGICNVFFGLG 276

Query: 208 APIGAFFGSLFAGLIGTEDPDQWPWAFYA-FAIASAFNLAISIY-SIPNSVPTNVHGFA- 264
              G   G LFA     +    W  AF     +      AI ++ ++P   P + H  A 
Sbjct: 277 TACGGLVGGLFA-----DRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPK--PVDAHKGAG 329

Query: 265 ------------MDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXX 312
                       +DW G+V  V+ L     V +   + G    ++               
Sbjct: 330 QRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCS---LYGEDLPHLYLIFVVILLSGSYFI 386

Query: 313 TYEVKYAESPLLPVEVTKNRHIIMILAALFLGW 345
            +E+  A  P+LP+   +NR    +LAA    W
Sbjct: 387 YHELYVATDPILPIRFLENRS---VLAASLSNW 416

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 47/83 (56%), Gaps = 4/83 (4%)

Query: 91  SIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSI 150
           +IMN + + F +E  K+ W+  SF L + +F  + G++ DI G K  ++  + FF +  +
Sbjct: 65  NIMNRVAEEF-AESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAHFFFGLGCL 123

Query: 151 ISGLTKYSHSDTFFIVSRAFQGL 173
              LT ++ + T F ++RA  G+
Sbjct: 124 ---LTCFAQNVTQFSIARAICGM 143

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 90/228 (39%), Gaps = 52/228 (22%)

Query: 105 GKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFF 164
           G   WL+  + L +  F+L+ GR+ +I G  + L+   I F + S+IS L   S+S    
Sbjct: 43  GNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLISAL---SNSMGTL 99

Query: 165 IVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGA---SAPIGAFFGSLFAGL 221
           I  R   G   + I  ++  +VG     +++R  ++ ++  +   +  +G F G  F   
Sbjct: 100 ISGRLIAGFGGSGI-ESLAFVVGTSIVQENHRGTMITALATSYVIAEGVGPFIGGAF--- 155

Query: 222 IGTEDPDQWPWAFY-------------AFAIASAFNL-AISIYSIPNSVPT--------- 258
               +   W W FY             AF   S  +L  +S+ S   S+ +         
Sbjct: 156 ---NEHLSWRWCFYINLPIGAFALIILAFCNTSGESLPKVSLLSKIKSIMSYKYDEVFKA 212

Query: 259 -------NVHGFAMDWIGSVLAVIGLILL---------NFVWNQGPIV 290
                   V  F +D IG  L+  G  LL         NF WN   I+
Sbjct: 213 SFWKKAFKVFVFKLDMIGVTLSSAGFTLLMLGLSFGGNNFAWNSSTII 260

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 105/280 (37%), Gaps = 64/280 (22%)

Query: 105 GKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFF 164
           G   WL+  + L +  F+L+ GR+ +I G  + L+   + F I S+IS L   S++    
Sbjct: 43  GNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGSLISAL---SNTMGTL 99

Query: 165 IVSRAFQGL------SIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLF 218
           I  R   G       S+AF++   +           N + I+I+ +  S  I    G   
Sbjct: 100 IGGRVIAGFGGSGIESLAFVVGTSI--------VQENYRGIMITALAVSYVIAEGVGPFI 151

Query: 219 AGLIGTEDPDQWPWAFY------AFA-IASAFNLAIS--------IYSIPNSVPT----- 258
            G     +   W W FY      AFA I+ AF  A          + S  NS+ +     
Sbjct: 152 GGAF--NEHLSWRWCFYINLPIGAFAFISLAFCCASGGKWLSKKWLLSKINSITSYKYYE 209

Query: 259 -----------NVHGFAMDWIGSVLAVIGLILL---------NFVWNQGPIVGWQT---- 294
                       +  F +D IG +L+  G  LL         NF WN   I+ + T    
Sbjct: 210 IFKASFWKKVFQILVFKLDMIGIILSSAGFTLLMLGLSFGGNNFAWNSSIIISFFTLGPI 269

Query: 295 AYIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHI 334
             I+               Y+ KYA  PLL  ++  N  I
Sbjct: 270 LLILFCAYDFHILPLLGVHYKSKYAR-PLLTWKIASNAGI 308

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 58/124 (46%), Gaps = 11/124 (8%)

Query: 57  QNPDYFQNQWQEYLF-------IFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETW 109
           +  +  + Q+ EY         + S  +   L+   +    +IMN + + F  E  K+ W
Sbjct: 21  EEDNGLEEQYHEYNLSLPKFPILLSLWLGSFLSSLDSTIVANIMNKVAEEFE-ESDKKQW 79

Query: 110 LIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRA 169
           +  SF L + +F  + G++ DI G K  ++  + FF +      LT ++ + T F ++RA
Sbjct: 80  IATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHFFFGLGCF---LTCFAQNITQFSIARA 136

Query: 170 FQGL 173
             G+
Sbjct: 137 ICGI 140

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 59/127 (46%), Gaps = 7/127 (5%)

Query: 109 WLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSR 168
           WL+  + L +  F L+ GR+  I GLK +L    + F I S+I  +   S+S    I  R
Sbjct: 46  WLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAV---SNSMGMIIGGR 102

Query: 169 AFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPD 228
              G   + I   V  +VG     + NR  +VI+++G +  +    G +  G   TE+  
Sbjct: 103 VVAGCGGSGIQSLVF-VVGTSLVEERNR-GMVITVLGLAFAVAFAVGPVIGGAF-TENVS 159

Query: 229 QWPWAFY 235
            W W FY
Sbjct: 160 -WRWCFY 165

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 90/223 (40%), Gaps = 11/223 (4%)

Query: 37  EIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNII 96
           E + D  +  ETP  +    + P       Q++  +         +   +P     +  +
Sbjct: 67  ESDLDTYTDAETP--DKVSCETPYTLMTHGQKWFMVALLTSGGFWSSLGSPIYYPALKQL 124

Query: 97  TDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTK 156
              FN         +  + +  G    ISG + D+YG +  ++ G + +++ SI  GL  
Sbjct: 125 EQVFNINEEMVNITVVVYFIFQGVAPTISGGLADVYGRRPIILAGMLIYVVASI--GLA- 181

Query: 157 YSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGS 216
            S+S    +  R  Q   I+ ++    G+VG+ +   S R + V ++ G  A +G  FGS
Sbjct: 182 CSNSYGVIVFLRCVQSAGISPLIAISSGVVGD-FTTKSERGSFVGAVSGF-ALMGQAFGS 239

Query: 217 LF-AGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPT 258
           L  AGL    D   W   F+   I       I+ + +P +  T
Sbjct: 240 LIGAGLTAAYD---WRAIFWFLTIGCGTCFVINFFLLPETKRT 279

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 62/145 (42%), Gaps = 8/145 (5%)

Query: 91  SIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSI 150
           +I++ +  SF  +  K  W++  + L +  F L+ GRI    G + ++V   + F   S+
Sbjct: 65  TIIDTVCKSFG-DYTKSGWIVTGYSLPNALFSLLWGRISANLGPRISIVACIVLFEAGSL 123

Query: 151 ISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPI 210
           IS L +   S    I  R   G+  + +    + +V      D   + +V+S++  +  I
Sbjct: 124 ISALAR---SMNMLIAGRVVSGVGGSGL--QTLSLVIGCQLVDEKSRPLVLSLLNCTFAI 178

Query: 211 GAFFGSLFAGLIGTEDPDQWPWAFY 235
            +  G    G   T     W W FY
Sbjct: 179 ASIIGPFIGGAFTTH--VTWRWCFY 201

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 47/83 (56%), Gaps = 4/83 (4%)

Query: 91  SIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSI 150
           +IMN + + F  E  K+ W+  S+ L + +F  + G++ D+ G K  ++  + FF +  +
Sbjct: 59  NIMNRVAEEFQ-ESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAHFFFGLGCL 117

Query: 151 ISGLTKYSHSDTFFIVSRAFQGL 173
              LT +++S T F ++RA  G+
Sbjct: 118 ---LTCFANSVTQFAIARAICGV 137

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 72/175 (41%), Gaps = 22/175 (12%)

Query: 70  LFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGG---KETWLIASFPLVSGSFILISG 126
           L ++ C+ S  L    T   + I+  I D    + G   K  WL+  + L +    LI G
Sbjct: 34  LSLYLCLASLTLVLFITALDILIVGTIIDVVAEQFGNYSKTGWLVTGYSLPNAILSLIWG 93

Query: 127 RIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGL------SIAFILP 180
           R   I G + +L+   + F   S+I+ L   + S    I  R   G+      ++ F++ 
Sbjct: 94  RFASIIGFQHSLILAILIFEAGSLIAAL---ASSMNMLIFGRVVAGVGGSGLQTLCFVIG 150

Query: 181 NVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFY 235
             M  VG   +P      +VIS++  +  + A  G +  G   T     W W FY
Sbjct: 151 CTM--VGERSRP------LVISILSCAFAVAAIVGPIIGGAFTTH--VTWRWCFY 195

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 56/114 (49%), Gaps = 5/114 (4%)

Query: 47  ETPQLEHSKWQNPDYFQ----NQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNS 102
           ET  L  S+ +  +  Q    ++ + ++ I S  +   L         ++++ I   FN 
Sbjct: 35  ETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN- 93

Query: 103 EGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTK 156
           E    +W+  ++ L S +F  + G+I DI+G +  ++   +FFI+  +I GL+K
Sbjct: 94  ELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 59/127 (46%), Gaps = 7/127 (5%)

Query: 109 WLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSR 168
           WL   + L +    LI GRI    G K+T++   + F I S+IS L   ++S +  I  R
Sbjct: 106 WLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSLISAL---ANSMSMLIGGR 162

Query: 169 AFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPD 228
              G+    I  ++  ++G+    +S R  I+I+++  S  I +  G    G+  +    
Sbjct: 163 VIAGVGGCGI-QSLSFVIGSTLVEESQR-GILIAVLSCSFAIASVVGPFLGGVFTSS--V 218

Query: 229 QWPWAFY 235
            W W FY
Sbjct: 219 TWRWCFY 225

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 60/133 (45%), Gaps = 19/133 (14%)

Query: 109 WLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSR 168
           WL   + L +   +LI GRI    G K T++   + F I S+IS L   + S    I  R
Sbjct: 100 WLFTGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIGSLISAL---ASSMNMLIGGR 156

Query: 169 AFQGL------SIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLI 222
              G+      S++F++ + +         + +++ ++I+++ +S  I +  G    G+ 
Sbjct: 157 VIAGIGGCGIQSLSFVIGSTL--------VEESKRGMLIAILSSSFAIASVVGPFLGGVF 208

Query: 223 GTEDPDQWPWAFY 235
            +     W W FY
Sbjct: 209 TSS--VTWRWCFY 219

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (55%), Gaps = 4/79 (5%)

Query: 91  SIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSI 150
           +IMN I   F +E  K+ W+  S+ L + +F  + G++ DI G K  ++  + FF +  +
Sbjct: 64  NIMNSIAAEF-AESDKKQWIATSYLLTNTAFQPLYGKLSDITGRKVAVITAHFFFALGCL 122

Query: 151 ISGLTKYSHSDTFFIVSRA 169
              LT ++ + T F ++RA
Sbjct: 123 ---LTCFAQNVTQFSIARA 138

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 65/153 (42%), Gaps = 12/153 (7%)

Query: 46  TETPQLEHSKWQNPDYFQNQWQEYL----FIFSCMMSQLLNQAATPQTLSIMNIITDSFN 101
           T  P+L    +      QN   + +     IF      LLN A     +S++  + +++ 
Sbjct: 7   TAAPKLSEGIYNLRRRCQNSKYQLIINMALIFLGCTFDLLNVAGV---ISVIEDLGETYG 63

Query: 102 SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTL-VGGYIFFIIWSIISGLTKYSHS 160
            E    +W + S+ +     I   GR+GDI G      + G+ F +   + + +T +   
Sbjct: 64  LEYTTASWALTSYAITFAGLIAFMGRLGDIIGNSVLFTISGFFFSLFCLLCAVVTNFPA- 122

Query: 161 DTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPD 193
              F V RA QG++ A ++P    ++  +  P+
Sbjct: 123 ---FAVLRALQGIAAAGLVPCGYALIPTLADPE 152

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 58/124 (46%), Gaps = 11/124 (8%)

Query: 140 GGYIFFIIWSIISGLTKY-------SHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKP 192
           GG  F  I+S++  L           H    +I+ R FQ +  + ++P  +G V ++  P
Sbjct: 174 GGRKFLYIFSLMIALIANVLLAAVPKHLAALYIL-RVFQAIGTSAVIPLGVGTVSDLISP 232

Query: 193 DSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSI 252
            +  K +   M+G +  +G   G +F GLI   + +QW W F   +I +   L + +  +
Sbjct: 233 MNRAKGVSYFMLGPN--MGPILGPIFGGLI-LMNGNQWRWLFGFTSITTGVGLILIVTFL 289

Query: 253 PNSV 256
           P ++
Sbjct: 290 PETL 293

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 47/236 (19%), Positives = 91/236 (38%), Gaps = 13/236 (5%)

Query: 33  GDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSI 92
           GD +   +    + E   +   +   P       Q++  +F   ++   +   +P     
Sbjct: 54  GDDDTSSECSHDEQEQQHIVEGEQNYPHTLLTYRQKWFMVFLMTITGFWSSLGSPIYYPA 113

Query: 93  MNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIIS 152
           +  +   FN +  K    +  + L  G    ISG + D+YG +  ++GG + F++ SI  
Sbjct: 114 LKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASI-- 171

Query: 153 GLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAP--- 209
           G+ K + S    +  R  Q + I+  +    G+V      D   K    + +GA++    
Sbjct: 172 GIAK-APSYGVIVFLRCIQSIGISPTIAISSGVVS-----DFTVKRERGTFVGATSGLVL 225

Query: 210 IGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAM 265
           IG   G L   +I       W   F+   I     + I  + +P +  T V   ++
Sbjct: 226 IGQGIGPLLGAVITAA--LHWRAVFWFLTIGCGSCMIIGFFLLPETKRTIVGNLSI 279

>KLTH0E03234g Chr5 complement(293162..294727) [1566 bp, 521 aa] {ON}
           similar to uniprot|P15365 Saccharomyces cerevisiae
           YJR152W DAL5 Allantoin permease;ureidosuccinate
           permease; expression is constitutive but sensitive to
           nitrogen catabolite repression
          Length = 521

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 2/91 (2%)

Query: 143 IFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVIS 202
           +F ++W  +  +T    +   FI +R   G+  + + P  M +    Y+ +   + +  S
Sbjct: 148 VFIVLWGFVLCMTSLPKNYASFIATRTVLGILESAVTPAFMLLTSQWYRRE--EQFLRTS 205

Query: 203 MIGASAPIGAFFGSLFAGLIGTEDPDQWPWA 233
           +  ASA +GA  GSL A  +   DP   P A
Sbjct: 206 IWSASAGLGAILGSLIAYGLAVRDPSSLPIA 236

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 40/208 (19%), Positives = 81/208 (38%), Gaps = 13/208 (6%)

Query: 31  KHGDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTL 90
           + G   E  + +  +T+   ++ S    PD  +    +       +   +     T   +
Sbjct: 5   ETGQNSEYNRKISDETKDLSVKQSACIAPDASKRNRVKLFLSLLSLGLSMF---VTALDV 61

Query: 91  SIMNIITDSFNSEGG---KETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFII 147
            I+  I D+  +  G   K  W++  + L +  F L+ GR+  + G + +++   I F  
Sbjct: 62  LIVGTIIDTVCTSFGDYTKSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFET 121

Query: 148 WSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGAS 207
            S+IS L K   S    I  R   G+  + +    + +V      +   + +V+S++  +
Sbjct: 122 GSLISALAK---SMNMLISGRVIAGVGGSGL--QTLSLVIGCQLVNEKSRPLVLSLLNCT 176

Query: 208 APIGAFFGSLFAGLIGTEDPDQWPWAFY 235
             + +  G    G   T     W W FY
Sbjct: 177 FAVASIVGPFLGGAFTTH--VTWRWCFY 202

>TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.242
           YNL065W
          Length = 529

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 78/204 (38%), Gaps = 12/204 (5%)

Query: 32  HGDIEEIEKDVISQTETPQLEH---SKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQ 88
           HGD      D++   + P   +   S+ + P    +  Q++  +    M    +   +P 
Sbjct: 23  HGDDSTKHGDMVMTNDKPIENNGTISRNEAPYTLLSYGQKWGMVALLTMCTFWSSLGSPI 82

Query: 89  TLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIW 148
               +  +   FN +  K    +  + L  G     SG + DIYG +  +V G I ++  
Sbjct: 83  YYPALRQLEKEFNIDEDKVNVTVVVYLLFQGIAPTFSGGLADIYGRRPVIVIGMIIYVAV 142

Query: 149 SIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASA 208
           S+  GL   S+S    +  R  Q   I+  +    G VG     D   K    + +GA++
Sbjct: 143 SV--GLA-CSNSYGVLVFLRILQSACISPTIAISSGFVG-----DFTLKFERGTFVGATS 194

Query: 209 PIGAFFGSLFAGLIGTEDPDQWPW 232
              A  G  F  LIG      W W
Sbjct: 195 GF-ALLGQAFGSLIGAALAAAWDW 217

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 59/133 (44%), Gaps = 13/133 (9%)

Query: 106 KETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFI 165
           K  WL   + L +   +LI GRI  + G K + +   + F + S++S L   ++S    I
Sbjct: 79  KVGWLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAIVIFEVGSLVSAL---ANSMDMLI 135

Query: 166 VSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISM---IGASAPIGAFFGSLFAGLI 222
             R   G+  + +  +++ ++ +    + NR  I+  M    G ++ +G F G  F   +
Sbjct: 136 GGRVIAGIGGSGV-QSLVFVISSTLVEERNRGLIIAVMSSSFGIASVVGPFLGGAFTTHV 194

Query: 223 GTEDPDQWPWAFY 235
                  W W FY
Sbjct: 195 ------TWRWCFY 201

>ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {ON}
           weakly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028W TPO1 Proton- motive-force-dependent
           multidrug transporter of the major facilitator
           superfamily able to transport eight different compounds
           including polyamines quinidine cycloheximide and
           nystatin involved in excess spermidine detoxification
          Length = 558

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 84/194 (43%), Gaps = 15/194 (7%)

Query: 64  NQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFN--SEGGKETWLIASFPLVSGSF 121
            +W     IF C +S   N +  P  LS   +I+  F+  S+    + +I  F +  G  
Sbjct: 78  KKWSIVTVIFVCQLSMNFNGSVYPHALS---LISKEFHVSSQAANTSQMI--FKVAYGFG 132

Query: 122 ILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPN 181
             +     + YG +  +     F  IW I+ G  K  +  T  IV+R   G+S A     
Sbjct: 133 CELWAPWSEEYGRRNIMQLSLFFTNIWQILGG--KAPNFGT-IIVARFLGGISQAG-GSV 188

Query: 182 VMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIAS 241
            +G+V ++++P  +     ++ +  ++ +GA  G +F GL+  E+   W W F+   I  
Sbjct: 189 TLGVVADMWQPQDH--GYAVAYVVLASVLGAVIGPVFGGLM--EEHLSWHWNFWIQLIFG 244

Query: 242 AFNLAISIYSIPNS 255
                +  + +P +
Sbjct: 245 GVTQLLHFFLVPET 258

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score = 37.7 bits (86), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 47/90 (52%), Gaps = 4/90 (4%)

Query: 258 TNVHGFAMDWIGSVLAV--IGLILLNFVWNQGPIVGWQTAYIIXXXXXX-XXXXXXXXTY 314
           T +  + +D+IG +LAV   GL+L+ F    G    W+TA II               T+
Sbjct: 269 TEIFLWKLDFIGLLLAVAFFGLVLVPFTLAGGLNKKWKTARIIVPEVLGWVVAFPAFLTW 328

Query: 315 EVKYAESPLLPVEVTKNRHII-MILAALFL 343
           E+K+A+ PL P +  K+R +   ++ A+FL
Sbjct: 329 EIKFAKYPLTPWKTVKDRGVFSALIIAIFL 358

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 37.4 bits (85), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 110/269 (40%), Gaps = 39/269 (14%)

Query: 91  SIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSI 150
           +++  I   FN E  + +W+  ++ L S +F  I G+I DI+G K  L+   I F + S+
Sbjct: 143 TLLAHIASEFN-ELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSL 201

Query: 151 ISGLTKYSHSDTF-FIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNR---KNIVISMIGA 206
           I GL     S +F ++V+  F        + ++  I  +   P  NR   + I     G 
Sbjct: 202 ICGL-----SPSFEWLVAGRFIAGIGGGGITSMSSITTSDIVPLRNRALYQGICNFYFGL 256

Query: 207 SAPIGAFFGSLFAG---------LIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVP 257
              +G   G  F+          LI      Q P AF++  +   F L +   S    + 
Sbjct: 257 GTALGGVVGGWFSDRSVGWRMSFLI------QLPIAFFSTILIILF-LRLPKESKGRGLQ 309

Query: 258 TNVHGF--------AMDWIGSVLAVIGLILLNFVWNQ---GPIVGWQTAYIIXXXXXXXX 306
            + + F        A+DWIG+   V  L L +F+      G  + + +   I        
Sbjct: 310 VDGNYFSTIKVRLSAVDWIGATTLV--LFLFSFMITASLGGKEIPYTSHKFIGLCVVTVI 367

Query: 307 XXXXXXTYEVKYAESPLLPVEVTKNRHII 335
                   E+K A+ P+LP+   K+R ++
Sbjct: 368 GALIFGYTELKIAKDPILPLRFLKDRSVL 396

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 37.4 bits (85), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 89/224 (39%), Gaps = 13/224 (5%)

Query: 40  KDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDS 99
           K+ + QT++ Q E      P       ++ + +  C  +   +  A      ++++I + 
Sbjct: 49  KNQLCQTKSNQNEPDIASPPYSRFGTTEKMILVIQCAFTGFFSSIAGAIYYPVLSVIENE 108

Query: 100 FNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSH 159
           FN         +  + +  G    I G + D  G +  ++   + +    I  GL   SH
Sbjct: 109 FNITEEMVNITVVVYFIFQGIAPSIMGGLADSMGRRPVVLSSVLVYCCACI--GLA-CSH 165

Query: 160 SDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLF- 218
           +    IV R  Q   I+ ++    GI+G+I       +   +  +     IG+ FG+L  
Sbjct: 166 TYAQIIVLRCLQAAGISPVIAINSGIMGDITT--RAERGGYVGYVSGFQVIGSAFGALIG 223

Query: 219 AGLIGTEDPDQWPWA--FYAFAIASAFNLAISIYSIPNSVPTNV 260
           AGL  T     W W   F+  AI S   L  SI  +P +  T V
Sbjct: 224 AGLSAT-----WSWRSIFWFLAIGSGVCLVASIIILPETKRTVV 262

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 37.4 bits (85), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 91  SIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSI 150
           +IMN + + F  E  K+ W+  SF L + +F  + G++ DI G +  L+  + FF +  +
Sbjct: 55  NIMNRVAEEFE-ESDKKQWIATSFLLTNTAFQPLYGKLSDITGRRFALLTAHFFFGLGCL 113

Query: 151 ISGLTKYSHSDTFFIVSRA 169
              LT ++ S   F ++RA
Sbjct: 114 ---LTCFAQSVEQFALARA 129

>NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {ON}
           Anc_5.284
          Length = 516

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 55/128 (42%), Gaps = 8/128 (6%)

Query: 128 IGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVG 187
           I ++YG + T +      IIW     LT +SH+    +  R   G   +  L    G + 
Sbjct: 134 ISELYGRRLTFIFSMTLSIIWQC---LTTWSHNVVGMMFGRFLSGFFGSAFLSIAGGSIS 190

Query: 188 NIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAI 247
           +I+  D     I +S+   S   G   G + +G +  E+   + W F    IAS   L +
Sbjct: 191 DIF--DKATITIPMSLYTLSCFYGPVLGPIVSGALYREN---YRWVFATLLIASGVCLVL 245

Query: 248 SIYSIPNS 255
            I++IP +
Sbjct: 246 IIFTIPET 253

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 96  ITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLT 155
           +   FN +  K +W+  S+ L S +F  + G++ DI+G K  LV   + F+I  ++ GL+
Sbjct: 138 VASEFN-QLSKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLS 196

Query: 156 K 156
           K
Sbjct: 197 K 197

>TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 73/317 (23%), Positives = 131/317 (41%), Gaps = 50/317 (15%)

Query: 61  YFQNQWQEYLFIFSCMMSQLL-----NQAATPQTLSIMNIITDSFNSEGGKETWLIASFP 115
           Y+ N +Q++L  FS  +         N   T QTL+     T SFN      T    +  
Sbjct: 68  YYANPFQKFLIYFSLFVIYYAYGLDGNVRPTYQTLA-----TSSFNRHSLNSTVTCINRV 122

Query: 116 LVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSI 175
             S   I  + R  DI+  + ++V   +F+++ +IIS     + S   + V     G+  
Sbjct: 123 TSSAGQIWFA-RASDIFSREFSMVISILFYVVGTIISS---QATSVAKYAVGACIYGIGH 178

Query: 176 AFILPNVMGIVGNIYKPDSNRKNIVISMIGASAP-IGAFFGSLFAGLIGTEDPDQWPWAF 234
           A I+     ++  IY  D +  N+   ++  +AP + A   +  +G I ++   +W W  
Sbjct: 179 AGIV-----LLCEIYMADFS--NLNWRVVAENAPMLPAIINTWVSGNITSDLGSKWQWGL 231

Query: 235 YAFAI---ASAFNLAISIYSI-----------------PNSVP-----TNVHGFAMDWIG 269
             +AI   AS   L + IY +                 P+ +       ++  + +D+IG
Sbjct: 232 GMWAIIFPASCIPLFVCIYHMRYMAKKNNEKIRKIFEKPSEIAWKKYLIDIFIWKLDFIG 291

Query: 270 SVL--AVIGLILLNFVWNQGPIVGWQTA-YIIXXXXXXXXXXXXXXTYEVKYAESPLLPV 326
            VL  AV  LIL+ F  + G    W +A +I+               +E K++  P+L +
Sbjct: 292 LVLLVAVFALILVPFTTSGGLHREWNSANFIVPEVVGWVVALPIFSVWEWKFSRYPILRL 351

Query: 327 EVTKNRHIIMILAALFL 343
           ++  +R I   L+  F 
Sbjct: 352 DLISDRGIYSALSISFF 368

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 3/74 (4%)

Query: 84  AATPQTL--SIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGG 141
           AA   TL  +IM  I   FN E  + +W+  ++ L S +F  + G++ DI+G K  L+  
Sbjct: 92  AAADGTLVSTIMAHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLN 150

Query: 142 YIFFIIWSIISGLT 155
            I F++  ++ GLT
Sbjct: 151 NIVFLVGCLMCGLT 164

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 78/180 (43%), Gaps = 8/180 (4%)

Query: 265 MDWIGSVLAVI--GLILLNFVWNQGPIVGWQTAYIIXXXXXX-XXXXXXXXTYEVKYAES 321
           +D+IG ++  +  G IL+ F    G    WQTA+II                +E+K++  
Sbjct: 283 LDFIGLLMLCVTFGCILIPFTLAGGLQSEWQTAHIIVPEVIGWCLALPLFLLWEIKFSRH 342

Query: 322 PLLPVEVTKNRHIIM-ILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIW 380
           PL P  + K+R II  I  A  + +             ++++ H S   A     +++  
Sbjct: 343 PLTPWALIKDRGIIFAIFIAFHINFCWYMQGDYMYTVLIVSV-HESVKSATRITSLYSFV 401

Query: 381 GTVAAVIVGAFIKKI--SAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFG 438
             +   I+G FI KI  +  FI+F  +V + I   +L     D       +G++ +L FG
Sbjct: 402 SVITGTILGMFITKIRRTKPFIVF-GVVCWFIAFGLLVHYRGDNNSHSGIIGSLCLLGFG 460

>KLTH0F03652g Chr6 (318194..320905) [2712 bp, 903 aa] {ON} similar
           to uniprot|P25360 Saccharomyces cerevisiae YCR037C PHO87
           Low-affinity inorganic phosphate (Pi) transporter
           involved in activation of PHO pathway expression is
           independent of Pi concentration and Pho4p activity
           contains 12 membrane-spanning segments and
           uniprot|P39535 Saccharomyces cerevisiae YJL198W PHO90
          Length = 903

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 209 PIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIAS-AFNLAISIYSIPNSVPTNVHGFAMDW 267
           PI  FFG+   GL+GT+D + +PWA    A+   A   A+S   +  ++   +    MD+
Sbjct: 727 PIVLFFGT---GLLGTQDINNFPWAIVILAMGGIALGGAVSSSGLLTTIAGALQRRVMDF 783

Query: 268 -IGSVLAVIGLILL 280
            + +V+A+ G+++L
Sbjct: 784 PLYAVMAIFGIVML 797

>NCAS0A06580 Chr1 (1303456..1305042) [1587 bp, 528 aa] {ON}
           Anc_5.284
          Length = 528

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 55/128 (42%), Gaps = 8/128 (6%)

Query: 128 IGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVG 187
           I + YG + T +      IIW     LT +S +    +  R   G   +  L    G + 
Sbjct: 146 ISEFYGRRPTFIFSLTVSIIWQC---LTTWSRTIEGMMFGRFLSGFFGSTFLSVAGGSIS 202

Query: 188 NIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAI 247
           +I+  DS    + +++   SA +G   G + +G +   D   + W F    IAS   LA+
Sbjct: 203 DIFDKDS--ITVPMAIYTTSAMLGPELGPIISGALYKVD---YKWTFVTLLIASGVCLAL 257

Query: 248 SIYSIPNS 255
            I ++P +
Sbjct: 258 IIVTVPET 265

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 92  IMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSII 151
           IMN + + FN+   K+ W+  S+ L + +F  + GR+ DI G K T +    FF + S  
Sbjct: 89  IMNRVAEDFNASNQKQ-WIATSYLLTNTAFQPLYGRLSDIIGRKYTQLIVPFFFGMGSF- 146

Query: 152 SGLTKYSHSDTFFIVSRA 169
             LT +S +   F ++RA
Sbjct: 147 --LTTFSKTLPQFALARA 162

>NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 67/163 (41%), Gaps = 10/163 (6%)

Query: 250 YSIPNSVPT-----NVHGFAMDWIGSVLAVI--GLILLNFVWNQGPIVGWQTAYIIXXXX 302
           ++IP  V       +V  + +D IG +L V   G +L+ F    G    W+TA+II    
Sbjct: 259 FTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEV 318

Query: 303 XX-XXXXXXXXTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWXXXXXXXXXXXXXLLN 361
                       +E+K++  PL P E+ K+R +   L   FL               L+ 
Sbjct: 319 IGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIV 378

Query: 362 LRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKI--SAAFILF 402
             H S   A     +++    +   I+G F+ K+  +  FILF
Sbjct: 379 AVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILF 421

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 63/149 (42%), Gaps = 20/149 (13%)

Query: 93  MNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIIS 152
           + +I++ FN +  K  W+++ + L      L+ GR   I+G K +L+   + F   S+IS
Sbjct: 65  IEVISEQFN-DYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLIS 123

Query: 153 GLTKYSHSDTFFIVSRAFQGL------SIAFILPNVMGIVGNIYKPDSNRKNIVISMIGA 206
            +   S+S    I  R   G+      S+ F++ + +             + + IS++  
Sbjct: 124 AV---SNSMNVLIGGRVVAGIGGSGIQSLCFVIASTL--------TTERSRGVAISVLSC 172

Query: 207 SAPIGAFFGSLFAGLIGTEDPDQWPWAFY 235
           +  + A  G    G   T     W W FY
Sbjct: 173 AYAVAAVAGPFMGGAFTTH--VTWRWCFY 199

>KNAG0B04900 Chr2 (940751..942301) [1551 bp, 516 aa] {ON} 
          Length = 516

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 57/128 (44%), Gaps = 8/128 (6%)

Query: 128 IGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVG 187
           I ++YG + T +      I+W     LT +S + T  +  R   G   +  L    G + 
Sbjct: 134 ISELYGRRATFIFSLTLSIVWQC---LTTWSRTLTGVMFGRFLSGFFGSSFLSVAGGAIS 190

Query: 188 NIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAI 247
           +I+    ++  + +S+   +A +G   G + +G + T D   + W F  F IAS   L  
Sbjct: 191 DIFL--KSQITVPMSLYTTAAMMGPSLGPIISGALYTVD---FRWTFVTFIIASGVCLVA 245

Query: 248 SIYSIPNS 255
            + +IP +
Sbjct: 246 IVVTIPET 253

>TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.241
           YIL121W
          Length = 608

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 46/228 (20%), Positives = 93/228 (40%), Gaps = 16/228 (7%)

Query: 36  EEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLF-IFSCMMSQLLNQAATPQTLSIMN 94
           E I+   + +T++ Q        P Y +   +E +F +  C  + L +  A      +++
Sbjct: 65  EPIDTTSLYKTKSGQHNEPTLDEPPYSRFGRKEKIFLVIQCAFTGLFSSIAGSIYYPVLS 124

Query: 95  IITDSFN-SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSI-IS 152
           ++   F  +E      ++  F   + S  L+ G + D  G +  ++   + +    I ++
Sbjct: 125 VMEKEFYITEEQVNVSVVVYFIFQALSPTLMGG-LADSLGRRPVVLSSIVLYFCACIGLA 183

Query: 153 GLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGA 212
             T YS      I  R  Q   I+ ++    GI+G++       +   + ++  +  +G 
Sbjct: 184 RCTNYSQ----LIGLRCLQAAGISPVIAVNSGIMGDVTT--KAERGGYMGLVSGTQVLGT 237

Query: 213 FFGSLFAGLIGTEDPDQWPWA--FYAFAIASAFNLAISIYSIPNSVPT 258
            FG+L    IG     +W W   F+   I S   L +SI  +P +  T
Sbjct: 238 AFGAL----IGAGLSSRWSWRSIFWFLVIGSGICLIVSIIVLPETKRT 281

>YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, ketoconazole,
           fluconazole, and barban
          Length = 563

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 48/243 (19%), Positives = 91/243 (37%), Gaps = 31/243 (12%)

Query: 32  HGDIEEIEKDVISQTETPQL-EHSKWQNPDYFQ-------NQWQEYLFIFSCMMSQLLNQ 83
           + +++    D IS  +  +   HS+  N   F        +  Q+ L +  C  +   + 
Sbjct: 24  NNNVDRSSSDAISDNDAERSNSHSEIDNESNFDMVPYSRFSHKQKMLLVVQCAFTGFFST 83

Query: 84  AATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYI 143
            A      ++ II   FN         I  + +  G    I G + D +G +        
Sbjct: 84  VAGSIYYPVLTIIERKFNITEELANVTIVVYFIFQGVAPSIMGGLADTFGRRP------- 136

Query: 144 FFIIWSIIS------GLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRK 197
             ++W+I++      GL   +H+    +  R  Q   I+ ++    GI+G++       +
Sbjct: 137 -IVLWAILAYFCACIGLA-CAHNYAQILALRCLQAAGISPVIAINSGIMGDV--TTKVER 192

Query: 198 NIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWA--FYAFAIASAFNLAISIYSIPNS 255
              + ++     +G  FG+    LIG     +W W   F+  AI S   L  S   +P +
Sbjct: 193 GGYVGLVAGFQVVGTAFGA----LIGAGLSSKWGWRAIFWFLAIGSGICLVFSTLLMPET 248

Query: 256 VPT 258
             T
Sbjct: 249 KRT 251

>AFR628C Chr6 complement(1577155..1579764) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL198W
           (PHO90) and YCR037C (PHO87)
          Length = 869

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 41/74 (55%), Gaps = 5/74 (6%)

Query: 209 PIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIAS-AFNLAISIYSIPNSVPTNVHGFAMDW 267
           P+  FFGS   GL+ T+D + +PW+    A+   A   A+S   +  ++  ++    MD+
Sbjct: 690 PLVLFFGS---GLLSTQDINNFPWSIVILAMGGIALGGAVSSSGLLATIARSLQARVMDY 746

Query: 268 -IGSVLAVIGLILL 280
            + +VL + GL++L
Sbjct: 747 SLYAVLVIFGLVML 760

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 57/141 (40%), Gaps = 24/141 (17%)

Query: 33  GDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSI 92
           G+ E++EKD       P +  S W N             +   ++S  +N+ A       
Sbjct: 32  GEEEDLEKDFRDPNTFPYILLSLWLNTSICA--------VDGTIISTTMNEIA------- 76

Query: 93  MNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIIS 152
                 S   E  K TW+  ++ L + +   + G+  D+ G KK L+   + FI+  ++ 
Sbjct: 77  ------SIFQEASKVTWVATAYMLTTCAVQPLYGKTSDLLGRKKCLLFAEVVFIVGLVMC 130

Query: 153 GLTKYSHSDTFFIVSRAFQGL 173
           G  +        IV+RA  G+
Sbjct: 131 GAARTIEE---LIVARAICGV 148

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 50/234 (21%), Positives = 90/234 (38%), Gaps = 20/234 (8%)

Query: 36  EEIEKDVISQTET--------PQLEHSKWQNPDY-FQNQWQEYLFIFSCMMSQLLNQAAT 86
            EIE D+ S+T +        PQ + +      Y   +  Q++  +    M    +   +
Sbjct: 58  REIEGDLESETSSHSGDDKIDPQQQITAETGAPYTLLSYGQKWGMVAILTMCGFWSSLGS 117

Query: 87  PQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFI 146
           P     +  +   FN +       +  + L  G    ISG + D +G +  ++ G + ++
Sbjct: 118 PIYYPALRQLEKQFNVDENMINITVVVYLLFQGVSPTISGGLADCFGRRPIILAGMLIYV 177

Query: 147 IWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGA 206
           + SI  GL   + S    I  R  Q + I+  +    G+VG     D   K+   + +GA
Sbjct: 178 VASI--GLA-CAPSYGVIIFLRCIQSIGISPTIAISSGVVG-----DFTLKHERGTFVGA 229

Query: 207 SAPIGAFFGSLFAGLIGTEDPDQWPWA--FYAFAIASAFNLAISIYSIPNSVPT 258
           ++      G  F  LIG     +W W   F+   I       I+   +P +  T
Sbjct: 230 TSGF-VLLGQCFGSLIGAVLTARWDWRSIFWFLTIGCGSCFLIAFLVLPETKRT 282

>ZYRO0D11946g Chr4 complement(1012082..1014985) [2904 bp, 967 aa]
           {ON} similar to uniprot|Q99189 Saccharomyces cerevisiae
           YOR160W MTR10 Nuclear import receptor mediates the
           nuclear localization of proteins involved in
           mRNA-nucleus export
          Length = 967

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 56/129 (43%), Gaps = 13/129 (10%)

Query: 151 ISGLTKYSHSDTFFIVSRAFQGL-SIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAP 209
           ++ + K  + D + ++ R    + S  F  P +  I  ++  PD  R+NI+  +I +   
Sbjct: 806 LASVIKLKNYDAYILILRCLDDIVSWGFKTPPISTIAIDVV-PDEWRQNILDKVIISHG- 863

Query: 210 IGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIG 269
                 +LFAGL+           F+A A A A +  +  + +     ++     + WI 
Sbjct: 864 -TELLTALFAGLLTN---------FHANAHADAVSCIVKCFRLAAEANSDDSSVCVQWIY 913

Query: 270 SVLAVIGLI 278
            V A +GL+
Sbjct: 914 EVTAQLGLV 922

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 58/130 (44%), Gaps = 13/130 (10%)

Query: 109 WLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSR 168
           WL+  + L S  F L+ GR+  + GLK  L+   + F I S+I+ +   S+S    I  R
Sbjct: 82  WLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAV---SNSMGMLIAGR 138

Query: 169 AFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLI---GTE 225
              G   + I  +++ IVG     + +R  +++ +        AF GS   G I      
Sbjct: 139 VVAGAGGSGI-QSLVYIVGTSLVSERSRGMVIMVL------TFAFVGSNAGGPILGGALN 191

Query: 226 DPDQWPWAFY 235
           +   W W F+
Sbjct: 192 EHASWRWCFF 201

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 34.7 bits (78), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 39/195 (20%), Positives = 75/195 (38%), Gaps = 12/195 (6%)

Query: 46  TETPQLEHSKWQNPDYFQN--QWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSE 103
           +  P++E +   +     N    +  L ++ C+ S  L    T   + I+  I D    +
Sbjct: 16  SSQPEIEEASDSDTSLNVNGGDAKMGLSLYLCLASLTLVLFITALDILIVGTIIDVVAKQ 75

Query: 104 GG---KETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHS 160
            G   K  WL+  + L +    L+ GR   I G + +L+   + F   S+++ L    + 
Sbjct: 76  FGNYSKTGWLVTGYSLPNAVLSLLWGRFASIIGFQHSLILAVLIFEAGSLVAALANSMN- 134

Query: 161 DTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAG 220
               ++            L  +  ++G     D   + +VIS++  +  + A  G +  G
Sbjct: 135 ---MLIVGRVVAGVGGSGLQTLCFVIG-CTMVDERSRPLVISILSCAFAVAAIVGPIIGG 190

Query: 221 LIGTEDPDQWPWAFY 235
              T     W W FY
Sbjct: 191 AFTTH--VTWRWCFY 203

>Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W
           (REAL)
          Length = 561

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 46/232 (19%), Positives = 91/232 (39%), Gaps = 15/232 (6%)

Query: 32  HGDIEEIEKDVISQTETPQLEHSKWQNPDYFQ-NQWQEYLFIFSCMMSQLLNQAATPQTL 90
           HG+   +    +S +++     S ++   Y + +  Q+ L +  C  +   +  A     
Sbjct: 30  HGETSGL---AVSNSQSEVGNESDFELEPYSRFSHTQKMLLVVQCAFTGFFSTVAGSIYY 86

Query: 91  SIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSI 150
            ++ +I   FN         I  + +  G    I G + D +G +  ++   + +    I
Sbjct: 87  PVLTVIEKKFNITEELANVTIVVYFVFQGLAPSIMGGLADTFGRRPVVLWAVLTYCCACI 146

Query: 151 ISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPI 210
             GL   SH+    +  R  Q   I+ ++    GI+G++       +   + ++     +
Sbjct: 147 --GLAS-SHNYAQILALRCLQAAGISPVIAINSGIMGDV--TTKVERGGYVGLVSGFQVV 201

Query: 211 GAFFGSLFAGLIGTEDPDQWPWA--FYAFAIASAFNLAISIYSIPNSVPTNV 260
           G  FG+    LIG     +W W   F+  AI S   L +S   +P +  T V
Sbjct: 202 GTAFGA----LIGAGLSSRWGWRAIFWFLAIGSGICLVVSALLLPETKRTLV 249

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 3/87 (3%)

Query: 90  LSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWS 149
           +S+++ ++  ++      +W + S+ +    FI   GR+GDI G  +        F I S
Sbjct: 49  ISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILS 108

Query: 150 IISGLTKYSHSDTFFIVSRAFQGLSIA 176
           ++ GL     +   F V RA QG++ A
Sbjct: 109 LLCGLMPNFEA---FAVMRALQGIAAA 132

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 49/227 (21%), Positives = 87/227 (38%), Gaps = 22/227 (9%)

Query: 36  EEIEKDVISQT---------ETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAAT 86
            EIE D+ S+T         +  Q   ++ + P    +  Q++  +    M    +   +
Sbjct: 58  REIEGDLDSETSSHSSDDKVDPTQQITAETKAPYTLLSYGQKWGMVAILTMCGFWSSLGS 117

Query: 87  PQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFI 146
           P     +  +   FN +       +  + L  G    +SG + D +G +  ++ G + ++
Sbjct: 118 PIYYPALRQLEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIILAGMLIYV 177

Query: 147 IWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGA 206
           I SI  GL   + S    I  R  Q + I+  +    G+VG     D   K+   + +GA
Sbjct: 178 IASI--GLA-CAPSYGVIIFLRCIQSIGISPTIAISSGVVG-----DFTLKHERGTFVGA 229

Query: 207 SAPIGAFFGSLFAGLIGTEDPDQWPWA----FYAFAIASAFNLAISI 249
           ++      G  F  LIG     +W W     F      S F +A  I
Sbjct: 230 TSGF-VLLGQCFGSLIGAVLTARWDWRAIFWFLTIGCGSCFLIAFLI 275

>Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W -
           Hypothetical ORF [contig 5] FULL
          Length = 529

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 61/134 (45%), Gaps = 15/134 (11%)

Query: 133 GLKKTLVGGYIF------FIIWSI---ISGLTKYSHSDTF--FIVSRAFQGLSIAFILPN 181
           GL  TL+GG          ++WS+   ++     + S T+   +V R  Q   I+ ++  
Sbjct: 70  GLSPTLMGGLADSFGRRPVVLWSVALYMAACIGIACSKTYAQILVLRCLQSAGISPVIAV 129

Query: 182 VMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIAS 241
             GI+G++   +  ++   + +      IG+ FG+L  G  G      W   F+  AIAS
Sbjct: 130 NSGIMGDVTTRE--QRGGYVGLTAGFQVIGSAFGALIGG--GIVSTWSWRAVFWFLAIAS 185

Query: 242 AFNLAISIYSIPNS 255
            F+L ++   +P +
Sbjct: 186 GFSLVVTFIMLPET 199

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 72/176 (40%), Gaps = 16/176 (9%)

Query: 64  NQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFIL 123
            Q    + IFS  ++  L        +++ + I   FN +     WL+  + L +   +L
Sbjct: 2   KQLATVVCIFSLSLTLFLGALDIVICITLYDTIGKVFN-DYANVGWLMTGYNLPNALCML 60

Query: 124 ISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVM 183
           + GRI  + GLK +LV   + F   S+++ L   + S    I  R   G   + I   V 
Sbjct: 61  LWGRIASLVGLKNSLVASIVIFEAGSLLAAL---ATSMGMLIGGRVIAGFGGSGIETLVF 117

Query: 184 GIVGNIYKPDSNRKNIVISMIGASAPI----GAFFGSLFAGLIGTEDPDQWPWAFY 235
            +   +   D   +  V++++G +  +    G F G  FA      +   W W F+
Sbjct: 118 AVGTRMV--DEKHRARVVTILGIAYMLAEGAGPFIGGAFA------EHVSWRWCFF 165

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 41/200 (20%), Positives = 76/200 (38%), Gaps = 12/200 (6%)

Query: 39  EKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITD 98
           E+   SQ E    +     N +    +    L++  C+ S  L    T   + I+  I D
Sbjct: 3   EEKNSSQAEVKAYDSDTELNVNSSDERGGISLYL--CLTSLTLVLFITALDILIVGTIID 60

Query: 99  SFNSEGG---KETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLT 155
               + G   K  WL+  + L +    L+ GR   I G + +L+   + F   S+++ L 
Sbjct: 61  VVAEQFGNYSKTGWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSLVAALA 120

Query: 156 KYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFG 215
              +     ++            L  +  ++G     + +R  +VIS++  +  + A  G
Sbjct: 121 NSMN----MLIVGRVVAGVGGSGLQTLCFVIGCTMVNERSRP-LVISILSCAFAVAAIVG 175

Query: 216 SLFAGLIGTEDPDQWPWAFY 235
            +  G   T     W W FY
Sbjct: 176 PIIGGAFTTH--VTWRWCFY 193

>Smik_8.117 Chr8 (181800..183344) [1545 bp, 514 aa] {ON} YHR048W
           (REAL)
          Length = 514

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 56/128 (43%), Gaps = 8/128 (6%)

Query: 128 IGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVG 187
           + ++YG + T +      IIW     LT +S + T  +  R   G   +  L    G + 
Sbjct: 132 LSELYGRRITFLYALTLSIIWQC---LTIWSRTITGVMFGRFLSGFFGSAFLSVAGGAIA 188

Query: 188 NIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAI 247
           +I+  D ++  I +++   SA +G   G +  G +  E    + W F    I S   L +
Sbjct: 189 DIF--DKDQIGIPMAIYTTSAFLGPSLGPIIGGALYHE---SYKWTFITLLITSGCCLVL 243

Query: 248 SIYSIPNS 255
            +++IP +
Sbjct: 244 IMFTIPET 251

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 33/73 (45%), Gaps = 2/73 (2%)

Query: 273 AVIGLILLNFVWNQGPIVGWQTAYIIXXXXXX-XXXXXXXXTYEVKYAESPLLPVEVTKN 331
           A+ G+IL+ F    G    W TA II                +E+K+A  PL P +  KN
Sbjct: 282 AIFGMILIPFTLAGGEEKVWSTARIIVPEVLGWAFALPLFLVWEIKFARYPLTPKDALKN 341

Query: 332 RHIIMILA-ALFL 343
           R I+  L   LFL
Sbjct: 342 RGIVSALVLVLFL 354

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 46/236 (19%), Positives = 92/236 (38%), Gaps = 18/236 (7%)

Query: 36  EEIEKDVISQTETPQLEHSKWQNPDY----FQNQWQEYLFIFSCMMSQLLNQAATPQTLS 91
            EI+ D +  ++  + E +      Y    ++ +W     +  C      +   +P    
Sbjct: 56  REIDGDSLQSSDEEKNEQASESTSPYTLLTYKQKWGMVALLTMC---GFWSSLGSPIYYP 112

Query: 92  IMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSII 151
            +  +   F  +  K    +  + L  G    ISG + D++G +  ++ G + +++ SI 
Sbjct: 113 ALRQLEKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVASI- 171

Query: 152 SGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIG 211
            GL   + S    +  R  Q + I+  +    G+VG     D   K+   + +GA++ + 
Sbjct: 172 -GLA-CAPSYGVIVFLRIIQSIGISPTIAISSGVVG-----DFTLKHERGTFVGATSGL- 223

Query: 212 AFFGSLFAGLIGTEDPDQWPWA--FYAFAIASAFNLAISIYSIPNSVPTNVHGFAM 265
              G  F  LIG      W W   F+   I    +  I+   +P +  T V   ++
Sbjct: 224 VLLGQCFGSLIGAVLAAAWNWRAIFWFLTIGCGTSFIIAFLLLPETKRTLVGNLSI 279

>KLLA0C19019g Chr3 (1689555..1691090) [1536 bp, 511 aa] {ON} similar
           to uniprot|P53322 Saccharomyces cerevisiae YGR260W TNA1
           High affinity nicotinic acid plasma membrane permease
          Length = 511

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 44/106 (41%), Gaps = 6/106 (5%)

Query: 134 LKKTLVGGYIFFII--WSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYK 191
           LKKT    Y+ F++  WSII+    +  S    I  R   G       P +  I+  +YK
Sbjct: 131 LKKTKPKYYMSFLVLSWSIITLCNAFVQSYASLIALRVLLGAFEGGFFPAMTLIISILYK 190

Query: 192 PDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDP---DQWPWAF 234
                K I     G+SA  GAF G +  GL   +     + W W +
Sbjct: 191 KQEQGKRIAF-FFGSSALSGAFGGLIATGLASMKPAGGLEGWRWLY 235

>Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON}
           (33230..34975) [1746 nt, 582 aa]
          Length = 581

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 86/221 (38%), Gaps = 12/221 (5%)

Query: 43  ISQTETPQLEHSKWQNPDYFQ-NQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFN 101
           I +T++ +L  +   +P Y +  + ++ L I  C  +   +  A      ++ +I   FN
Sbjct: 73  IMKTQSVKLGPNTTDSPPYSRFGRTEKSLLIIQCAFTGFFSSVAGAIYYPVLTVIEKKFN 132

Query: 102 SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSD 161
                    +  + +  G      G + D  G +  ++   + +    I  GL   S + 
Sbjct: 133 ITEELVNITVVVYFIFQGLAPSFMGGLADSLGRRPVVLFSILVYCCACI--GLA-LSQNY 189

Query: 162 TFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGL 221
           T  +V R  Q   I+ ++    GI G+I       +   +  +     IG+ FG+    L
Sbjct: 190 TQIVVLRCLQAAGISPVIAINSGICGDI--TTRAERGAYVGYVSGFIVIGSAFGA----L 243

Query: 222 IGTEDPDQWPWA--FYAFAIASAFNLAISIYSIPNSVPTNV 260
           IG      W W   F+   I S   L ISI  +P +  T V
Sbjct: 244 IGAGLSSTWGWRSIFWFLTIGSGICLMISIIVLPETKRTLV 284

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 91  SIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSI 150
           +++  I   FN E    +W+  ++ L S +F  + G+I DI+G K  L+   + F +  +
Sbjct: 151 TLLAHIASEFN-EMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCL 209

Query: 151 ISGLT 155
           I GL+
Sbjct: 210 ICGLS 214

>TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON}
           Anc_8.570 YBR180W
          Length = 608

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 3/84 (3%)

Query: 184 GIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAF 243
           G V +I  P    K++ + M+G +  +G     + AGLI   + +QW W F   AI +  
Sbjct: 247 GTVADISPPKHRGKSVALFMLGPN--MGPIIAPIIAGLI-LMNSNQWRWLFGFSAICTGV 303

Query: 244 NLAISIYSIPNSVPTNVHGFAMDW 267
            L I I  +P ++   V      W
Sbjct: 304 ALMIVIVILPETLRCIVGNNDPKW 327

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 87/227 (38%), Gaps = 22/227 (9%)

Query: 36  EEIEKDVISQT---------ETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAAT 86
            EIE D+ S+T         ++ Q   ++   P    +  Q++  +    M    +   +
Sbjct: 57  REIEGDLESETSSHSGDVKGDSTQQITTEIGAPYTLLSYGQKWGMVAILTMCGFWSSLGS 116

Query: 87  PQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFI 146
           P     +  +   FN +       +  + L  G    +SG + D +G +  ++ G + ++
Sbjct: 117 PIYYPALRQLEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIILAGMLIYV 176

Query: 147 IWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGA 206
           + SI  GL   + S    I  R  Q + I+  +    G+VG     D   K+   + +GA
Sbjct: 177 VASI--GLA-CAPSYGVIIFLRCIQSIGISPTIAISSGVVG-----DFTLKHERGTFVGA 228

Query: 207 SAPIGAFFGSLFAGLIGTEDPDQWPWA----FYAFAIASAFNLAISI 249
           ++      G  F  LIG     +W W     F      S F +A  I
Sbjct: 229 TSGF-VLLGQCFGSLIGAVLTARWDWRSIFWFLTIGCGSCFLIAFLI 274

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 65/153 (42%), Gaps = 28/153 (18%)

Query: 93  MNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIIS 152
           + +I++ FN +  K  W+++ + L      L+ GR   I+G K +L+   + F   S+IS
Sbjct: 65  IEVISEQFN-DYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLIS 123

Query: 153 GLTKYSHSDTFFIVSRAFQGL------SIAFILPNVMGIVGNIYKPDSNRKNIVISMIGA 206
            +   S+S    I  R   G+      S+ F++ + +             + + IS++  
Sbjct: 124 AV---SNSMNVLIGGRVVAGIGGSGIQSLCFVIASTL--------TTERSRGVAISVLSC 172

Query: 207 SAPIGA----FFGSLFAGLIGTEDPDQWPWAFY 235
           +  + A    F GS F   +       W W FY
Sbjct: 173 AYAVAAVASPFMGSAFTTHV------TWRWCFY 199

>TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.245
           YBR043C
          Length = 640

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 39/189 (20%), Positives = 77/189 (40%), Gaps = 11/189 (5%)

Query: 70  LFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIG 129
           L +     S L+   AT      +N IT+S ++        +  + L  G F L      
Sbjct: 90  LIVLIIAFSSLMGPMATSIVFPAINPITESLDTTTFMVNISVGVYSLSLGIFPLWWSSFS 149

Query: 130 DIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNI 189
           +++G +   V  +I    + I + L+    S   FI+ R   G + A +     G V ++
Sbjct: 150 EMHGRRSVYVVSFIMLFGFCIGAALSPNISS---FIILRVLCGAASASVQSVGAGTVSDL 206

Query: 190 YKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPW--AFYAFAIASAFNLAI 247
           Y P+   +N+ I        +G     L A +I +    +W W    +   I + F++ +
Sbjct: 207 YIPEDRGRNLGIYY------MGPLMAPLIAPIIASGLVTRWSWRSTQWFMVILAGFDVLL 260

Query: 248 SIYSIPNSV 256
            ++ +P ++
Sbjct: 261 LVFFLPETL 269

>KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 624

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 75/181 (41%), Gaps = 10/181 (5%)

Query: 265 MDWIGSVLAV--IGLILLNFVWNQGPIVGWQTAYIIXXXXXX-XXXXXXXXTYEVKYAES 321
           +D +G +L V  +G +L+ F    G    W+TA II                +E K+A  
Sbjct: 268 LDSVGLILVVGALGCVLVPFTLAGGLSDKWRTAQIIVPEVIGWCVALPLFVLWEAKFARF 327

Query: 322 PLLPVEVTKNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAG--TTYFMFA- 378
           PL P  V K+R +I  L   F                L+   H S   A   TT F F  
Sbjct: 328 PLTPRSVLKDRGVIAALVIAFHIHFCVYMQADYMYTVLVIAVHESVKAAQRITTLFNFVS 387

Query: 379 -IWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSF 437
            I GT+   ++  ++K+ +  FILF   V F +   +L     D++     +G + +L F
Sbjct: 388 IITGTLLGFVI-VYVKR-TKKFILFGVCVWF-VAFGLLVHFRGDESSHSGIIGALCLLGF 444

Query: 438 G 438
           G
Sbjct: 445 G 445

>YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presumed
           antiporter of the DHA1 family of multidrug resistance
           transporters; contains 12 predicted transmembrane spans;
           expression of gene is up-regulated in cells exhibiting
           reduced susceptibility to azoles
          Length = 514

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 56/128 (43%), Gaps = 8/128 (6%)

Query: 128 IGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVG 187
           + ++YG + T +      IIW     LT +S + T  +  R   G   +  L    G + 
Sbjct: 132 LSELYGRRITFLYALTLSIIWQC---LTIWSKTITGVMFGRFLSGFFGSAFLSVAGGAIA 188

Query: 188 NIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAI 247
           +I+  D ++  I +++   SA +G   G +  G +  +    + W F    I S   L +
Sbjct: 189 DIF--DKDQIGIPMAIYTTSAFLGPSLGPIIGGALYHQS---YKWTFITLLITSGCCLVM 243

Query: 248 SIYSIPNS 255
            I++IP +
Sbjct: 244 IIFTIPET 251

>Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106W
           (REAL)
          Length = 440

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 2/83 (2%)

Query: 265 MDWIGSVLAVI--GLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESP 322
           +D IG VL  +  G IL+      G    W+++ II               +E  YA +P
Sbjct: 139 LDVIGIVLITVSTGCILVPLTLAAGASEKWRSSKIIGTLVSGGVLFLIFMFWEASYAHNP 198

Query: 323 LLPVEVTKNRHIIMILAALFLGW 345
           LLP ++ K+R I   L   F  +
Sbjct: 199 LLPFKLLKDRGIWAPLGVAFFNY 221

>Suva_4.275 Chr4 complement(487620..489671) [2052 bp, 683 aa] {ON}
           YBR043C (REAL)
          Length = 683

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 64/164 (39%), Gaps = 13/164 (7%)

Query: 69  YLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRI 128
           +L  FS MM  +     T      +N IT  F +        I  + L  G F L    +
Sbjct: 111 FLIAFSSMMGPM----GTSIIFPAINAITTEFKTSVIMVNVSIGVYLLSLGVFPLWWSSL 166

Query: 129 GDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGN 188
            ++ G + T +  +     +SI S L    +S   FI  R   G + A +     G V +
Sbjct: 167 SELEGRRTTYITSFAMLFAFSIGSALAPDINS---FIALRMLCGAASASVQSVGAGTVAD 223

Query: 189 IYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPW 232
           +Y  +   KN+    +G           L + +IG+   ++WPW
Sbjct: 224 LYISEDRGKNLSYYYLGP------LLAPLLSPIIGSLLVNRWPW 261

>Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199C -
           Hypothetical ORF [contig 27] FULL
          Length = 723

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 6/80 (7%)

Query: 123 LISGRIGDIYGLKKTLVGGYIFFIIWSII-SGLTKYSHSDTFFIVSRAFQGLSIAFILPN 181
           L+ GR+G+ +G ++T+  G   FII  +  +  TK SH     I+ R   GL +  +L  
Sbjct: 171 LMVGRLGEKWGRRRTIRYGSFVFIIGGLFQTSATKLSH----LIIGRVISGLGVG-LLST 225

Query: 182 VMGIVGNIYKPDSNRKNIVI 201
           ++ I  +   P  NR  +  
Sbjct: 226 IVPIYQSEISPPHNRGKLAC 245

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 59/145 (40%), Gaps = 8/145 (5%)

Query: 91  SIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSI 150
           +IM  +   FN       WL+  + L +    L+ GR G + G K +++   + F + S+
Sbjct: 97  TIMETVAAKFNGYS-MTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSL 155

Query: 151 ISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPI 210
           I+     + S T  I  R   G+  + I   +  ++ +    D  R    IS++  +  +
Sbjct: 156 IAAA---ATSMTMLIGGRVISGIGGSGI-QTLCFVITSTLVTDRTR-GTAISILSCAFAV 210

Query: 211 GAFFGSLFAGLIGTEDPDQWPWAFY 235
            +  G    G   T     W W FY
Sbjct: 211 ASVAGPFLGGAFATH--VTWRWCFY 233

>Skud_8.107 Chr8 (179754..181322) [1569 bp, 522 aa] {ON} YHR048W
           (REAL)
          Length = 522

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 56/128 (43%), Gaps = 8/128 (6%)

Query: 128 IGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVG 187
           + ++YG + T +   +  IIW     LT +S +    +  R   G   +  L    G + 
Sbjct: 139 LSELYGRRITFLYALMLSIIWQC---LTIWSGTIAGVMFGRFLSGFFGSAFLSVAGGAIA 195

Query: 188 NIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAI 247
           +I+  D ++  I +++   SA +G   G +  G +  E    + W F    I S   L +
Sbjct: 196 DIF--DKDQIGIPMAIYTTSAFLGPSLGPIIGGALYHES---YKWTFITLLITSGCCLVL 250

Query: 248 SIYSIPNS 255
            I++IP +
Sbjct: 251 IIFTIPET 258

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 3/77 (3%)

Query: 265 MDWIGSVL--AVIGLILLNFVWNQGPIVGWQTAYIIXXXXXX-XXXXXXXXTYEVKYAES 321
           +D IG +L  A  G +L+ F    G    W+ A+II                +EVKY+  
Sbjct: 283 LDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRH 342

Query: 322 PLLPVEVTKNRHIIMIL 338
           PL P ++ K+R ++  L
Sbjct: 343 PLTPWDLIKDRGVLFAL 359

>NDAI0A08230 Chr1 (1882144..1889643) [7500 bp, 2499 aa] {ON}
           Anc_3.211 YBL004W
          Length = 2499

 Score = 32.3 bits (72), Expect = 3.8,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 14/70 (20%)

Query: 143 IFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVIS 202
           +F + W +I  + KYS +  F I++            P  + ++ N+  PD   K++V S
Sbjct: 474 LFDVYWRVI--ILKYSETSNFGILN------------PFTLKLLSNLTTPDDFSKDVVGS 519

Query: 203 MIGASAPIGA 212
           +IG   PI A
Sbjct: 520 LIGVINPIEA 529

>TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {ON}
           Anc_8.446 YDL199C
          Length = 687

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 48/101 (47%), Gaps = 9/101 (8%)

Query: 123 LISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNV 182
           L+ GR+G+ +G ++T+  G + F+I  +  G   ++      I+ R   GL +  +L  +
Sbjct: 163 LLVGRLGEKWGRRRTIKYGSLIFVIGGLFQG---FADKMMHLIIGRTISGLGVG-LLSTI 218

Query: 183 MGIVGNIYKPDSNRKNIVI-----SMIGASAPIGAFFGSLF 218
           + I  +   P  NR  +       +++G +A +   +G  F
Sbjct: 219 VPIYQSEISPPHNRGKLACIEFTGNIVGYAASVWIDYGCSF 259

>Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON}
           complement(9458..11311) [1854 nt, 618 aa]
          Length = 617

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 3/87 (3%)

Query: 259 NVHGFAMDWIGSVL--AVIGLILLNFVWNQGPIVGWQTAYIIXXXXXX-XXXXXXXXTYE 315
           +V  + +D+IG +L  A  G IL+ F    G    W+TA+II                +E
Sbjct: 281 DVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWE 340

Query: 316 VKYAESPLLPVEVTKNRHIIMILAALF 342
           +K+++ PL P  + K+R I   L   F
Sbjct: 341 IKFSKVPLTPWALIKDRGIFFALVIAF 367

>CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121w
          Length = 583

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 49/231 (21%), Positives = 88/231 (38%), Gaps = 18/231 (7%)

Query: 36  EEIEKDVISQTETPQLEHSKWQNPDY--FQNQWQEYLFIFSCMMSQLLNQAATPQTLSIM 93
           +E  K+ I +T + Q E      P Y  F  +++  L +  C  + L +  A      ++
Sbjct: 47  DEAVKEPIYRTRSNQTEPDIANAPPYSRFDAKYKMAL-VLQCAYTGLFSTMAGAIYYPVL 105

Query: 94  NIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISG 153
           ++I   F+         +  + +  G    + G + D  G +       + F +      
Sbjct: 106 SVIEKQFHITEELVNITVVVYFIFQGIAPTLMGGLADSLGRRPV-----VLFAVTVYFGA 160

Query: 154 LTKYSHSDTF--FIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIG 211
               + + T+   +V R  Q   I+ ++    GI+G++    + R   V  + G      
Sbjct: 161 CIGLACAQTYAQIVVLRCLQAAGISPVIAINSGIIGDV-TTRAERGGYVGYISGFQV--- 216

Query: 212 AFFGSLFAGLIGTEDPDQWPWA--FYAFAIASAFNLAISIYSIPNSVPTNV 260
              GS F  LIG     +W W   F+  AI S   L  SI  +P +  T V
Sbjct: 217 --LGSAFGALIGAGLSSRWGWRSIFWFLAIGSGVCLVFSIIMLPETKRTIV 265

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 37/81 (45%), Gaps = 3/81 (3%)

Query: 265 MDWIGSVL--AVIGLILLNFVWNQGPIVGWQTAYIIXXXXXX-XXXXXXXXTYEVKYAES 321
           +D IG +L  A  G +L+ F    G    W+TA+II                +E+KY+  
Sbjct: 283 LDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRH 342

Query: 322 PLLPVEVTKNRHIIMILAALF 342
           PL P ++ K+R I   L   F
Sbjct: 343 PLTPWDLIKDRGIFFALLIAF 363

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 9/106 (8%)

Query: 237 FAIASAFNLAISIYSIPNSVPTNVHGF-----AMDWIGSVL--AVIGLILLNFVWNQGPI 289
            AI +  ++ ++I S P S+    H +      +D +G +L  A   LIL+     +G  
Sbjct: 235 LAIKNKEDVKLTI-SKPRSISWARHLYDIFFWKLDMLGLILLVAFFALILVPLTLAKGLH 293

Query: 290 VGWQTA-YIIXXXXXXXXXXXXXXTYEVKYAESPLLPVEVTKNRHI 334
            GW +A +I+              T+E+K+A +P+ P+++ K+R I
Sbjct: 294 EGWGSAKFIVPEVLGWALALPLFLTWELKFASNPITPLDLIKDRGI 339

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 5/65 (7%)

Query: 228 DQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGS--VLAVIGLILLNFV-- 283
           + W WA +     +   + +S+  I N +P NV+G +  W  S  +L + GLI+L+F+  
Sbjct: 210 EYWAWAEHV-PKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFILF 268

Query: 284 WNQGP 288
           W  GP
Sbjct: 269 WGGGP 273

>CAGL0J00363g Chr10 (27627..29123) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P38776 Saccharomyces cerevisiae
           YHR048w
          Length = 498

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 52/129 (40%), Gaps = 10/129 (7%)

Query: 128 IGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVG 187
           I ++YG + T V      IIW     LT +S +    +  R   G   +  L    G + 
Sbjct: 116 ISELYGRRITFVSSLFLSIIWQC---LTTWSKTIEGVLFGRFLSGFFGSVFLSVAGGAIS 172

Query: 188 NIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLI-GTEDPDQWPWAFYAFAIASAFNLA 246
           +I+    ++K I I M  A     AF G     +I G      + W F    IAS   L 
Sbjct: 173 DIF----SKKQIGIPM--AIYTTAAFLGPSLGPIISGALYHANYKWTFVTLLIASGVCLT 226

Query: 247 ISIYSIPNS 255
           + + S+P +
Sbjct: 227 LIVISVPET 235

>KLLA0E16083g Chr5 complement(1432567..1438476) [5910 bp, 1969 aa]
           {ON} similar to uniprot|P50077 Saccharomyces cerevisiae
           YGR217W CCH1 Voltage-gated calcium channel involved in
           calcium influx in response to mating pheromones
          Length = 1969

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 43/101 (42%), Gaps = 17/101 (16%)

Query: 196 RKNIVISMIGASAPIGAFFGSL-----FAGLIGTEDPDQWPWAFYAF--------AIASA 242
           +  IVI  + A   +  F  SL     F G +  +D +  P+ FY+          IAS 
Sbjct: 815 KNAIVIWNLSAFYFLFVFLASLIVLLYFDGTLDADDMEDTPFGFYSLPNAFLTLIKIAST 874

Query: 243 FNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFV 283
            N   S+Y++    PT          GSVL ++  IL NFV
Sbjct: 875 ENWTDSLYALQRDSPTLFSAL----FGSVLLILWFILSNFV 911

>Kwal_14.782 s14 (42720..44195) [1476 bp, 491 aa] {ON} YGR260W
           (TNA1) - Tna1p is a high affinity nicotinic acid plasma
           membrane permease [contig 245] FULL
          Length = 491

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 47/113 (41%), Gaps = 4/113 (3%)

Query: 147 IWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGA 206
            WS+I+  + +  S    + +R   G       P +  ++  +YKP    K I     G+
Sbjct: 126 CWSVITLSSGFVQSYGSLLATRILLGTFEGGFFPAMTLLITMMYKPKEQAKRIAF-FFGS 184

Query: 207 SAPIGAFFGSLFAGLIG---TEDPDQWPWAFYAFAIASAFNLAISIYSIPNSV 256
           SA  GAF G +  GL     T   + W W +    + S    A   + +P+++
Sbjct: 185 SALSGAFGGLIATGLASVKSTSGLEGWRWLYIIEGLISVCATAWLFFGLPDNL 237

>NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 2/81 (2%)

Query: 265 MDWIGSVL--AVIGLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAESP 322
           +D IG++L  A +G IL+      G    W  + +I               +E K+A  P
Sbjct: 280 LDIIGTLLFTACLGCILVPLTLAGGTNSKWNNSRVIGPFVLGFVLIPILGVWEYKWARDP 339

Query: 323 LLPVEVTKNRHIIMILAALFL 343
           L+P ++ ++R +   L   FL
Sbjct: 340 LIPYKLVRDRGVWAALGISFL 360

>ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL065W (AQR1),
           YIL121W and YIL120W (QDR1); Tandem gene duplication in
           Saccharomyces cerevisiae
          Length = 534

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 43/202 (21%), Positives = 76/202 (37%), Gaps = 28/202 (13%)

Query: 37  EIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAA------TPQTL 90
           +I +  +S +E  ++ HS  +    +  +W         MM  LL  A       +P   
Sbjct: 44  KIGEACVSTSEISKIPHSMLR----YSQKW---------MMVALLTSAGFWSSLGSPAVY 90

Query: 91  SIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSI 150
             +  +   F          +  + L  G    +   + D YG +  ++ G + FI+ SI
Sbjct: 91  PALRNLQREFGVSEDLVNIAVVVYLLFQGVAPTVCSGLADTYGRRPVILMGMLIFIVSSI 150

Query: 151 ISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPI 210
             G+   S+S    I  R  Q   I+ I+    G+VG+ +   S R   + ++ G +   
Sbjct: 151 --GIA-CSNSFALVIALRCIQSSGISPIIAINSGVVGD-FTLKSERGTFIGAVSGLT--- 203

Query: 211 GAFFGSLFAGLIGTEDPDQWPW 232
               G  F  LIG      + W
Sbjct: 204 --LLGQAFGSLIGASLTAAYNW 223

>NDAI0C05670 Chr3 complement(1310115..1311617) [1503 bp, 500 aa]
           {ON} Anc_8.570
          Length = 500

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 44/110 (40%), Gaps = 4/110 (3%)

Query: 158 SHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSL 217
           SH    F + R  Q    + ++    G V +I  P    K I   M+G +  IG     +
Sbjct: 120 SHIGALFAM-RVVQAFGSSSVITLGAGTVTDITPPKHRGKAIAYFMMGPN--IGPVIAPI 176

Query: 218 FAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDW 267
            AGLI  +  D W W F   AI S   L   I  +P ++   V  +   W
Sbjct: 177 IAGLILMKG-DYWRWLFGFTAIMSGIGLFAIIIFLPETLRCIVGNYDPRW 225

>KLLA0C03454g Chr3 (311611..314313) [2703 bp, 900 aa] {ON} similar
           to uniprot|P25360 Saccharomyces cerevisiae YCR037C PHO87
           Low-affinity inorganic phosphate (Pi) transporter
           involved in activation of PHO pathway expression is
           independent of Pi concentration and Pho4p activity
           contains 12 membrane-spanning segments and to
           uniprot|P39535 Saccharomyces cerevisiae YJL198W PHO90
          Length = 900

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 206 ASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIAS-AFNLAISIYSIPNSVPTNVHGFA 264
           A  PI  FFG+   GL+ T D + +PW+    A+   A   A+S   +  ++  ++    
Sbjct: 722 AVIPIVLFFGT---GLLTTHDINNFPWSIVILAMGGIALGAAVSSSGLLGTIAGSLQKRV 778

Query: 265 MDW-IGSVLAVIGLILL 280
           MD+   ++L + G+++L
Sbjct: 779 MDYPTYAILCIFGIVML 795

>TPHA0A01410 Chr1 (276357..279200) [2844 bp, 947 aa] {ON} Anc_8.357
           YDR166C
          Length = 947

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 7/88 (7%)

Query: 46  TETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMN--IITDSFNSE 103
           T+T  L  SKWQN   FQ++  E   I   +M+Q +     P   S +N  I+ D  N++
Sbjct: 32  TKTTDL--SKWQNVSDFQDESYE---ILKDLMNQKILDNNNPSNNSQINNDIVADPLNNK 86

Query: 104 GGKETWLIASFPLVSGSFILISGRIGDI 131
              E   +   PL   S  LI+ +  D+
Sbjct: 87  KMLEVLNMNKIPLEMQSNFLINNKKFDV 114

>Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL065W
           (SIT1) - Ferrioxamine B permease [contig 8] FULL
          Length = 591

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 36/80 (45%), Gaps = 3/80 (3%)

Query: 258 TNVHGFAMDWIG--SVLAVIGLILLNFVWNQGPIVGWQTAYIIXXXXXX-XXXXXXXXTY 314
           T V  + +D +G   V  V G IL+ F         WQTA II                +
Sbjct: 249 TEVFFWRLDAVGLIMVCVVFGCILIPFTLAGSLKDKWQTAEIIVPEVIGWCVALPLFLLW 308

Query: 315 EVKYAESPLLPVEVTKNRHI 334
           E+K+A+ PL+P  V K+R I
Sbjct: 309 EMKFAKHPLVPWNVIKDRGI 328

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 2/83 (2%)

Query: 263 FAMDWIGSVLAVI--GLILLNFVWNQGPIVGWQTAYIIXXXXXXXXXXXXXXTYEVKYAE 320
           + +D IG+ +  +  G IL+      G    W  + II               YE+K+A 
Sbjct: 308 WKLDTIGTFIMTVSLGCILVPLTLAGGTSSKWDDSQIIGPLVLGVVLLPMLIVYELKWAR 367

Query: 321 SPLLPVEVTKNRHIIMILAALFL 343
            P+LP ++ K+R +   ++  FL
Sbjct: 368 EPILPWKLIKDRAVWASMSISFL 390

>Kpol_1048.45 s1048 (117855..119801) [1947 bp, 648 aa] {ON}
           (117855..119801) [1947 nt, 649 aa]
          Length = 648

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 69/184 (37%), Gaps = 13/184 (7%)

Query: 85  ATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIF 144
           A P      N+ T + NS       + A  PL+ G F        DI G K   +   + 
Sbjct: 194 ALPTLQKAFNVSTTTINSTVSVFMAVFAIGPLIWGHF-------ADICGRKWLYLCSLLL 246

Query: 145 FIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMI 204
             I +I+           +F+  R FQ  S + ++    G V +I  P    K I   M+
Sbjct: 247 MTIVNILLASLPAKIGLLYFL--RIFQAFSSSSVMSMGAGTVTDITAPKHRGKAIAYFMM 304

Query: 205 GASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFA 264
           G +  +G     + AG+I     D W W F   +I S     + +  +P ++   V    
Sbjct: 305 GPN--MGPIVAPIIAGVILIN--DNWRWLFGFTSIMSGVAFFLVLVFLPETLRCMVGNGD 360

Query: 265 MDWI 268
             WI
Sbjct: 361 KRWI 364

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 49/109 (44%), Gaps = 9/109 (8%)

Query: 124 ISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVM 183
           ISG + D+YG +  ++ G + ++I SI    +K S+    F+  R  Q   I+ I+    
Sbjct: 137 ISGGLADVYGRRPIILLGMLIYVIASIGLACSK-SYGAVVFL--RCLQSAGISPIIAINS 193

Query: 184 GIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPW 232
           G+ G+ +   S R   V ++ G +       G  F  LIG      + W
Sbjct: 194 GVAGD-FTVKSERGTFVGAVSGFT-----LMGQAFGSLIGAALTAAYDW 236

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,604,065
Number of extensions: 1805383
Number of successful extensions: 5992
Number of sequences better than 10.0: 246
Number of HSP's gapped: 6021
Number of HSP's successfully gapped: 251
Length of query: 542
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 428
Effective length of database: 40,409,475
Effective search space: 17295255300
Effective search space used: 17295255300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)