Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B002808.844ON1081108151510.0
NDAI0E002708.844ON1198100819830.0
KAFR0A028508.844ON1042105517750.0
TDEL0B005408.844ON111584817350.0
CAGL0B02365g8.844ON1050107117100.0
Smik_13.178.844ON113190116560.0
YML117W (NAB6)8.844ON113490815970.0
TPHA0I002708.844ON1039102715860.0
KNAG0G034408.844ON105385515040.0
ZYRO0G14256g8.844ON125978514600.0
KLTH0C03784g8.844ON99787014271e-180
SAKL0D01364g8.844ON108287113531e-168
Kwal_27.102398.844ON91480313131e-164
Ecym_46158.844ON106784212681e-156
KLLA0D01485g8.844ON115194810901e-129
Suva_13.268.844ON11224419951e-116
Kpol_1068.58.844ON10322869701e-113
Skud_13.248.844ON11282979601e-111
TBLA0B032808.844ON13622939411e-107
ABL122C8.844ON10432628712e-99
NCAS0H010406.183ON6292254471e-45
KLLA0E19031g6.183ON6522004482e-45
TBLA0B052106.183ON7102254474e-45
AFL061C6.183ON5232004341e-44
Ecym_22336.183ON5762004334e-44
SAKL0A05280g6.183ON5822004326e-44
NDAI0F022606.183ON6802014341e-43
TDEL0G016206.183ON5842004273e-43
Kpol_1002.696.183ON5902004264e-43
Kwal_27.111586.183ON5672004254e-43
CAGL0C01419g6.183ON6392004284e-43
KAFR0B066906.183ON5332004217e-43
ZYRO0G08140g6.183ON6322014258e-43
KNAG0M004306.183ON4432004141e-42
KLTH0H04906g6.183ON5692004211e-42
Suva_16.1236.183ON5962004123e-41
YPL184C (MRN1)6.183ON6122004097e-41
Smik_6.3906.183ON6252004098e-41
Skud_16.946.183ON6142004052e-40
TPHA0J022106.183ON5932043981e-39
ZYRO0F07238g8.670ON389209980.005
TPHA0D012108.670ON364204830.33
TDEL0A061608.670ON37868771.8
KLLA0A04103g7.75ON78555762.6
Skud_4.352.61ON31756752.9
KLTH0E10868g8.466ON34159743.9
KAFR0C043501.342ON663167744.2
KLTH0G10912g2.306ON436105735.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B00280
         (1081 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844    1988   0.0  
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     768   0.0  
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   688   0.0  
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   672   0.0  
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   663   0.0  
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...   642   0.0  
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...   619   0.0  
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   615   0.0  
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   583   0.0  
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   566   0.0  
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   554   e-180
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   525   e-168
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   510   e-164
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   493   e-156
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   424   e-129
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...   387   e-116
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   378   e-113
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...   374   e-111
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   367   e-107
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   340   2e-99
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   176   1e-45
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   177   2e-45
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   176   4e-45
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   171   1e-44
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   171   4e-44
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   171   6e-44
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    171   1e-43
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   169   3e-43
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   168   4e-43
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   168   4e-43
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   169   4e-43
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   166   7e-43
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   168   8e-43
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   164   1e-42
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   166   1e-42
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   163   3e-41
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   162   7e-41
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   162   8e-41
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   160   2e-40
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   157   1e-39
ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {...    42   0.005
TPHA0D01210 Chr4 complement(253331..254425) [1095 bp, 364 aa] {O...    37   0.33 
TDEL0A06160 Chr1 complement(1078577..1079713) [1137 bp, 378 aa] ...    34   1.8  
KLLA0A04103g Chr1 (369258..371615) [2358 bp, 785 aa] {ON} simila...    34   2.6  
Skud_4.35 Chr4 (62864..63817) [954 bp, 317 aa] {ON} YDL218W (REAL)     33   2.9  
KLTH0E10868g Chr5 (975831..976856) [1026 bp, 341 aa] {ON} simila...    33   3.9  
KAFR0C04350 Chr3 (860142..862133) [1992 bp, 663 aa] {ON} Anc_1.3...    33   4.2  
KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some s...    33   5.2  

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score = 1988 bits (5151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 977/1081 (90%), Positives = 977/1081 (90%)

Query: 1    MVGPHSRRNSGXXXXXXXXXXXXXXXXXXXXXXXXRKPSYGPLGPGTNSMLFYQGEQARX 60
            MVGPHSRRNSG                        RKPSYGPLGPGTNSMLFYQGEQAR 
Sbjct: 1    MVGPHSRRNSGYQAFQLQQQQQQSQQYMQYNGQRQRKPSYGPLGPGTNSMLFYQGEQARS 60

Query: 61   XXXXXXXXXXXXXXLPNVPPTPFDTAYGATLLPSHLLMGSPFVATPTTGHSQSAIFQQPY 120
                          LPNVPPTPFDTAYGATLLPSHLLMGSPFVATPTTGHSQSAIFQQPY
Sbjct: 61   QYFPTQQPYYQTSPLPNVPPTPFDTAYGATLLPSHLLMGSPFVATPTTGHSQSAIFQQPY 120

Query: 121  MMTPNRASFSQIPSMLNVGNPPSARRQGNQNDPNRRRSSYRSKVPETDPKTLFLQPFRMS 180
            MMTPNRASFSQIPSMLNVGNPPSARRQGNQNDPNRRRSSYRSKVPETDPKTLFLQPFRMS
Sbjct: 121  MMTPNRASFSQIPSMLNVGNPPSARRQGNQNDPNRRRSSYRSKVPETDPKTLFLQPFRMS 180

Query: 181  YKILPSGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYLINHHDSDKPDDDTEC 240
            YKILPSGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYLINHHDSDKPDDDTEC
Sbjct: 181  YKILPSGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYLINHHDSDKPDDDTEC 240

Query: 241  RSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQDXXXXXXTNIVDEP 300
            RSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQD      TNIVDEP
Sbjct: 241  RSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQDENEEEETNIVDEP 300

Query: 301  SFYTKESVYFELSNPQATRSILIQFKNPCSEQELFDKKLKFLNQENNSRYILESIDLVNV 360
            SFYTKESVYFELSNPQATRSILIQFKNPCSEQELFDKKLKFLNQENNSRYILESIDLVNV
Sbjct: 301  SFYTKESVYFELSNPQATRSILIQFKNPCSEQELFDKKLKFLNQENNSRYILESIDLVNV 360

Query: 361  TQTENEFPKHYAILTFINILMAMEICDYLKIHGPRYGIQDCMFVQVIPKAVSCVSSKRAS 420
            TQTENEFPKHYAILTFINILMAMEICDYLKIHGPRYGIQDCMFVQVIPKAVSCVSSKRAS
Sbjct: 361  TQTENEFPKHYAILTFINILMAMEICDYLKIHGPRYGIQDCMFVQVIPKAVSCVSSKRAS 420

Query: 421  IISKDNDNNDETLSSQQKKNDILKNSSIISLPSAENDQVXXXXXXXXXXXXXXXTNIEEL 480
            IISKDNDNNDETLSSQQKKNDILKNSSIISLPSAENDQV               TNIEEL
Sbjct: 421  IISKDNDNNDETLSSQQKKNDILKNSSIISLPSAENDQVSDEEKLDKLSEKLKSTNIEEL 480

Query: 481  ILIVDTATYPRPSFLSHDEHLPNATLSLSSSSNPFEQQLPYSYEEDDDQRTNVRSGSLPA 540
            ILIVDTATYPRPSFLSHDEHLPNATLSLSSSSNPFEQQLPYSYEEDDDQRTNVRSGSLPA
Sbjct: 481  ILIVDTATYPRPSFLSHDEHLPNATLSLSSSSNPFEQQLPYSYEEDDDQRTNVRSGSLPA 540

Query: 541  NPQFPNMPNLPKGYISPNPNMNYNTPLMYPNGYFVNDPAFSMXXXXXXXXXXXXPISKTL 600
            NPQFPNMPNLPKGYISPNPNMNYNTPLMYPNGYFVNDPAFSM            PISKTL
Sbjct: 541  NPQFPNMPNLPKGYISPNPNMNYNTPLMYPNGYFVNDPAFSMNNNYNNNTNYRNPISKTL 600

Query: 601  EQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFI 660
            EQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFI
Sbjct: 601  EQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFI 660

Query: 661  TFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPE 720
            TFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPE
Sbjct: 661  TFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPE 720

Query: 721  FAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAA 780
            FAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAA
Sbjct: 721  FAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAA 780

Query: 781  IRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVKSISNN 840
            IRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVKSISNN
Sbjct: 781  IRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVKSISNN 840

Query: 841  VKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGIGIDTVSNNEEDGNIEKGNTLSK 900
            VKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGIGIDTVSNNEEDGNIEKGNTLSK
Sbjct: 841  VKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGIGIDTVSNNEEDGNIEKGNTLSK 900

Query: 901  IDTDVNGFNALGFKIEPKHDMMNETMDNNTEGNNTLXXXXXXXXXXXXLMISSPKESVQK 960
            IDTDVNGFNALGFKIEPKHDMMNETMDNNTEGNNTL            LMISSPKESVQK
Sbjct: 901  IDTDVNGFNALGFKIEPKHDMMNETMDNNTEGNNTLENISSDESSNIELMISSPKESVQK 960

Query: 961  GDVITNQKPHSNNHHNFKRNSSSNRQRYKEXXXXXXXXXXXXXXXXXXXXKEFGFGISPN 1020
            GDVITNQKPHSNNHHNFKRNSSSNRQRYKE                    KEFGFGISPN
Sbjct: 961  GDVITNQKPHSNNHHNFKRNSSSNRQRYKETDTQNTHRNNNNSNATFAPNKEFGFGISPN 1020

Query: 1021 VDEHQKNNKKHNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYYDESN 1080
            VDEHQKNNKKHNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYYDESN
Sbjct: 1021 VDEHQKNNKKHNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYYDESN 1080

Query: 1081 A 1081
            A
Sbjct: 1081 A 1081

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/1008 (44%), Positives = 598/1008 (59%), Gaps = 136/1008 (13%)

Query: 36   RKPSYGPLGPGTNS--MLFYQGEQARXXXXXXXXXXXXXXXLPNVPPTPFDTAYGATLLP 93
            RKPSY  L    ++  M++                      LPN PPTPFDTAYGATLLP
Sbjct: 38   RKPSYISLNHSVHNPNMVYQHDPNGSQYFATTQQAYYIPSPLPNAPPTPFDTAYGATLLP 97

Query: 94   SHLLMGSPFVATP------TTGHSQSAIFQQPYMMTPNRASFSQIPSMLNVGNPPSARRQ 147
            SHLLMGSP+V+TP      +   SQ  ++ Q    TPNR SFSQ+ SMLN    PS+R  
Sbjct: 98   SHLLMGSPYVSTPNGIVPSSQQQSQMFLYSQSPAGTPNRKSFSQLNSMLN---QPSSRSN 154

Query: 148  GNQNDPNRR-RSSYRSKVPETDPKTLFLQPFRMSYKILPSGDDAYRTRSLLFENVVNSIE 206
               +  N R +++ ++++PE DP  LF +PF +SYK+LP+GDDAYRTRSLLF NV +SI+
Sbjct: 155  FFTDSYNNRYQNNPQTRIPEVDPNELFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSID 214

Query: 207  LHTFMTEFVRFSPIESVYLINHHDSDKPDD---DTECRSILLSFLTREVCLTFYNNVLQR 263
            LH+F+ +FV++S IES+YLI++ D +K  D   D   RSILLSFL+RE+CL+FYNNVLQR
Sbjct: 215  LHSFIYDFVQYSSIESIYLISNTDDEKDQDNENDKNKRSILLSFLSREICLSFYNNVLQR 274

Query: 264  LKEFKAKLKSENLRLSFVSIKY--------------------QDXXXXXXTNIVD-EPSF 302
            L EFK  L+S++L L+FV + Y                    Q+      TN  D   S 
Sbjct: 275  LNEFKTNLQSKSLTLNFVILNYLEKTDDGSTANISNNQLNQIQENENDVNTNEFDYRNSM 334

Query: 303  YTKESVYFELSNPQATRSILIQFKNPCSEQELFDKKLKFL-NQENNSRYILESIDLVNVT 361
             T  ++ F+L NP ATR I+I+ K  C ++ L +K L FL + + N RYILESIDL N+ 
Sbjct: 335  NTVNALKFDLINPDATRFIMIELKTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFNII 394

Query: 362  QTENE-------------------------------------FPKHYAILTFINILMAME 384
            + EN                                      FP HYA+L+FINI MAME
Sbjct: 395  ENENSSENKSIIEAKNENENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAME 454

Query: 385  ICDYLKIHGPRYGIQDCMFVQVIPKAVSCVSSKRASIISKDNDNND-------ETLSSQQ 437
            + DYLK++G ++GI +  +VQ+     S  SS + S ++   DN D       E++  + 
Sbjct: 455  LRDYLKLNGLKHGITNASYVQIKHVKKSLNSSSKRSSVTSTTDNKDKSEVDTNESVEGKD 514

Query: 438  KKNDILK--NSSIISLPSAENDQV---XXXXXXXXXXXXXXXTNIEELILIVDTATYPRP 492
            KK++  K  N+ + S+  +  D                      ++E I ++D ATY  P
Sbjct: 515  KKSEEAKSFNNKLSSITMSSPDTTYEGEDDIDIDIIISKLQKLKLKETIQVLDIATYNTP 574

Query: 493  SFLSHDEHLPNATLSLSSSSNPFEQQL----PYSYEEDDDQRTNVRSGSLPANPQFPNMP 548
             F SHD H+ N TLS+    NPFE QL    P +    D    N+    LP  P  P++ 
Sbjct: 575  LFQSHDSHMANITLSIV---NPFEAQLMRPPPSNIVSPDQNHENLSYPILP--PTLPSIE 629

Query: 549  NLP-----------------------KGYISPNPNMNYNTP---LMYPNGYFVNDPAFSM 582
              P                         Y   + + NYNT    +   N    N+  F +
Sbjct: 630  KFPTRDQTLNQETSGRRSLSSSSTSLSNYQGRSNSNNYNTEAKEVKEQNKGERNEGIFFV 689

Query: 583  XXXXXXXXXXXXPISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVR 642
                        PI +TLE    T++QV +S+G + GNRTIYIGN+N RSK ED+CNVVR
Sbjct: 690  EQPTFNTDPTMYPIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVR 749

Query: 643  GGILQNVKYIEHKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAV 702
            GGILQ++K I  K ICF+TFIEASAA+ FYANSFIDP++LH +TLKIGWGNY EPL K++
Sbjct: 750  GGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSI 809

Query: 703  ALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQIN 762
            ALAVT+GASRNVYVSLPEFAFKDKF+NDPEY+E+H+KYKLP   QLR DF+KYG IEQIN
Sbjct: 810  ALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQIN 869

Query: 763  YLKDSHCCWVNFLNISAAIRLVEDA-HNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKS 821
            YL DSHCCWVNF+NI++AI+LVED  +NP ++ FS+KFN+RYDGLIINYGKDRCGNVN++
Sbjct: 870  YLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRN 929

Query: 822  LMSNKNSRFYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGIGID 881
            L+SNKNSR Y+KVK  S+N KL++L+EKR+ + E+   L     +D +L  LDA GIG+ 
Sbjct: 930  LISNKNSRHYRKVKKFSDNYKLRQLQEKRRVEQEKGKEL-NGGVNDNKLPSLDALGIGLQ 988

Query: 882  TVS---------NNEEDGNIEKGNTLSKIDTDVNGFNALGFKIEPKHD 920
              +         +NE+D N +   T    ++D N FNALGF+I+   D
Sbjct: 989  RTAPPEEQKVPESNEDDANYDSAVT----ESDTNTFNALGFRIQSNTD 1032

 Score = 82.4 bits (202), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (86%)

Query: 1036 KEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYYDESNA 1081
            K+ RVIPG+DVMAQYL QLQHSTFMYAANILG SAED +YYDE + 
Sbjct: 1152 KQQRVIPGADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDEEDT 1197

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
            Anc_8.844 YML117W
          Length = 1042

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/1055 (41%), Positives = 605/1055 (57%), Gaps = 140/1055 (13%)

Query: 75   LPNVPPTPFDTAYGATLLPSHLLMGSPFVATPTT-GHSQSAIFQQPYMMTPNRASFSQIP 133
            LPN PPTPFDTAYGATLLPSHLLMGSPF+++P      Q    QQ +    N  S +   
Sbjct: 70   LPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNVPTPQQQYFLQQQFNTNNNNGSSTPRK 129

Query: 134  SMLNVGNPPSARRQGNQNDPNRRRSSY-----------RSKVPETDPKTLFLQPFRMSYK 182
            S   V N P + R    ++   +R S+            +   +   + LF +P  +SY 
Sbjct: 130  SFFKVSNRPISSRSSRFSE---KRKSFIINNPTTNNSNNNNNNKEILEKLFTEPINISYV 186

Query: 183  ILPSGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYLI-NHHDSDKPDDDTECR 241
            ILP GDDAYRTRSLLFENV N+I LH+F+T FV+ + IES+YL+ N +DS+  D      
Sbjct: 187  ILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNKNDSNTCD------ 240

Query: 242  SILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQDXXXXXXTNIVDEPS 301
             I+LSFL+R +CL FYNNVLQRLKEFK  L SE+L L+FVS+KY                
Sbjct: 241  -IILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTTRDNQ-------- 291

Query: 302  FYTKESVYFELSNPQATRSILIQFKNPCS---------EQELFDKKL-KFLNQENNSRYI 351
                 S+ F +    ATRS+ I+    CS         +++LF+K L + L  + N RY+
Sbjct: 292  ---GPSLEFNIVTRDATRSLAIEL---CSNENDSLILEKEQLFEKILNEILRTDENKRYV 345

Query: 352  LESIDLVNVTQTENEFPKHYAILTFINILMAMEICDYLKIHGPRYGIQDCMFVQVIP--- 408
            LESIDLV+  ++  EF K+YAIL+F+NI MA+EI DY+++   +  I  C FV + P   
Sbjct: 346  LESIDLVSTDKSNKEFGKNYAILSFLNITMAIEIMDYIQVISSKLNIGKCSFVTIQPLIE 405

Query: 409  -------KAVSCVSSKRASIISKDNDNNDETLSSQQKKNDILKNSSIISLPSAENDQVXX 461
                    A+S  ++ ++S+ S+ N+N +   S+   KN I    S  S  S + + +  
Sbjct: 406  NNVMNNSSALSSATNIQSSVSSEGNNNQNNNGSTFFHKNSINSLLSSESSVSIDEEVISI 465

Query: 462  XXXXXXXXXXXXXTNIEELILIVDTATYPRPSFLSHDEHLPNATLSLSSSSNPFEQQLPY 521
                           ++++ L +    YP P F    +HLPN T+S+ +  +    Q+P 
Sbjct: 466  ADKLKG-------IKLKDISLDILPRDYPEPEFNFSTDHLPNVTISVPTQLD----QIPG 514

Query: 522  SYEEDDDQRTNVRSGSLPANPQFP-----NMPNLPKGYISPNPNMNYNTPLMYPNGYFVN 576
            +           R+  +  N   P     +M N     +S N     NTP++ P+  F  
Sbjct: 515  T----------PRTQEIYINDMSPSFEGIDMMNSSSTMLSGNGTFISNTPMLIPSQSFYM 564

Query: 577  DPAFSMXXXXXXXXXXXXPISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVED 636
            D    +            PI+ +LE   +T+++V +++G+DAGNRTIYIGNIN RSK ED
Sbjct: 565  DQNTQIQEAPFRSNSFIHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAED 624

Query: 637  ICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVE 696
            ICNVVRGGILQ++K+IE KHICF+TFIEA+AA+ FYAN+FIDPIVLH +TLK+GWGNY  
Sbjct: 625  ICNVVRGGILQSIKFIESKHICFVTFIEAAAAVQFYANAFIDPIVLHGNTLKLGWGNYSG 684

Query: 697  PLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYG 756
            PLPK++ALAVT+GASRNVYVSLPEFAFKDK+INDPE++EYH+K+KLP  +QLRIDFS YG
Sbjct: 685  PLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYG 744

Query: 757  GIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCG 816
              EQINYL DSHCCWVNF+NIS+AI+LVE+A N  + +F+EKF+ RY+GL+INYGKDRCG
Sbjct: 745  PTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFD-RFNEKFDERYNGLVINYGKDRCG 803

Query: 817  NVNKSLMSNKNSRFYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAF 876
            N+NK+L++ KNSRFYK  ++  +N KL +LEEKR+    R N  +   + +  +     +
Sbjct: 804  NINKNLIAGKNSRFYKIRQN--HNFKLSKLEEKRRDHDRRENGFKHVYNDEETI-----Y 856

Query: 877  GIGIDTVSNNEEDGNIEKGNTLSKIDTDVNGFNALGFKIEPKHDMMNETMDNNTEGNNTL 936
               ++T + + E+     G  L          ++LG  +E K+++ ++        N+ L
Sbjct: 857  NESMETDNQHNEESKENDGKFLQ--------LDSLGISLESKNEIADDI-------NDAL 901

Query: 937  XXXXXXXXXXXXLMISSPKESVQKGDVITNQKPHSNNHHNFKRN-SSSNRQRYKEXXXXX 995
                              ++S+ K +   N   HS++  + +   +S N  R K+     
Sbjct: 902  TVDQFEN-----------EKSITKNNGFENTSFHSDSSSDIELIINSPNSLRTKDNDVLD 950

Query: 996  XXXXXXXXXXXXXXXKEFGFGISPNVDEHQKNNKKHNTND-----------KEARVIPGS 1044
                              G+          KN+   N ND           + +R IPGS
Sbjct: 951  SEKIINSANTTNRTGNANGY----------KNDYTKNRNDGMRNNRSRNRSRYSRTIPGS 1000

Query: 1045 DVMAQYLAQLQHSTFMYAANILGASAEDGSYYDES 1079
            DVMAQYLAQLQHSTFMYAANILGAS E+  YYDE+
Sbjct: 1001 DVMAQYLAQLQHSTFMYAANILGASGEE-EYYDEA 1034

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
           YML117W
          Length = 1115

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/848 (43%), Positives = 507/848 (59%), Gaps = 81/848 (9%)

Query: 77  NVPPTPFDTAYGATLLPSHLLMGSPFVATP---------TTGHSQSAIFQQPYMMTPNRA 127
           N PPTPFDTAYG TLLPSHLLMGSPFV++P            H +   +      + +  
Sbjct: 55  NAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLFQQPHHHQHAHQRLQQYSHNQSKSSSGR 114

Query: 128 SFSQIPSMLNVG---NPPSARRQGNQNDPNRRRSSYRSKVPETDPKTLFLQPFRMSYKIL 184
           SF ++ +   V    N P A R    N   RR S Y+S +  +D    F  PF ++Y++L
Sbjct: 115 SFGKLATAYPVPPSLNSPPASRNALHNRGPRRGSHYKS-IQSSDASKRFKDPFILTYRVL 173

Query: 185 PSGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYLINHHDSDKPDDDTECRSIL 244
           P G+D +RTRSLLFENV  SI+LH+F+T F  + P+ESVYL           + +  SIL
Sbjct: 174 PKGNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYLFK--------SEGDHVSIL 225

Query: 245 LSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKY------QDXXXXXXTNIVD 298
           LSF ++ +CL FYN+VLQRL E+K+ L S+ L LSFVS++Y      ++       +  D
Sbjct: 226 LSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVSDTSEEDIDKEDDSKPD 285

Query: 299 EPSFYTKESVYFELSNPQATRSILIQFKNPCSEQELFDKKLKFLNQENNSRYILESIDLV 358
             +     S+ +++ N  ATRSI+I FK PCS+ EL DKKL+FL +ENN+RY+LESIDLV
Sbjct: 286 AFNITAAGSLRYDVINRGATRSIMITFKTPCSKDELIDKKLEFLKKENNTRYVLESIDLV 345

Query: 359 NVTQTENEFPKHYAILTFINILMAMEICDYLKIHGPRYGIQDCMFVQVIPKAVSCVSSKR 418
              +    FP++YA+LTF+NI MA+EI DY+++H  +  I  C F+ + P+       KR
Sbjct: 346 TADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQKLDISKCFFISIQPQ---IPDGKR 402

Query: 419 ASIISKDNDNNDETLSSQQKKNDILKNSSIISLPSAENDQVXXXXXXXXXXXXXXXTNIE 478
            S+ S  N  + E++S   +     KN+S+ SL S+    +                N +
Sbjct: 403 LSVSSASNGRSMESISGNYRS----KNASVTSLESS-GSIISLDQEIDEMTYKLQSVNSK 457

Query: 479 ELILIVDTATYPRPSFLSHDEHLPNATLSLSSS-------SNPFE----------QQLPY 521
           + IL V T  Y  PSF  H +HL N T+S ++S        +P E          Q +P 
Sbjct: 458 KNILEVTTNNYKDPSFEGHTDHLTNVTVSEAASLDSQLTMPSPQEVTVNEYVLPNQDMPL 517

Query: 522 SYEEDDDQRTNVRSGSLPANPQFPNMPNLPKGYISPNPNMNYNTPLMYPNGYFVNDPAFS 581
             + +            P+      MPN P G   P PN+  N  +              
Sbjct: 518 PNDMNYAPSVQDVDAVPPSMVPMSTMPNTPYGCYMPPPNVRQNGNM-------------- 563

Query: 582 MXXXXXXXXXXXXPISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVV 641
                        PI+++L++   T+++V +S+G   GNRT+YIGNI+ RS+ EDICNVV
Sbjct: 564 -----------TKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDICNVV 612

Query: 642 RGGILQNVKYIEHKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKA 701
           RGGILQNVK++  K ICF+TF+EASAA+ FY N+FIDPIVLH + LK+GWG++  PLPK+
Sbjct: 613 RGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKS 672

Query: 702 VALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQI 761
           +ALAVTVGASRNVYVSLPEFAFKDK+I DP+Y+EY++K++LP  +QLR DFS YG IEQI
Sbjct: 673 IALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQI 732

Query: 762 NYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKS 821
           NYL D HCCWVNF NISAAI+LVE+        F +    RYDGL+I YGKDRCGNVNK+
Sbjct: 733 NYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIGYGKDRCGNVNKN 792

Query: 822 LMSNKNSRFYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGIGID 881
            ++ KNSRFYKKVK  S N++L ++EE+R+   E L   R+  ++  +  +  + GI ID
Sbjct: 793 FIAGKNSRFYKKVKKPSFNIRLSKMEEERRQHEETLR--RQQENNSEKFLQFGSLGITID 850

Query: 882 TVSNNEED 889
             SN +ED
Sbjct: 851 --SNGKED 856

 Score = 66.2 bits (160), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (85%), Gaps = 1/42 (2%)

Query: 1038 ARVIPGSDVMAQYLAQLQHSTFMYAANILGASAE-DGSYYDE 1078
             + IPGSDVMAQYLAQLQHSTF+YAANILGAS + D +Y DE
Sbjct: 1070 GKSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLDE 1111

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] {ON}
            some similarities with uniprot|Q03735 Saccharomyces
            cerevisiae YML117w
          Length = 1050

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/1071 (39%), Positives = 591/1071 (55%), Gaps = 152/1071 (14%)

Query: 77   NVPPTPFDTAYGATLLPSHLLMGSPFVATPTTGHSQSA---------------------- 114
            NVPPTPFDTAYGA+LLPSHLLMGSP ++T       +A                      
Sbjct: 48   NVPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYNRNNRSFQFRRNSGF 107

Query: 115  IFQQ----PYMMTPNRASFSQIPSMLNVGNPPSARRQGNQNDPN-----RRRSSYRSKVP 165
            + Q     PYM +  R+S SQ P           R + N  D +     +++  ++ + P
Sbjct: 108  VLQSNGNTPYM-SSKRSSLSQAPM-------SQKRAEKNSTDSSVGSHGKKKLQHKKRTP 159

Query: 166  ETDPKTLFLQPFRMSYKILPSGDDAYRTRSLLFENVVNSIE-LHTFMTEFVRFSPIESVY 224
              D     + P  ++Y++LPSGDD Y+TRSLLFENV  + E L  FM   + +S +ESVY
Sbjct: 160  -IDVTKKLISPISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVY 218

Query: 225  LINHHDS---DKPDDDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFV 281
            +    D+   DK  D   C  + LSFL+R+  L FYNN LQRL +FK KL S  L +SFV
Sbjct: 219  VFQQTDTPSKDKESDKDTC-CLQLSFLSRQAALDFYNNFLQRLPDFKKKLSSPKLSVSFV 277

Query: 282  SIKY------------QDXXXXXXTNIVDEPSFYTKESVYFELSNPQATRSILIQFKNPC 329
            S  Y                     NI        + ++  E+ +  ATRSI I+F +  
Sbjct: 278  SFSYVTDEDKDKDKDKDKDINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAIEFYSQV 337

Query: 330  SEQELFDKKLKFLNQENNSRYILESIDLVNVTQTENEFPKHYAILTFINILMAMEICDYL 389
             +  LF+K L FL+ ++N RYILE++D+++     ++FP +Y ILTFINI MA+E+ DYL
Sbjct: 338  EQDALFEK-LPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEVLDYL 396

Query: 390  KIHGPRYGIQDCMFVQVIPKAVSCVSSKRASI------ISKDNDNNDETLSSQQKKNDIL 443
            K +   Y + +C FV +      C S + +S       IS +   +   ++     N ++
Sbjct: 397  KANLMTYSVNECFFVSL----PGCKSQRESSTTPVLGHISTEGSKSVSEVNLANGGNTVM 452

Query: 444  KNSSIISLPSAENDQVXXXXXXXXXXXXXXXTNIEELILIVDTATYPRPSFLSHDEHLPN 503
             +  + SL    +D++                 +EE  L +  + YP+P   SHD+H+P 
Sbjct: 453  IDRELESL----SDELAS-------------LKLEEKCLKIIRSDYPKPEIRSHDDHIPG 495

Query: 504  AT----LSLSSSSNPFEQQLPYSYEEDDDQRTNVRSGSLPANPQFPNMPNLPKGYISPN- 558
            +T           NP      Y ++   D  + +  GS  +N   P++ ++    + PN 
Sbjct: 496  STNFSMYIFDDGMNPEGNSGMYLHDNLTDHSSII--GSPFSNYIDPSISHV----MLPNN 549

Query: 559  --PNMNYNTPLMYPNGYFVNDPAFSMXXXXXXXXXXXXPISKTLEQHATTTSQVVNSLGA 616
              P   ++ P  +P    ++ P F+              I++++E    T++++  ++G 
Sbjct: 550  GLPVGGFDAPGKFPIEP-ISGPPFNHTNKV---------ITQSIEDRLNTSARIAAAMGG 599

Query: 617  DAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSF 676
            DA NRT+YIGNIN RSKVEDICNVVRGGILQNVK+IE K ICF+TFIEASAA  F ANSF
Sbjct: 600  DADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSF 659

Query: 677  IDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEY 736
            IDPIVLH +TL++GWGN   PLPK++ALAVTVGA+RNVYVSLPE+AFKDKFINDP+Y+EY
Sbjct: 660  IDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEY 719

Query: 737  HQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFS 796
            H++YKLP  +QLR DF+ YG IEQINYLKDSHCCWVNF+NI++AIRLVED ++    +F 
Sbjct: 720  HERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFH 779

Query: 797  EKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVKSISNNVKLKELEEKRKADTER 856
            +KFNNRY+GLIINYGKDRCGN+NK+L++ K S+FYKKVK  S ++++K++EEKRK   + 
Sbjct: 780  KKFNNRYEGLIINYGKDRCGNINKNLIAGKGSKFYKKVKKPSYDIRIKKMEEKRKMQEDN 839

Query: 857  LNSLRKTSSSDGQLSKLDAFGIGID-TVSN----------NEEDGNIEKGNTLSKIDTD- 904
            L S +K S       +LD+ GI +D T SN           EE+G +++    +   +D 
Sbjct: 840  LLSQKKNSI------QLDSLGISVDRTFSNESKLSGGHTTTEENGGVKQDLESNDYKSDH 893

Query: 905  --VNGFNALGFKIEPKHDMMNETMDNNTEGNNTLXXXXXXXXXXXXLMISSPKESVQKGD 962
              ++    +G  +  K   + + +  + E  + +                  + +  +GD
Sbjct: 894  PQISSNGPIGIGLSSKKSPIFDDISGSDE--SVISDFENSASKETSSSDRKYQTTNSRGD 951

Query: 963  VITNQKPHSNNHHNFKRNSSSNRQRYKEXXXXXXXXXXXXXXXXXXXXKEFGFGISPNVD 1022
                  P +N  H   R  S+    YK+                         G +P +D
Sbjct: 952  TFV---PKTNLSHAPPRAPSTINMTYKKISYVPPLN-----------------GQAPKMD 991

Query: 1023 EHQKNNKKHNT--NDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAE 1071
              +K  + HN   N +  R IPGSDVMAQYLAQLQHSTFMYAANILGAS E
Sbjct: 992  YPKKYKRTHNNFPNQQPTRPIPGSDVMAQYLAQLQHSTFMYAANILGASVE 1042

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
           (REAL)
          Length = 1131

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/901 (41%), Positives = 518/901 (57%), Gaps = 135/901 (14%)

Query: 75  LPNVPPTPFDTAYGATLLPSHLLMGSPFVATPTT--GHS-------QSAIFQQPY----- 120
           LPN+PPTPFDTAYGA+LLPSHLLMGSPFV++P    G+S       +   + +P      
Sbjct: 60  LPNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNFKRKAYSRPVSNHNN 119

Query: 121 ---------------MMTPNRASFSQIPSMLNVGNPPSARRQGNQNDPNR----RRSSYR 161
                          M+TP+     +  S     N        N+   NR    RR+S R
Sbjct: 120 YNGNNNSNQNNNNNGMVTPSNYYRIERNSFSRNNNSTRNSTHNNKGCDNRNSSGRRTSTR 179

Query: 162 SKVPETDPKTLFLQ-PFRMSYKILPSGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSPI 220
           + + +     L LQ PFR++YKILP+GDDAYRTRSLL ENV  S +LH+ +  FV+ + +
Sbjct: 180 NNIFDDISSELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTL 239

Query: 221 ESVYLINHHDSDK-PDDDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLS 279
           ES Y+I +  SD   D+ T   SIL+SFLTR  CL FYNN+LQRL EFK  LKSE+L L 
Sbjct: 240 ESTYIIGNEKSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLK 299

Query: 280 FVSIKY---------QDXXXXXXTNIVD--EPSFYTKESVYFELSNPQATRSILIQFKNP 328
           FV + Y         +D         +D    S     S++ +L N  ATRSI+++FK+P
Sbjct: 300 FVCLNYDFKCLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSP 359

Query: 329 CSEQELFDKKLKFLNQENNSRYILESIDLVNVTQTENEFPKHYAILTFINILMAMEICDY 388
               ELF+KKL+FL++ NN RYILESID+VN     N+FP++YA+LTF+NI MA+E+ DY
Sbjct: 360 LKSTELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDY 419

Query: 389 LKIHGPRYGIQDCMFVQVIPKAVSCVSSKRASII-------------------------- 422
           LK +  + GI  C +V + P  +S   S  A+I                           
Sbjct: 420 LKKYSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVENNNDNNNSN 479

Query: 423 --------SKDNDNNDETLSSQQKKNDILKNSSIISLPSAENDQVXXXXXXXXXXXXXXX 474
                   +  +++N+ T +S    +++    S+ SLPS+    V               
Sbjct: 480 NHKSNISDANTHNSNNSTRASLYGNSNV----SLASLPSS----VSLNEEIDILTTKLQG 531

Query: 475 TNIEELILIVDTATYPRPSFLSHDEHLPNATLSLS-SSSNPFEQQLPYSYEEDDDQRTNV 533
             ++   L ++   Y  P+   H  HL N  +S +  +S  F   +P             
Sbjct: 532 IQLDGTDLEINYHDYQTPTVHEHSTHLSNVKISKTVENSRQFPHDIP------------- 578

Query: 534 RSGSLPANPQ-FPNMPNLPKGYISPNPNMNYNTPLMYPNGYFVNDPAFSMXXXXXXXXXX 592
               LP N + F N  N   G I P   M   +P+                         
Sbjct: 579 --SPLPLNERMFMNDSNHSNGSIVPQQLMATPSPVS--------------STIQMNQRVL 622

Query: 593 XXPISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYI 652
             PI+++LEQ+   +++V +S+G+D GNRTIYIGNIN RS+ EDICNVVRGGILQ++KY+
Sbjct: 623 PNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYM 682

Query: 653 EHKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASR 712
             K ICF+TFIEA +A+ FYANSFIDPIVLH + L++GWG+Y  PLPK+++LAVT+GASR
Sbjct: 683 PEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASR 742

Query: 713 NVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWV 772
           NVYVSLPEFAFK+KFI+DP+Y++ H+   LP A+QLR DFS YG IEQINYL DSHCCW+
Sbjct: 743 NVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWI 802

Query: 773 NFLNISAAIRLVED------AHN-----PVESKFSEKFNNRYDGLIINYGKDRCGNVNKS 821
           NF+NIS+AI LVE+      AHN       ++   +KF  RY+GL+INYGKDRCGN+NK+
Sbjct: 803 NFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKN 862

Query: 822 LMSNKNSRFYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGIGID 881
           L++ KNSRFYKKVK  S N++L +LEE+R+ +       +K  + D  L+ L++ GI +D
Sbjct: 863 LVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNEND----KKERAFDKALN-LESLGISLD 917

Query: 882 T 882
           +
Sbjct: 918 S 918

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/62 (64%), Positives = 46/62 (74%), Gaps = 1/62 (1%)

Query: 1017 ISPNVDEHQKNNKKHNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYY 1076
            I PN  E   N KK+  +    R IPGSDVMAQYLAQ+QHSTFMYAANILGASAED ++ 
Sbjct: 1071 IVPN-GETTSNRKKNRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHT 1129

Query: 1077 DE 1078
            +E
Sbjct: 1130 EE 1131

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
           RNA-binding protein that associates with mRNAs encoding
           cell wall proteins in high-throughput studies; deletion
           mutants display increased sensitivity to some cell wall
           disrupting agents; expression negatively regulated by
           cAMP
          Length = 1134

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/908 (41%), Positives = 519/908 (57%), Gaps = 124/908 (13%)

Query: 75  LPNVPPTPFDTAYGATLLPSHLLMGSPFVATPT--TGHSQS-------AIFQQPY----- 120
           LPN+PPTPFDTAYGA+L PSHLLMGSPFV++P   +G++ +         + +P      
Sbjct: 60  LPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSARSSNLKRKAYSRPVSNHNG 119

Query: 121 ---------------MMTPN------RASFSQIPSMLNVGNPPSARRQGNQNDPNRRRSS 159
                          M+TP+      R SFS+  +        + +    +N+  RR  +
Sbjct: 120 YNGNSNSNQNNTNNGMVTPSNYYRMGRNSFSRNNNSTRNVTHNNNKGCDTRNNSGRRTFA 179

Query: 160 YRSKVPETDPKTLFLQPFRMSYKILPSGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSP 219
             +   +  P+ L  +PF ++YK+LP+GDDAYRTRSLL ENV +SI+LH+ +  FV+ + 
Sbjct: 180 RNNIFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNT 239

Query: 220 IESVYLINHHDSDKPDD-DTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRL 278
           +ES YLI    SD   D +T+  SIL+SFLT+  CL FYNN+LQRL EFK  LKSE L L
Sbjct: 240 LESAYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNL 299

Query: 279 SFVSIKY-----------QDXXXXXXTNIVDEPSFYTKESVYFELSNPQATRSILIQFKN 327
            FV + Y           +          +   S     S++  ++N  ATRSI+I+FK+
Sbjct: 300 KFVCLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFKS 359

Query: 328 PCSEQELFDKKLKFLNQENNSRYILESIDLVNVTQTENEFPKHYAILTFINILMAMEICD 387
           P  + +LF KKL+FL++  N RYILESIDLVN     N+FP++YA+LTF+NI MA+E+ D
Sbjct: 360 PVEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLD 419

Query: 388 YLKIHGPRYGIQDCMFVQ----VIPKAVSCV--------SSKRASIISKDNDNNDETLSS 435
           YLK +    GI  C +V     V+  A S V        S+ R S+ S    NN+++ ++
Sbjct: 420 YLKKYSKNLGISKCFYVSLAPLVVSSARSSVANIYEGKTSTHRLSVPSVTAGNNNDSNNN 479

Query: 436 QQKKNDILKNSSIISLPSAENDQVXXXXXXXXXXXXXXXTNIEELILI------------ 483
                  +   + ++  S+    V               +  EE+ ++            
Sbjct: 480 GNNNKSNMSGITTLNNNSSIGVSVYGHSNMSLTSLSSSVSLNEEIDMLATKLQGVELDGT 539

Query: 484 ---VDTATYPRPSFLSHDEHLPNATLSLSS-SSNPFEQQLPYSYEEDDDQRTNVRSGSLP 539
              ++   Y  P+   H  HL N  +S ++ +S  F Q +P                 LP
Sbjct: 540 YLEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIP---------------SPLP 584

Query: 540 ANPQ-FPNMPNLPKGYISPNPNMNYNTPLMYPNGYFVNDPAFSMXXXXXXXXXXXXPISK 598
            N   F N  N   G I P   +   +P+          P   M            PI++
Sbjct: 585 LNEHMFMNDSNQSNGAIIPQQLIATPSPV---------SPNLQMNQRVLPN-----PITQ 630

Query: 599 TLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHIC 658
           +LEQ+   +++V +S+G+D GNRTIYIGNIN RSK EDICNVVRGGILQ++KYI  K IC
Sbjct: 631 SLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKIC 690

Query: 659 FITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSL 718
           F+TFIEA +A+ FYANSFIDPIVLH + L++GWG+Y  PLPK ++LAVT+GASRNVYVSL
Sbjct: 691 FVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSL 750

Query: 719 PEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNIS 778
           PEFAFK+KFI+DP+Y++ H+   LP A+QLR DFS YG IEQINYL DSHCCW+NF+NIS
Sbjct: 751 PEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNIS 810

Query: 779 AAIRLVEDAHN-----------PVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKN 827
           +AI LVE+ +             ++    EKF  RY GL+INYGKDRCGN+NK+L++ KN
Sbjct: 811 SAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINKNLIAGKN 870

Query: 828 SRFYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGIGIDTVSNNE 887
           SRFYKKVK  S N++L +LEEKR     R N + +   +  +   L++ GI +D    ++
Sbjct: 871 SRFYKKVKRPSYNIRLSKLEEKR-----RQNEIDEKEKAFDKPLNLESLGISLDA---HK 922

Query: 888 EDGNIEKG 895
           ++G  E G
Sbjct: 923 DNGGGETG 930

 Score = 77.0 bits (188), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/56 (67%), Positives = 42/56 (75%)

Query: 1023 EHQKNNKKHNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYYDE 1078
            E   N KK   +    R IPGSDVMAQYLAQ+QHSTFMYAANILGASAED ++ DE
Sbjct: 1079 ETANNRKKKRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHPDE 1134

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
            Anc_8.844 YML117W
          Length = 1039

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/1027 (38%), Positives = 556/1027 (54%), Gaps = 134/1027 (13%)

Query: 83   FDTAYGATLLPSHLLMGSPFVATPTTGHSQSAIFQQPYMMTPNRA-SFSQIPS-MLNVGN 140
            FD AYG TLLPSH+LM SPFV+TP   +         +  +P+R  S+++  S  +   N
Sbjct: 112  FDYAYGTTLLPSHILMNSPFVSTPNKSYLS-------FQASPSRGISYNRRNSNQMVFPN 164

Query: 141  PP---SARRQGNQNDPNRRRSSYRSKVPETDP----KTLFLQ----PFRMSYKILPSGDD 189
            PP   S    G++++  R +S    KV   D     + +F +     +++SY+ILP GDD
Sbjct: 165  PPIITSPHLVGDKSE--RAKSDNYEKVDTLDDEKRNREVFEEESAIAYKISYQILPKGDD 222

Query: 190  AYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYLINHHDSDKPDDDTECRSILLSFLT 249
             Y TRSLLFEN+  SI+LHTF+ +FV +  IESVY++  +++ +       +SILLSF +
Sbjct: 223  TYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPSYETHQ----NSVKSILLSFTS 278

Query: 250  REVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQDXXXXXXTNIV------DEPSFY 303
            R +CL FYN+VLQ+L E+K +L SENL+LSFVS+ Y           +      +E  F 
Sbjct: 279  RSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNNINKGNGKISVESQKNETDFE 338

Query: 304  TKESVYFELSNPQATRSILIQFKNPCSE-QELFDKKLKFLNQENNSRYILESIDLVNVTQ 362
                + ++++N  ATRS+ I+F     +  +  +  L FL+   N RYI+ES+ +VN   
Sbjct: 339  LTSLIQYQVANFGATRSLCIEFDKRVDKIDDFIETYLPFLSSNANKRYIIESLYIVNNNG 398

Query: 363  TENEFPKHYAILTFINILMAMEICDYLKIHGPRYGIQDCMFVQVIPKAVSCVSSKRASII 422
             +NEFP HY IL+F+NI M +E+  Y++       I++C++V       +  +S R S+ 
Sbjct: 399  KDNEFPAHYVILSFLNISMVIEVLHYIRSKNLSKTIKNCLYVSFDRTKHAVSNSNRQSLS 458

Query: 423  SKDNDN--NDETLSSQQKKNDILKNSSIISLPSAENDQVXXXXXXXXXXXXXXXTNIEEL 480
             K   +  N  TL S    N  +  + I S+      ++                 I+  
Sbjct: 459  KKGTSDTLNTYTLESPINHNTEVDMNDIPSIYDENEIEIANKLSELE---------IQTH 509

Query: 481  ILIVDTATYPRPSFLSHDEHLPNATLSLSSSSNPFEQQLPYSYEEDDDQRTNVRSGSLPA 540
               +D + Y  P      EHLPN ++S                          R   + A
Sbjct: 510  TFNLDISNYSNPHIEIRAEHLPNVSIS--------------------------RDPMIYA 543

Query: 541  NPQFPNMPNLPKGYISPNPNMNYNTPLMYPN---GYFVNDPAFSMXXXXXXXXXXXXPIS 597
            NP + + P+   GY+    NM   TP +  +     + ND                 P+ 
Sbjct: 544  NPIYQSPPS---GYME---NMWTTTPFLSSHIVHEEYAND-RVDYNMKHYNNQLYNVPLP 596

Query: 598  KTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHI 657
            +TL+    T++++ + +G   GNRTI+IGNIN RSK EDICNV RGGI+Q VKYI  K+I
Sbjct: 597  QTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNI 656

Query: 658  CFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVS 717
            CF+ FI+  AA  FYANSFIDPI+LHN+TLKIGWG++  PLPKA+ LAVT GASRNVYVS
Sbjct: 657  CFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVS 716

Query: 718  LPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNI 777
            LPEFAFKDK+INDP Y+EYH KY LP   QLR DFSK+G +EQIN+LKD HCCW+NF NI
Sbjct: 717  LPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNI 776

Query: 778  SAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVKSI 837
             +AI+LVE   N   + F E++ NRY GLII YGKDRCGNVNKSL+SNKNSR+++KVK  
Sbjct: 777  RSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCGNVNKSLVSNKNSRYFRKVKKP 836

Query: 838  SNNVKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGIGIDTVSNNEEDGNIEKGNT 897
            S N++L++LEE+RK + E           D +   LD+ GI   T S N+   NI++  T
Sbjct: 837  SYNIRLQQLEEERKRNDE-------IKQIDNKRINLDSLGI---TTSPNQ---NIQEDET 883

Query: 898  LS----KIDTDVNGFNALGFKIEPKHDMMNETMDNNTEGNNTLXXXXXXXXXXXXLMISS 953
            LS    K+ +D       GFK              N+E  + +            L+I+S
Sbjct: 884  LSLAKLKLTSDT------GFK--------------NSENESDIDDSASNSSTDVELIINS 923

Query: 954  PKESVQKGDVITNQKPHSNNHHNFKRNSSSNRQRYKEXXXXXXXXXXXXXXXXXXXXKEF 1013
            P    +      N+KP  NN    +R                                ++
Sbjct: 924  PGNGFKSH---RNRKPKPNNLDLGER-----------PKVDAIVFKADGPMAPNKLSHDY 969

Query: 1014 GFGISPNVDEHQKNNKKHNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDG 1073
                +  VD  +    +  T+ K   +IPGSDVM+QYLAQ+QHSTFMYAAN+L AS E+ 
Sbjct: 970  HRTHNTRVDNPRSERTRKRTHKK---IIPGSDVMSQYLAQVQHSTFMYAANVLNASIEEP 1026

Query: 1074 SYYDESN 1080
             +YDE++
Sbjct: 1027 EFYDEND 1033

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
           Anc_8.844 YML117W
          Length = 1053

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/855 (41%), Positives = 481/855 (56%), Gaps = 111/855 (12%)

Query: 76  PNVP-----PTPFDTAYGATLLPSHLLMGSPFVATPTTGHSQSAIFQQPYMMTPNRASFS 130
           PN P     PTPFDTAYGATLLPSHLLMGSPFV+TP    +                   
Sbjct: 82  PNSPMTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPNLPQTNY----------------- 124

Query: 131 QIPSMLNVGNPPSARRQGNQNDPNRRRSS---YRSKVPETDPKT---LFLQPFRMSYKIL 184
                       +A+R+G+         S   YR     TDP+    LF  PF +SYKIL
Sbjct: 125 ------------TAQRKGSHTGMANGTGSMNYYR-----TDPQIINGLFQIPFEISYKIL 167

Query: 185 PSGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYLINHHDSDKPDDDTECRSIL 244
           P GDD YRTRSLL  N+ + ++LHTF+++FV+ + +ESVY+       K     E    L
Sbjct: 168 PKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYIT------KEGQQPEKYGFL 221

Query: 245 LSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQDXXXXXXTNIVDEPSFYT 304
           LSFL+ ++CL FYNNVLQRLKEFK +LK+ +L LSFVS++ +            E   Y 
Sbjct: 222 LSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPTKV--------EGKIYR 273

Query: 305 K---------ESVYFELS-NPQATRSILIQFKNP---CSEQELFDKKLKFLNQENNSRYI 351
           +          +++F+++    ATRSI I+F +     +  EL +KKLKFL++ NN RYI
Sbjct: 274 RFAADDGDGMANLHFDMAAQTGATRSIAIEFVDKDVILTRDELLNKKLKFLSEGNN-RYI 332

Query: 352 LESIDLVNVTQTENEFPKHYAILTFINILMAMEICDYLKIHGPRYGIQDCMFVQVI--PK 409
           LE I +         F K+YAI+TF++I MAMEI DYLK++  +  +    +VQV   P+
Sbjct: 333 LEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEIMDYLKLNIKQLHLTKFFYVQVTHPPQ 392

Query: 410 AVSCVSSKRASIISKDNDNNDETLSSQQKKNDILKNSSIISLPSAENDQVXXXXXXXXXX 469
                S K+    + D ++N +T     KK+     ++ +    +               
Sbjct: 393 QSPAASQKKPH--ANDTESNRDTSPPNSKKDQEFFPNNSMLSLVSSESSTSLADDVDGLV 450

Query: 470 XXXXXTNIEELILIVDTATYPRPSFLSHDEHLPNATLSLSSSSNPFEQQLPYSYEEDDDQ 529
                  ++E  L +    YP P F    EH      SL     P  Q  P    +    
Sbjct: 451 NKLKSIELQESTLKLRVEDYPEPLFEQFSEHSNGIVQSL-----PVPQTRPIGGPQSSIS 505

Query: 530 RTNVRSGSLPANPQFP-------------NMPNLPKGYISPNPNMNYNTPLMYPNG--YF 574
            T    G+ P +   P             ++PNLP G+I   P     +  M P     F
Sbjct: 506 -TPRAFGAFPNDIGSPPASFLPLDLNHSNSVPNLPPGFIPATP-----SGPMSPQQQQLF 559

Query: 575 VNDPAFSMXXXXXXXXXXXXPISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKV 634
           +N                  PI+ +LE    T++QV  ++G+D  NRTIYIGNIN RS+ 
Sbjct: 560 LNS---QRQQRDHAGGKFAHPITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRA 616

Query: 635 EDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNY 694
           EDICNVVRGGILQN+K+IE KHICFITFIEASAA+ FYAN+FIDPIVLH +TLK+GWG Y
Sbjct: 617 EDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTY 676

Query: 695 VEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSK 754
             PLPK +ALAVT+GASRNVY+SLPE AFKDK+I DP+++ YH+ +KLP  + LR DF  
Sbjct: 677 TGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLH 736

Query: 755 YGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDR 814
           YG IEQIN L DSHCCWVNF+NIS+AIRLVEDA    +  F++ F++RY+GL+INYGKDR
Sbjct: 737 YGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTK-QDHFNQLFDHRYEGLVINYGKDR 795

Query: 815 CGNVNKSLMSNKNSRFYKKVKSISNNVKLKELEEKRK-ADTERLNSLRKTSSSDGQLSKL 873
           CGN+N++L++ K S+++KKVK  + +V+L +LEEKR+  D ER   +  T   +   +  
Sbjct: 796 CGNINRNLVAGKTSKYHKKVKKHTRDVRLSQLEEKRRNQDAERREMVNGTIPEE---NPF 852

Query: 874 DAFGIGIDTVSNNEE 888
           DAF I   +    +E
Sbjct: 853 DAFAINTGSAEKKDE 867

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 42/61 (68%), Gaps = 1/61 (1%)

Query: 1019 PNVDEHQKNNKKHNTN-DKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYYD 1077
            P+    +  N +H     + AR IPGSDVMAQYLAQLQHSTFMYAAN+LGAS E    YD
Sbjct: 992  PDTGYGKAENGRHRQQLPRNARTIPGSDVMAQYLAQLQHSTFMYAANVLGASNEGTEQYD 1051

Query: 1078 E 1078
            +
Sbjct: 1052 D 1052

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
           {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
           YML117W NAB6 Putative RNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 1259

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/785 (40%), Positives = 462/785 (58%), Gaps = 100/785 (12%)

Query: 157 RSSYRSKVPETDPKTLFLQPFRMSYKILPSGDDAYRTRSLLFENVVNSIELHTFMTEFVR 216
           R+ +R +        +F +PF ++Y++LP GDD YRTRSLLFENV  S++L++F++++ R
Sbjct: 195 RNRHRRRAQNEQADKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSR 254

Query: 217 FSPIESVYLINHHDSDKPDDDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENL 276
           + P+ES+Y+       K  +D    S+LLSFL+R++CL  YN+VLQRL EFK  LKS++L
Sbjct: 255 YGPVESIYMF------KDRNDKTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSL 308

Query: 277 RLSFVSIKYQ----------------------DXXXXXXTNIV------DEPSFYTKESV 308
            +SFVS+KY+                      D      T +       D  +     S+
Sbjct: 309 TVSFVSLKYRKHVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASL 368

Query: 309 YFELSNPQATRSILIQFKNPCSEQELFDKKLKFLNQENNSRYILESIDLVNVTQTENEFP 368
            +++ N  ATRS+ ++      + +L D++L FL+  NN RY+LESI L+N  +    FP
Sbjct: 369 QYDIVNRGATRSVALELDGEYDKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFP 428

Query: 369 KHYAILTFINILMAMEICDYLKIH-GPRYGIQDCMFVQV--------------IPKAVSC 413
           K+YAILTF+NI MA+E+ DY++ +   R   Q C FV V                 +++ 
Sbjct: 429 KNYAILTFLNISMAVEVLDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITP 488

Query: 414 VSSKRASIISKDNDNNDETLSSQQKKNDILKNSSIISLPSAEN----DQVXXXXXXXXXX 469
           V+S  ++ I+ + D    T           KN+S+ SL S  +    DQ           
Sbjct: 489 VASGGSAGIATNGDLGGYTS----------KNASLSSLNSVGSYISLDQEIDFLSSSLKG 538

Query: 470 XXXXXTNIEELILIVDTATYPRPSFLSHDEHLPNATLSLSSS-----SNPFEQQLPYSYE 524
                  ++E         YP+P F    +HL NA++  +S+     S+P  Q++     
Sbjct: 539 SHTITVAVDE---------YPKPFFAEFSDHLSNASVLEASALDTQISSPHPQEVIVP-- 587

Query: 525 EDDDQRTNVRSGSLPANPQFPNM-PNLPKGYISPNPNMNYNTPL-MYPNGYFVNDPAFSM 582
               Q + +  G+ P +   P   P L    +   P+M  N+ + M P G          
Sbjct: 588 ---SQDSPLVGGAPPLDAVHPAATPALSSQVLPLQPHMAMNSGIYMEPFG---------- 634

Query: 583 XXXXXXXXXXXXPISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVR 642
                       PI+++L++   T+++V NS+G   GNRT+YIGNI+ RSK EDICNVVR
Sbjct: 635 ----RRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDICNVVR 690

Query: 643 GGILQNVKYIEHKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAV 702
           GGILQ++++++ KHICF+TFIEAS A+ FY N+FIDPIVLH + LK+GWG++  PLPK+V
Sbjct: 691 GGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSV 750

Query: 703 ALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQIN 762
           +LAVTVGASRNVYVSLP+FAFKDK+INDP+YQ Y  +YKLP  +QLR DF+++G IEQIN
Sbjct: 751 SLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQIN 810

Query: 763 YLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSL 822
           +L D HCCWVNF+NIS+AI+LVE+        F + F+NRY GLII YGKDRCGNVNK+L
Sbjct: 811 FLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNKNL 870

Query: 823 MSNKNSRFYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGIGIDT 882
           +S KNSRFYKKVK  S N++L  +EE+RK   E L S  +  ++D ++ +  + GI ++ 
Sbjct: 871 ISGKNSRFYKKVKKPSYNIRLSRMEEERKKHEETLRS--QNQNNDEKMLQFGSLGIHLEG 928

Query: 883 VSNNE 887
             NN+
Sbjct: 929 NDNNK 933

 Score = 73.2 bits (178), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/66 (57%), Positives = 46/66 (69%), Gaps = 1/66 (1%)

Query: 1014 GFGISPNVDEHQKNNKKHNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAE-D 1072
            G  +S +V   +    K     + A+ IPGSDVMAQYLAQLQHSTFMYAANILGA+AE D
Sbjct: 1190 GDRMSSHVGNSRGQQGKGRNKRRNAKAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGD 1249

Query: 1073 GSYYDE 1078
              YY++
Sbjct: 1250 VDYYED 1255

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (95%)

Query: 83  FDTAYGATLLPSHLLMGSPFVATP 106
           FDTAYG TLLPSHLL+GSPFV++P
Sbjct: 87  FDTAYGITLLPSHLLIGSPFVSSP 110

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  554 bits (1427), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 342/870 (39%), Positives = 488/870 (56%), Gaps = 134/870 (15%)

Query: 75  LPNVPPTPFDTAYGATLLPSHLLMGSPFVATPT--------TGHSQSAIFQQPYMMTPNR 126
           +P  P TPFDT+YG +LLPSHLLM SPF+ATP          G S+S+  Q  Y  TPN 
Sbjct: 45  VPPAPQTPFDTSYGVSLLPSHLLMSSPFLATPGMGSASPHRAGGSRSSHAQSSYH-TPNF 103

Query: 127 ASFS-QIPSMLNVGNPPSARRQGNQNDPNRRRSSYRSKVPETDPKTLFLQPFRMSYKILP 185
            S   ++P       PP+ +R        R  SS + +             + + + ILP
Sbjct: 104 GSTQLRMP-------PPTEKRNFKHGSSYRHNSSVQQRA------------YEVVFHILP 144

Query: 186 ----SGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYLINHHDSDKPDDDTECR 241
                G D Y TRSLLF N+     LH F+T+F +F  +ESVYL+          D++ +
Sbjct: 145 RSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLV----------DSQQQ 194

Query: 242 SILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQDXXXXXXTNIVDEPS 301
           S+L+SFLT+E CL FYN VLQ+L EFK +LKS+ L L+F S++             D  +
Sbjct: 195 SVLVSFLTKETCLDFYNGVLQKLSEFKKELKSKELTLNFASLR-------------DVKT 241

Query: 302 FYTKESVYFELSNPQATRSILIQFKNPCSEQELFDKKLKFLNQENNSRYILESIDLVNVT 361
             T + +  E+    ATRS++++F++   +  L  K L F+  E   RY++E+I++VN  
Sbjct: 242 GPTLQEIKIEVLRAGATRSLILEFQDKV-DLALLSKSLGFIVNEG-PRYVVEAIEIVNAG 299

Query: 362 QTENEFPKHYAILTFINILMAMEICDYLKIHGPRYGIQDCMFVQVIPKAVSCVSSKRASI 421
           ++   F  HYAI+ FI+I MA+E  +YLK                  K    +  +  + 
Sbjct: 300 RSSKHFGPHYAIIHFISIAMALETVEYLKSQSN--------------KLAGLIKFRYVNT 345

Query: 422 ISKDNDNNDETLSSQQKKNDILKNSSIISLPSAENDQVXXXXXXXXXXXXXXXTNIEELI 481
            S    +  +TLSS Q     L N+S   +   E+                  T++ E  
Sbjct: 346 TSASGKSEFQTLSSSQLNERALSNTSDSDISGGES--------VASLGSKLQQTSLGEQT 397

Query: 482 LIVDTATYPRPSFLSHDEHLPNATLS------------LSSSSNPFEQQLPYSYEEDDDQ 529
           L+VD   Y RP      EHLP+ T+S             S++++P  Q++  +  ED   
Sbjct: 398 LVVDPTQYGRPLVEERSEHLPHVTISKALNSKSSLNDLTSNTTSPQPQEVLVNDHEDSSS 457

Query: 530 RTNVRSGSLPANPQFPNMPNLPKGYISPNPNMNYNTPLMYPNGYFVNDPAFSMXXXXXXX 589
           R ++ S    AN   P  P +P                 YP  +++N             
Sbjct: 458 RGSMVSLK-QANSHGPAYPPIPG----------------YP--FYMN------------- 485

Query: 590 XXXXXPISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNV 649
                P+ +TL+Q  TTT+QV  ++G   GNRT+YIGNI+ RSK EDICNVVRGGILQ+V
Sbjct: 486 --MSKPLGQTLQQQYTTTAQVATAMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSV 543

Query: 650 KYIEHKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVG 709
           KYIE KHICF+TFIEA++A+ F+ANS I+PIVLH + LK+GWG++   LP++++LAVT+G
Sbjct: 544 KYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIG 603

Query: 710 ASRNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHC 769
           ASRNVYVSLPE AFKDKFI DPEYQE+ +K++LP  +QL  DFS +G IE +N+L+D HC
Sbjct: 604 ASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHC 663

Query: 770 CWVNFLNISAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSR 829
           CW+NF+NIS AI+LVEDA+NP    F EKF NRY GL I YGKDRCGNVNK+L++NKNS+
Sbjct: 664 CWINFMNISNAIKLVEDANNPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVANKNSK 723

Query: 830 FYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGIGI-DT---VSN 885
           ++KKVK  S N++L+   +++K  ++    ++  +    +  K DAFGI + DT   V +
Sbjct: 724 YFKKVKKASYNIRLR---KQQKGASDAPTEVKDEAKELDKPIKADAFGISVGDTQNLVRD 780

Query: 886 NEEDGNIEKGNTLSKIDTDVNGFNALGFKI 915
           ++E+  +E+   L   D +  G   LG  +
Sbjct: 781 SDEEQKLEEDELLRLSDLNNTG-GGLGISL 809

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%)

Query: 1025 QKNNKKHNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYYDE 1078
            Q + K  +   ++++ IPGSDVMAQYLAQLQHSTFMYAANILG    +  +YDE
Sbjct: 935  QDSKKPLHPRRRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETVFYDE 988

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  525 bits (1353), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 328/871 (37%), Positives = 474/871 (54%), Gaps = 177/871 (20%)

Query: 75  LPNVPPTPFDTAYGATLLPSHLLMGSPFVATPTTGHSQSAIFQQPYMMTPNRASFSQIPS 134
           +P+ P TPFDT+YGATLLPSHLLMGSPF++TP    + + +      +  ++  F     
Sbjct: 63  MPSAPQTPFDTSYGATLLPSHLLMGSPFISTP---QNAAMMHAGSRGLNSSQQQFYHYTY 119

Query: 135 MLNVGNPPSARRQGNQNDPNR--------------------------RRSSYRSKVPETD 168
             N  N  S+++  N  D  +                          +R ++      + 
Sbjct: 120 SNNGKNKGSSKK--NNRDKKKVENGHVMMTRYSYPPPPQLNAPPMTHKRKTHLRHETNSQ 177

Query: 169 PKTLFLQPFRMSYKILPSGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYLI-- 226
           P +   +P+ +++KILP GDD Y TRSLL  NV  SI+LH F+T+FV+F PIESVY++  
Sbjct: 178 PSS---EPYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPE 234

Query: 227 -------------NHHDSDKPDDDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKS 273
                           + ++   + + +SILLSFLT+  CL FYNNVLQ+L +FK  L S
Sbjct: 235 EEEEEEEEEEEEEEEEEEEEEKGEEKKQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNS 294

Query: 274 ENLRLSFVSIKYQDXXXXXXTNIVDEPSFYTKESVYFELSNPQATRSILIQFKNPCSEQE 333
           ++L L+FVS+                    T E +  ++    ATRSI ++FKN  + ++
Sbjct: 295 KSLTLNFVSL--------------------TSEDIRDDVLRKGATRSIALEFKNSFTTKQ 334

Query: 334 LFDKKLKFLNQENNSRYILESIDLVNVTQTENEFPKHYAILTFINILMAMEICDYLKIHG 393
           L  + ++ L+  +NSR+++E ID+VN       F  HYAI+ FI+I MA+E   YL    
Sbjct: 335 L--ESIEILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISISMAVEASSYLLNWD 392

Query: 394 PRYGIQDCMFV--QVIPKAVSCVSSKRASIISKDNDNNDETLSSQQKKNDILKNSSIISL 451
            + GI    FV   +I K+    S+  +   S+ + + D+TL    KK   L        
Sbjct: 393 EKLGISRLFFVTDSIINKSDYFRSAPASQDASRSSVSIDQTLEFATKKLQGLV------- 445

Query: 452 PSAENDQVXXXXXXXXXXXXXXXTNIEELILIVDTATYPRPSFLSHDEHLPNATLSLSS- 510
                                    ++E  L +   TYP+     H  HL + ++S    
Sbjct: 446 -------------------------LKERTLSIKPKTYPQAEIEEHQHHLTSISISKPLL 480

Query: 511 -----------------SSNPFEQQLPYSYEEDDDQRTNVRSGSLPANPQFPNMPNLPKG 553
                            +S+P  Q++ Y ++  +  R +V   S        +M +    
Sbjct: 481 SSNNNSSSVSLQGNQNLTSSPVTQEM-YLHDTSNSTREDVMIQS--------SMASGTSN 531

Query: 554 YISPNPNMNYNTPLMYPNGYFVNDPAFSMXXXXXXXXXXXXPISKTLEQHATTTSQVVNS 613
           ++ P P+            Y+++                  PI +TL+Q  TTT+QV ++
Sbjct: 532 FVPPPPH------------YYMD---------------VTKPIRQTLQQQLTTTAQVASN 564

Query: 614 LGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYA 673
           +G   GNRT+Y+GNIN RSK EDICNVVRGGILQ++K+ EHKH+CF+TFIEA+AA+ F+A
Sbjct: 565 MGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTFIEAAAAVQFFA 624

Query: 674 NSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEY 733
           N+ I+PIVLH + LK+GWG++   L +++ALAVT+GASRNVYVSLPE+AFKDKFI DPE+
Sbjct: 625 NASIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEF 684

Query: 734 QEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVES 793
           QE+ +KY+LP  +QLR DFS +G IEQINYL D HCCWVNF+NI++AI+LVEDA+     
Sbjct: 685 QEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNK 744

Query: 794 KFSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVKSISNNVKLKELEEKRKAD 853
           KF   + +RY GLII YGKDRCGNVNK+L++NK SRF+KKVK  S  +            
Sbjct: 745 KFHGSYQDRYKGLIIGYGKDRCGNVNKNLVANKKSRFFKKVKKASYKI------------ 792

Query: 854 TERLNSLRKTSSSDGQ--LSKL--DAFGIGI 880
             R++   K   S+GQ  +S    +AFGI I
Sbjct: 793 --RMHKQNKAGGSNGQEPISSFQDNAFGICI 821

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 3/54 (5%)

Query: 1031 HNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGAS---AEDGSYYDESNA 1081
            H+   ++++ IPGS VMAQYLAQLQHSTFMYAANILG +    ED + YDE+  
Sbjct: 1024 HHGRHRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDENGG 1077

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
           Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  510 bits (1313), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 317/803 (39%), Positives = 446/803 (55%), Gaps = 125/803 (15%)

Query: 98  MGSPFVATPTTGHSQSAIFQQPYMMTPNRASFSQIPSMLNVGNPPSARRQGNQNDPNRRR 157
           M SPF+ATP  GHS       P+    N++S +   + L +  PPS   +G++   N+ +
Sbjct: 1   MSSPFLATPGVGHSS------PHRHVTNKSSQAYKSTQLRM--PPSDAIRGSRRH-NKEK 51

Query: 158 SSYRSKVPETDPKTLFLQPFRMSYKILP---SGD-DAYRTRSLLFENVVNSIELHTFMTE 213
             Y     +         P+++++ ILP   +GD D +RTRSL F N+   + LH F+  
Sbjct: 52  HLYDEGTRQI--------PYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLAT 103

Query: 214 FVRFSPIESVYLINHHDSDKPDDDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKS 273
           F +F  IESVY++          D E +S+L+SFLT+E CL FYN +LQ+L EFK +L+S
Sbjct: 104 FHKFDRIESVYVV----------DREQQSVLVSFLTKETCLDFYNGILQKLSEFKKELRS 153

Query: 274 ENLRLSFVSIKYQDXXXXXXTNIVDEPSFYTKESVYFELSNPQATRSILIQFKNPCSEQE 333
           + L LSF S +           +   P   T + + FE+    ATRS+ ++FK+      
Sbjct: 154 KELSLSFASPQ----------KVESGP---TLQEIKFEVLRAGATRSLGLEFKDEIDFAS 200

Query: 334 LFDKKLKFLNQENNSRYILESIDLVNVTQTENEFPKHYAILTFINILMAMEICDYLKIHG 393
           L  KK  F +  +  RY++ESI+ VN  +    F  +YAI+ FI+I MA+E  +YLK+  
Sbjct: 201 LL-KKFDFFDN-SGPRYVIESIETVNTDKPSKYFGSNYAIVHFISIAMAVETMEYLKVQT 258

Query: 394 PR-YGIQDCMFVQVIPKAVSCVSSKRASIISKDNDNNDETLSSQQKKNDILKNSSIISLP 452
           P  +G+            VS V+S   S  S+    ++  LS Q   ND+    SI S  
Sbjct: 259 PESFGLTK----------VSYVNSTFTSGKSEFQTFSNSELSDQ---NDVEVQDSISSF- 304

Query: 453 SAENDQVXXXXXXXXXXXXXXXTNIE-ELILIVDTATYPRPSFLSHDEHLPNATLSL--- 508
                                  ++E E    V  + Y  P    H++H  + T+S    
Sbjct: 305 -------------EDITLSEGSMSVENEKAFTVLPSQYGPPVVEEHNQHCSHITISKALS 351

Query: 509 ---------SSSSNPFEQQLPYSYEEDDDQRTNVRSGSLPANPQFPNMPNLPKGYISPNP 559
                    SS ++P  Q++  S  E    R ++ S  L A  Q P  P           
Sbjct: 352 SKVSRNGSSSSIASPQPQEVLVSNSEAPSSRNSIVS-LLSARSQGPTYP----------- 399

Query: 560 NMNYNTPLMYPNGYFVNDPAFSMXXXXXXXXXXXXPISKTLEQHATTTSQVVNSLGADAG 619
                     P  ++  D                 P+ +TL+Q  T T+QV  ++G  AG
Sbjct: 400 ---------VPGYHYYMD--------------MSKPLGQTLQQQYTATAQVATAMGGGAG 436

Query: 620 NRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFIDP 679
           NRT+YIGNI+ RSK EDICNVVRGGILQ+VKYIE KHICF+TFIEA++A+ F+ANS I+P
Sbjct: 437 NRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEP 496

Query: 680 IVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQK 739
           IVLH   LK+GWG++   LP++++LAVT+GASRNVYVSLPE+AFKDKFI DPEYQ + +K
Sbjct: 497 IVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREK 556

Query: 740 YKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEKF 799
           +KLP   QL  DFS +G IE IN+L+D HCCW+NF+NIS AI+LVEDA+N     F EKF
Sbjct: 557 FKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEKF 616

Query: 800 NNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVKSISNNVKLKELEEKRKADTERLNS 859
            NRY GL I YGKDRCGNVNK+L+SNKNS+++KKVK  S N++L+    ++K+D E    
Sbjct: 617 ENRYRGLFIGYGKDRCGNVNKNLVSNKNSKYFKKVKKASYNIRLR---RQQKSDIEAQAK 673

Query: 860 LRKTSSSDGQLSKLDAFGIGIDT 882
             K   +  +  ++DAFGI + +
Sbjct: 674 SGKGDENSEKKLQVDAFGISVGS 696

 Score = 62.0 bits (149), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 35/52 (67%)

Query: 1016 GISPNVDEHQKNNKKHNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILG 1067
            G   ++       K   +  + A+ IPGS+VMAQYLAQLQHSTFMYAA+ILG
Sbjct: 853  GSKSDIGSKSTQGKSSKSRQRNAQAIPGSNVMAQYLAQLQHSTFMYAADILG 904

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
           similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  493 bits (1268), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 327/842 (38%), Positives = 453/842 (53%), Gaps = 152/842 (18%)

Query: 75  LPNVPPTPFDTAYGATLLPSHLLMGSPFVATPT--TGHSQSAIFQQPYMMTPNRASFS-Q 131
           +P VP TPFD  YGA+LLPSH+LMGSPFV+TP    GH             P+ +S S  
Sbjct: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQGH-----------FHPSASSHSNH 127

Query: 132 IPSMLNVGNPPSARRQGNQNDPNRRRSSYRSKVPETDPKTLFLQPFRMSYKILPSGDDAY 191
             S L    PP  +       P RRR S+     E         P+++++KILP G D Y
Sbjct: 128 SRSFLYYPQPPILKPI-----PPRRRKSFSLNHSE---------PYQVNFKILPKGKDEY 173

Query: 192 RTRSLLFENV--VNSIELHTFMTEFVRFSPIESVYLINHHDSDKPDDDTECRSILLSFLT 249
            TRSLLF N+    + ++H F+T F++F PIES+YL+         DD+   SILLSFLT
Sbjct: 174 MTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLL---------DDSH--SILLSFLT 222

Query: 250 REVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQDXXXXXXTNIVDEPSFYTKESVY 309
           +  CL FYNN+LQR  EFK+KL S  L +SFV     +       N+V            
Sbjct: 223 KATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVCQDETNWFRLLQMNVVTR---------- 272

Query: 310 FELSNPQATRSILIQFKNPCSE--QELFDKKLKFLNQENNSRYILESIDLVNVTQTENE- 366
                   TRS+ I+F++   E   +L  +K+ +L   +  R+++E IDLVN    +N+ 
Sbjct: 273 ------GVTRSLCIEFEDQSMELTSDLIHEKIPWLFFSH--RFVIERIDLVNAAAPKNQN 324

Query: 367 FPKHYAILTFINILMAMEICDYLK--IHGPRYGIQDCMFVQVIPKAVSCVSSKRASIISK 424
           F   Y ++ FI I MA+E+ +YL+      + GI    FV V         +  +S +S 
Sbjct: 325 FNNRYLLIHFICISMALEVEEYLQQASQKKQLGISKIQFVNV---------NGHSSDLS- 374

Query: 425 DNDNNDETLSSQQKKNDILKNSSIISLPSAENDQVXXXXXXXXXXXXXXXTNIEELILIV 484
             D +    ++  ++     + S ISLP + +  +                 +  + L V
Sbjct: 375 --DEDAVAAANGLQRESRTSSVSSISLPISNSSDLVELFHSLDLA-------LGIISLQV 425

Query: 485 DTATYPRPSFLSHDEHLPNATLS-----LSSSSNPFEQQLPYSYEEDDDQRTNVRSGSLP 539
             + YP P   SHD+HL + T+S     L+SS++  E  +           +N   G L 
Sbjct: 426 IPSEYPVPLIESHDDHLHSVTISRPSKTLTSSTSLVE--MDGGPNGGTPNGSNAMQGVL- 482

Query: 540 ANPQFPNMPNLPKGYISPNPNMNYNTPLMYPNGYFVN----------------------- 576
                          +  +P+ + NTP M PN   +N                       
Sbjct: 483 ---------------LLSDPSSDGNTPSMLPNELNINTSLMPGPMGGQVLGTSQSLSLHN 527

Query: 577 -------DPAFSMXXXXXXXXXXXXPISKTLE-QHATTTSQVVNSLGADAGNRTIYIGNI 628
                   P++ M            PI++ L+ Q+ T T QV       + NRT+YIGNI
Sbjct: 528 PNDNGGAGPSYFMDPMSGA------PINQALQRQYLTGTGQV-----GGSNNRTVYIGNI 576

Query: 629 NSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFIDPIVLHNHTLK 688
           + RSK EDICNVVRGGILQN+K+I  K ICF+TFIEA+AAI FYAN+ ++PIVLH + L+
Sbjct: 577 HPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILR 636

Query: 689 IGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQL 748
           +GWG     LPK +ALAVT+GASRNVYVSLPE++FK+K+IN+PE++EYH KYKLP  +QL
Sbjct: 637 VGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQL 696

Query: 749 RIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVE---SKFSEKFNNRYDG 805
           R DF+KYG +EQINYL D HCCWVNF+NI+ AIRLVED ++  +    KF  +F+ RY  
Sbjct: 697 RQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKN 756

Query: 806 LIINYGKDRCGNVNKSLMSNKNSRFYKKVKSISNNVKL-KELEEKRKADTERLNSLRKTS 864
           LII YGKDRCGNVNK+L +NKNSRF+KK+K ++   K  K  + KR   +   +  RK  
Sbjct: 757 LIIGYGKDRCGNVNKNLTANKNSRFFKKIKKLNCTTKPNKRQQSKRGTSSASSDDARKDD 816

Query: 865 SS 866
           +S
Sbjct: 817 AS 818

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%)

Query: 1036 KEARVIPGSDVMAQYLAQLQHSTFMYAANILGASA 1070
            K ++ I G DVM+QYL QL HSTF+Y+ NILGA+ 
Sbjct: 1018 KFSKPIAGQDVMSQYLEQLHHSTFLYSTNILGATT 1052

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  424 bits (1090), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 314/948 (33%), Positives = 453/948 (47%), Gaps = 170/948 (17%)

Query: 78  VPPTPFDTAYGATLLPSHLLMGSPFVATPTTGHSQSA--------IFQQPYMMTPNRASF 129
           +P TPFD  YG TLLPSHLL+GSPFV TP TG   SA        +     M   N +  
Sbjct: 68  IPQTPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGANGVPVGSNNIMNLRNSSYK 127

Query: 130 SQIPSMLNVGNPPS-----ARRQGNQNDPNRRRSSYRSKV-PETDPKTLFLQ-------- 175
           S  P    +   PS     ARR+ N+    R  S   +KV  E D +  +          
Sbjct: 128 SFYPPAPKLRPAPSGRLRRARRKDNKPQQQREHSRDNNKVEAEYDVERGYSSRSASRSQS 187

Query: 176 --------------------------PFRMSYKILPSGDDAYRTRSLLFENVVNSIELHT 209
                                       +  Y ILP G+D YR+RSLLF NV + +++  
Sbjct: 188 FSASTSGSMSGSSGPKSIRKTIDSELKIQFQYSILPKGNDTYRSRSLLFTNVNSELDIVE 247

Query: 210 FMTEFVRFSPIESVYLINHHDS-------------DKP----------------DDDTE- 239
           F+ +  +  PIES+YLI   D+             D P                D D E 
Sbjct: 248 FLQKVAKNYPIESIYLIKDEDTGDDIENLNTSNNDDDPNQNYNADNNNNSKREDDKDKES 307

Query: 240 --------------C--RSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSI 283
                         C  +S LLSF T+E CL FYNN+LQR  E K  +KS+ L ++FV I
Sbjct: 308 APALTKQIAISPSSCSQQSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKI 367

Query: 284 KYQDXXXXXXTNIVDEPSFYTKESVYFELSNPQATRSILIQFKNPCSEQELFDKKLKFLN 343
             QD          DE      +     L    ATRS+ ++F +     +     L FL 
Sbjct: 368 --QD----------DEEWMANLKMNVISLG---ATRSLYVEFADDSVTSDTIWDTLPFL- 411

Query: 344 QENNSRYILESIDLVNVTQTENEFPKHYAILTFINILMAMEICDYLKIHGPRYGIQDCMF 403
            +N+ +Y++  +D+V   +    F  HY +L F+++ MA+E+ + L+       +    F
Sbjct: 412 -KNSGKYVVIDVDVVTTDERRKNFGLHYCLLHFLSVTMALEVKELLETGDE--AVSRVSF 468

Query: 404 VQVIPKAVSCVSSKRASIISKDNDNNDETLSSQQKKNDILKNSSIISLPSAENDQVXXXX 463
           V     A   +  +R+S IS   + + +  S+  +      N   +SLP +E  QV    
Sbjct: 469 VTPANSADKEMRRRRSSAISLKQEASPQMFSTDSRSRSRSSN---VSLPLSE--QVSTAS 523

Query: 464 XXXXXXXXXX-XTNIEELILIVDTATYPRPSFLSHDEHLPNATLSLSSSSNPFEQQLPYS 522
                        N+    LIVD + Y  P     D HL + ++S            P +
Sbjct: 524 TDISTPIYEEFDGNLTWSTLIVDVSEYKEPIVNEFDHHLNSWSISK-----------PTT 572

Query: 523 YEEDDDQRTNVRSGSLPANPQFPNMPNLPKGYISPNPNMNYNTPLMYPNGYFVNDPAFSM 582
               +   TN  S +L  +         P    S +P          P    +N+  + M
Sbjct: 573 LYMHESGTTNFSSSNLSDDID-------PLSISSHDP---------VPQQMLLNEYPYIM 616

Query: 583 XXXXXXXXXXXXPISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVR 642
                        I++T++   + + Q VN   A   +RT+YIGNIN RSK EDICNVVR
Sbjct: 617 EPLMPPQ------ITQTIQNQYSKSIQAVN---AGMEHRTVYIGNINPRSKAEDICNVVR 667

Query: 643 GGILQNVKYIEHKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAV 702
           GGILQ++K++ HK ICF+TFIE +AA+ FYAN+ ++PI+LH + LK+GWG    PLPK +
Sbjct: 668 GGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNI 727

Query: 703 ALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQIN 762
           ALAVTVGASRNVYVSLP+ AFKDKFINDP+++EY  +YK+P   QL+ DF  YG +EQ+N
Sbjct: 728 ALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVN 787

Query: 763 YLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSL 822
           +  D HCCW+NF+NIS+AI+LVE+  +  ++ F +K   RY GLII YGKDRCGN+N++L
Sbjct: 788 FHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRCGNINRNL 847

Query: 823 MSNKNSRFYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDA--FGIGI 880
           + NKN +                    +  +T R +  RK S++    S +D     +  
Sbjct: 848 VFNKNGK------------GSNHNRNSQNNNTSRGHRQRKQSATFSNASNIDLKHSSVAN 895

Query: 881 DTVSNNEEDGNIEKGNTLSKIDTDVNGFNALGFKIEPKHDMMNETMDN 928
            +++N + D  ++  N LS +  D +    LG  I P+ +  +   DN
Sbjct: 896 ASIANGKLDRPMDNKNFLS-LGVDADFSEGLGISISPQAERRHVLSDN 942

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 40/61 (65%), Gaps = 2/61 (3%)

Query: 1021 VDEHQKNNKKHNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYYDESN 1080
            V +H+  N   N      + I GSDVM +YL QL H+TF+YAANILGA+ +D  +YDE N
Sbjct: 1093 VAQHEGANNG-NPRKSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGAT-QDPVFYDEDN 1150

Query: 1081 A 1081
            A
Sbjct: 1151 A 1151

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
           (REAL)
          Length = 1122

 Score =  387 bits (995), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 212/441 (48%), Positives = 280/441 (63%), Gaps = 60/441 (13%)

Query: 476 NIEELILIVDTATYPRPSFLSHDEHLPNATLSLS-SSSNPFEQQLP-------YSYEEDD 527
           +++  IL V    YP P    H  HL N  +S +  +S  F Q +P       + +  D 
Sbjct: 526 DLDGTILEVTCHDYPTPVINEHSAHLSNIKISKTVDNSRQFTQDIPSPLPLNEHMFMTDS 585

Query: 528 DQRTNVRSGSLPANPQFPNMPNLPKGYISPNPNMNYNTPLMYPNGYFVNDPAFSMXXXXX 587
           +Q     S     + Q    P+ P+   SPNP MN     + PN                
Sbjct: 586 NQ-----SNGTIVSQQLITAPS-PQ---SPNPQMNQR---VLPN---------------- 617

Query: 588 XXXXXXXPISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQ 647
                  PI+++LEQ+   +++V +S+G+D GNRTIYIGNIN RS+ EDICNVVRGGILQ
Sbjct: 618 -------PITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQ 670

Query: 648 NVKYIEHKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVT 707
           N+KYI  K ICF+TFIEA++A+ FYANSFIDPIVLH + L++GWG+Y  PLPK+++LAVT
Sbjct: 671 NIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVT 730

Query: 708 VGASRNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDS 767
           +GASRNVYVSLPEFAFK+KFI+DP+Y++ H+   LP A+QLR DFS YG IEQINYL DS
Sbjct: 731 IGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDS 790

Query: 768 HCCWVNFLNISAAIRLVED------AHNPV-----ESKFSEKFNNRYDGLIINYGKDRCG 816
           HCCW+NF+NIS+AI LVE+       H+       ++   EKF+ RY GL+INYGKDRCG
Sbjct: 791 HCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCG 850

Query: 817 NVNKSLMSNKNSRFYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAF 876
           N+NK+L++ KNSRFYKKVK  S N++L +LEE+R     R N   K  S D  L+ L++ 
Sbjct: 851 NINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERR-----RQNENDKKESFDKVLN-LESL 904

Query: 877 GIGIDTVSNNEEDGNIEKGNT 897
           GI +D     + D    +G T
Sbjct: 905 GISLDPHKGTDIDEAEAEGTT 925

 Score =  286 bits (732), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 164/385 (42%), Positives = 228/385 (59%), Gaps = 53/385 (13%)

Query: 75  LPNVPPTPFDTAYGATLLPSHLLMGSPFVATPTT------GHSQS---AIFQQPY----- 120
           LPNVPPTPFDTAYGA+LLPSHLLMGSPFV++P        G S       + +P      
Sbjct: 60  LPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAYSRPISSQNS 119

Query: 121 -----------------MMTPN------RASFSQIPSMLNVGNPPSARRQG--NQNDPNR 155
                            MMTP+      R  FS+  +  N  N      +G   +N   R
Sbjct: 120 YNANHNNNNNNSNSNNGMMTPSSYYRNGRTLFSRKDN--NAVNVTHNIHKGYETRNSSGR 177

Query: 156 RRSSYRSKVPETDPKTLFLQPFRMSYKILPSGDDAYRTRSLLFENVVNSIELHTFMTEFV 215
           R SS  +   E DP+TL  +PFR++YKILP+GDDAYRTRSLL ENV +S +LH+ +  FV
Sbjct: 178 RTSSRINIFDEIDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFV 237

Query: 216 RFSPIESVYLINHHDSDKPD-DDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSE 274
           + + +ES Y++   ++D  + ++T+  SIL+SFLTR  CL FYNN+LQRL EFK  LKS+
Sbjct: 238 KSNALESAYIVGSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSK 297

Query: 275 NLRLSFVSIKY-----------QDXXXXXXTNIVDEPSFYTKESVYFELSNPQATRSILI 323
           +L L FV + Y           ++          D+ S     S++ ++ N  ATRSI+I
Sbjct: 298 SLNLKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIII 357

Query: 324 QFKNPCSEQELFDKKLKFLNQENNSRYILESIDLVNVTQTENEFPKHYAILTFINILMAM 383
           +FK+P  + ELF +KL+FL++  N RYILESID+V+     N+FP++Y +LTF+NI MA+
Sbjct: 358 EFKSPLEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAI 417

Query: 384 EICDYLKIHGPRYGIQDCMFVQVIP 408
           E+ DYLK +  + GI  C +V + P
Sbjct: 418 EVLDYLKKYSKKLGISKCFYVSLTP 442

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/40 (87%), Positives = 37/40 (92%)

Query: 1039 RVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYYDE 1078
            R IPGSDVMAQYLAQ+QHSTFMYAANILGASAED +Y DE
Sbjct: 1083 RTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSDE 1122

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,
           1032 aa] {ON} (7832..9475,9855..9863,10320..11765) [3099
           nt, 1033 aa]
          Length = 1032

 Score =  378 bits (970), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 173/286 (60%), Positives = 226/286 (79%), Gaps = 9/286 (3%)

Query: 605 TTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIE 664
            T++++ N++G  AGNRT+YIGNIN RSK EDICNVVRGG LQ +K+ + K ICF+TFIE
Sbjct: 565 ATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIE 624

Query: 665 ASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFK 724
           A++A  FYANSFIDPI+LHN+TL++GWG++  PLPK+++LAVTVGASRNVYVSLPE+AFK
Sbjct: 625 AASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFK 684

Query: 725 DKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLV 784
           DKFINDPEY+EYH KY LP  ++LR DFS +G +EQ+N+L D HCCW+NF+NI +AI+LV
Sbjct: 685 DKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLV 744

Query: 785 EDAHNPVESK-FSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVKSISNNVKL 843
           E  ++    K F E++ NRY GLII YGKDRCGNVNKSL+S KNS+FY+KVK  S N++L
Sbjct: 745 ESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRL 804

Query: 844 KELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGIGIDTVSNNEED 889
           ++LEE+RK   E  N +   S +      L++FGI ++T S NE +
Sbjct: 805 QQLEEERKQ--EEKNKISNKSIN------LNSFGIQVETPSQNESE 842

 Score =  248 bits (632), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 156/412 (37%), Positives = 228/412 (55%), Gaps = 68/412 (16%)

Query: 75  LPNVPPTPFDTAYGATLLPSHLLMGSPFVATPTTGHSQSAIFQQPYMMTPNRAS------ 128
           +PN PPTPFD+AYGA+LLPSHLLMGSPFV+TPT G S S  F +P   +P++        
Sbjct: 118 IPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARP---SPSKGGNSMGRL 174

Query: 129 FSQIPSMLNVGNPPSAR-------------------------RQGNQNDPNRRRSSYRSK 163
            S  P+   +  PPS+R                         R+GN N  +R  ++   +
Sbjct: 175 SSAYPAPPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNS-HRNTNNNGGR 233

Query: 164 VPETDPKTLF----LQPFRMSYKILPSGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSP 219
             + +    F    L  F +SYK+LP G+D Y+TRSLLFENV  S++LH F+ +FV F P
Sbjct: 234 FTQKNIIKRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGP 293

Query: 220 IESVYLINHHD--------------------SDKPDDDTECRSILLSFLTREVCLTFYNN 259
           IESVYLIN +                     +D   ++ + +SILLSFL+R +CL FYN+
Sbjct: 294 IESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNS 353

Query: 260 VLQRLKEFKAKLKSENLRLSFVSIKYQDXXXXXXTNIVDEPSFYTKE---SVYFELSNPQ 316
           VLQRL EFK +L S +L LSFV +KY++          DE S ++     S+ +++    
Sbjct: 354 VLQRLSEFKTQLNSNDLTLSFVLLKYKNQDRPD-----DEESDFSPALPLSLEYDIIKRG 408

Query: 317 ATRSILIQFKNPCSEQELF-DKKLKFLNQENNSRYILESIDLVNVTQTENEFPKHYAILT 375
           ATRSI ++F  P + +E F + KL FL    N RYI+ES+D++N  + +   PK+  ILT
Sbjct: 409 ATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILT 468

Query: 376 FINILMAMEICDYLKIHGPRYGIQDCMFVQVIPKAVSCVSSKRASIISKDND 427
           F+NI M +++ D +++     GI  C+FV    +  +  + KR S++   +D
Sbjct: 469 FLNISMTVDVMDRIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDITSD 520

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 43/53 (81%)

Query: 1026 KNNKKHNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYYDE 1078
            KN     ++ K  +++PGSDVM+QYLAQLQHSTFMYAANILGAS+++  +YDE
Sbjct: 972  KNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPEFYDE 1024

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
           (REAL)
          Length = 1128

 Score =  374 bits (960), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 179/297 (60%), Positives = 231/297 (77%), Gaps = 17/297 (5%)

Query: 596 ISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHK 655
           I+++LEQ+   +++V +S+G+D GNRTIYIGNIN RS+ EDICNVVRGGILQ++KYI  K
Sbjct: 625 ITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEK 684

Query: 656 HICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVY 715
            I F+TFIEA +A+ FYANSFIDPIVLH + L++GWG+Y  PLPK+++LAVT+GASRNVY
Sbjct: 685 RISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVY 744

Query: 716 VSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFL 775
           VSLPEFAFK+KFI+DP+Y++ H+   LP A+QLR DFS YG IEQINYL DSHCCW+NF+
Sbjct: 745 VSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFM 804

Query: 776 NISAAIRLVED------AHNP-----VESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMS 824
           NIS+AI LVE+      AH+      V++   EKF+ RY GL+INYGKDRCGN+NK+L++
Sbjct: 805 NISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINKNLVA 864

Query: 825 NKNSRFYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGIGID 881
            KNSRFYKKVK  S N++L +LEE+R     R N   K  S D  L+ L++ GI +D
Sbjct: 865 GKNSRFYKKVKRPSYNIRLSKLEERR-----RQNENDKKESFDKVLN-LESLGISLD 915

 Score = 75.9 bits (185), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (92%)

Query: 1039 RVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYYDE 1078
            R IPGSDVMAQYLAQ+QHSTFMYAANILGASAED +Y +E
Sbjct: 1089 RTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSEE 1128

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 29/32 (90%), Positives = 32/32 (100%)

Query: 75  LPNVPPTPFDTAYGATLLPSHLLMGSPFVATP 106
           LPNVPPTPFDTAYGA+LLPSHLLMGSPFV++P
Sbjct: 60  LPNVPPTPFDTAYGASLLPSHLLMGSPFVSSP 91

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  367 bits (941), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 169/293 (57%), Positives = 229/293 (78%), Gaps = 8/293 (2%)

Query: 596  ISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHK 655
            +++TLE H  T++++   LG   GNRT+YIGNIN RSK ED+CNVVRGGILQ + ++  K
Sbjct: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860

Query: 656  HICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVY 715
            HICF+TFIEA+ A  F+AN++IDPIVLH + LK+GWGN+  PLPK+++LAVT+GA+RNVY
Sbjct: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920

Query: 716  VSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFL 775
            VSLPEFAFKDKFIN+P+Y++YH+ YKLP   QLR DFS+YG IEQINYL D HCCW+NF+
Sbjct: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980

Query: 776  NISAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVK 835
            NI++AI LVE+ +     +F  KF+ RY+GLII YGKDRCGNVNK+L++ KNS+F+KKVK
Sbjct: 981  NINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVATKNSKFFKKVK 1040

Query: 836  SISNNVKLKELEEKRKADTERLNSLRKTS--SSDGQLSK----LDAFGIGIDT 882
              +  +KLK++EE+R+   E  N+LR  +  S++ Q+ K    L++ GI  ++
Sbjct: 1041 KPAYQIKLKKIEEERRLQEE--NNLRNNNKLSNNSQIRKPAVNLESLGITFES 1091

 Score =  123 bits (308), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/119 (53%), Positives = 81/119 (68%), Gaps = 6/119 (5%)

Query: 168 DPKTLFLQPFRMSYKILPSGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYLIN 227
           D   L   P  +SYKILP G D +RTRSLL EN+  SI+  T +  F+ F PIESVYLI 
Sbjct: 252 DINKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLI- 310

Query: 228 HHDSDKPDDDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQ 286
                K +  ++  SILLSF++RE+CL FYNNVLQRL EFK +L S++L LSFV +KY+
Sbjct: 311 -----KLNPGSKYNSILLSFVSREICLDFYNNVLQRLMEFKTELSSKSLTLSFVILKYE 364

 Score = 68.6 bits (166), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%)

Query: 1029 KKHNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAED 1072
            +  N N    + IPGSDVM+QYL QLQHSTFMYAANILG SAED
Sbjct: 1306 RNKNKNRNTRKTIPGSDVMSQYLTQLQHSTFMYAANILGVSAED 1349

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 40/62 (64%), Gaps = 12/62 (19%)

Query: 75  LPNVPPTPFDTAYGATLLPSHLLMGSPFVATPTTGHSQSAIFQQPYMM-----TPNRASF 129
           +P+ PPTPFD +YGATLLPSHLLMGSPFV+TP        I   PY       TP R SF
Sbjct: 101 IPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPN-------IHSFPYSATSISSTPTRKSF 153

Query: 130 SQ 131
           S+
Sbjct: 154 SR 155

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  340 bits (871), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 156/262 (59%), Positives = 202/262 (77%), Gaps = 9/262 (3%)

Query: 595 PISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEH 654
           PI +TL++     +   N +     NRT+YIGNI+ RSK EDICNVVRGGILQ +K+I  
Sbjct: 534 PIGQTLQRQYLAGASQANGIN----NRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISS 589

Query: 655 KHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNV 714
           K ICF+TFIE +AA+ FYAN+ ++PIVLH + L++GWG     LPK +ALAVT+GASRNV
Sbjct: 590 KRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNV 649

Query: 715 YVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNF 774
           YVSLPE++FK+K+IN+PE++ YH KYKLP  +QLR DF+KYG +EQINYL+D HCCWVNF
Sbjct: 650 YVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNF 709

Query: 775 LNISAAIRLVEDAHNPVE---SKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFY 831
           +NI+ AIRLVED+++P+E    KF  +F+ RY  LII YGKDRCGNVNK+L +NKNSRFY
Sbjct: 710 MNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSRFY 769

Query: 832 KKVKSISNNVKLKELEEKRKAD 853
           KK+K  S    +K+ ++ RK D
Sbjct: 770 KKIKKQS--YSMKQGKQPRKED 789

 Score =  188 bits (478), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 131/366 (35%), Positives = 182/366 (49%), Gaps = 74/366 (20%)

Query: 38  PSYGP-LGPGTNSMLFYQGEQARXXXXXXXXXXXXXXXLPNVPPTPFDTAYGATLLPSHL 96
           P+ GP  GPG  +  F   E                  +P VP TPFD  YGA+LLPSH+
Sbjct: 28  PAQGPGTGPGQPARFFPGAE----------GMSLAAGSMPPVPQTPFDPTYGASLLPSHM 77

Query: 97  LMGSPFVATP----------TTGHSQSAIFQQPYMMTPNRASFSQIPSMLNVGNPPSARR 146
           LMGSPF++TP          T GHS  ++    +     R+SF   P       PP  + 
Sbjct: 78  LMGSPFLSTPLRPQAHFHPSTPGHSSHSL----HHAQSARSSFLYYP------QPPMLKP 127

Query: 147 QGNQNDPNRRRSSYRSKVPETDPKTLFLQPFRMSYKILPSGDDAYRTRSLLFENV--VNS 204
                 P RR+ S      E         P+ +++KILP G D Y TRSLL  N+  +  
Sbjct: 128 -----IPPRRKKSVTLNHSE---------PYHINFKILPKGKDEYMTRSLLLTNLEMLRD 173

Query: 205 IELHTFMTEFVRFSPIESVYLINHHDSDKPDDDTECRSILLSFLTREVCLTFYNNVLQRL 264
           +++H F+  FV+F P+ES+YL+        DD+    SILLSFLT+  CL FYNN+LQR 
Sbjct: 174 LDIHNFLNSFVKFGPVESIYLM--------DDN---HSILLSFLTKATCLDFYNNLLQRF 222

Query: 265 KEFKAKLKSENLRLSFVSIKYQDXXXXXXTNIVDEPSFYTKESVYFELSNPQATRSILIQ 324
            EFK KL S  L +SFV                DE S++  + +   +    ATRS+ ++
Sbjct: 223 SEFKTKLHSPKLSVSFV--------------CQDESSWF--KYLQMNVVTRGATRSLTVE 266

Query: 325 FKNPCSEQELFDKKLKFLNQENNSRYILESIDLVNVTQTENEFPKHYAILTFINILMAME 384
           F++   E      +LKF     + R++LE IDL+N T     F   Y IL FI+I MA+E
Sbjct: 267 FEDSVKELNEDFVRLKFPWLFCSQRFVLERIDLINATTVNQHFGTRYMILHFISISMALE 326

Query: 385 ICDYLK 390
           + D+L+
Sbjct: 327 VDDFLQ 332

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/45 (57%), Positives = 31/45 (68%), Gaps = 3/45 (6%)

Query: 1036 KEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAED---GSYYD 1077
            K ++ I G DVM+QYL QL HSTF+YA NILGA+      G YYD
Sbjct: 992  KFSKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYD 1036

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  176 bits (447), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 92/225 (40%), Positives = 135/225 (60%), Gaps = 23/225 (10%)

Query: 596 ISKTLEQHATTTSQVVNSLGA--DAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIE 653
           IS  L Q +   + +  + G   + GNRT+Y+GN+    K+E+ICNVVRGG+LQ+VK + 
Sbjct: 421 ISNALLQQSAAAAAIATAAGGPNNLGNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLS 480

Query: 654 HKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRN 713
            +++CF+TFI+ +AA  FYA S +  + +     K+GWG +  PLP A+ALAV+ GASRN
Sbjct: 481 DRYVCFVTFIDPTAAAQFYAMSSLHGLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRN 540

Query: 714 VYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVN 773
           VY+      F+   + DP         ++   D LR  F +YG +EQIN+L + +CC++N
Sbjct: 541 VYIG--NINFEKDAMRDP---------RIFTEDSLRKLFRQYGEVEQINFLPEKNCCFIN 589

Query: 774 FLNISAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNV 818
           F NIS AI  ++            K N  ++ L IN+GKDRCGNV
Sbjct: 590 FTNISNAILALDKI----------KSNPHFEDLKINFGKDRCGNV 624

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 104/208 (50%), Gaps = 20/208 (9%)

Query: 618 AGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFI 677
           A +RT+Y+GNI S   V+++ + VR G++++VK I  K   FI+F++ S+A+ F++++ +
Sbjct: 211 APSRTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAIL 270

Query: 678 DPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYH 737
             + +    +KIGWG      P   A  +   A+RNV++        D    +P  +   
Sbjct: 271 KRLNIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFIGHLNKTDNDSCTKEPITEA-- 328

Query: 738 QKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSE 797
                    +LR D   +G IE +  + +    +V+F +I++AI+ V +  +        
Sbjct: 329 ---------KLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNLRS-------- 371

Query: 798 KFNNRYDGLIINYGKDRCGNVNKSLMSN 825
             N  Y+   I YGKDRC  + K+   N
Sbjct: 372 -MNPYYENKKIAYGKDRCAFITKTQQHN 398

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  177 bits (448), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 85/200 (42%), Positives = 124/200 (62%), Gaps = 21/200 (10%)

Query: 619 GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678
           GNRT+Y+GN+    K+E+ICN +RGG+LQN+K +  +H+CF+TFI+ +AA  FYA S + 
Sbjct: 470 GNRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMSSLH 529

Query: 679 PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ 738
            + +HN   KIGWG +  PLP  +ALAV+ GASRN+Y+    F            ++  Q
Sbjct: 530 GLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIYLGNINFE-----------EDAKQ 578

Query: 739 KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEK 798
           +  +   D LR  F ++G +EQIN+L + +CC++NF NIS AI  ++            K
Sbjct: 579 EESVFAEDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKI----------K 628

Query: 799 FNNRYDGLIINYGKDRCGNV 818
            N  ++ L IN+GKDRCGNV
Sbjct: 629 SNPHFNNLKINFGKDRCGNV 648

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 107/211 (50%), Gaps = 20/211 (9%)

Query: 618 AGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFI 677
           A +RT+Y+GNI +    + + + VR G+++ VK +  K   F++F++ + A+ F++++ +
Sbjct: 230 APSRTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAIL 289

Query: 678 DPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKD---KFINDPEYQ 734
             + +    +KIGWG      P   A     GA+RNVY+       KD   K+  DP   
Sbjct: 290 KRLNIDGRDIKIGWGKPQPIDPIVRAGIANDGATRNVYIGKLN-TNKDSCEKWGADP--- 345

Query: 735 EYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESK 794
               K  L   ++L  D S++G IE I  ++D    +V+F +I AAI+ V +    ++  
Sbjct: 346 ----KEILVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAVANI-GSIDPY 400

Query: 795 FSEKFNNRYDGLIINYGKDRCGNVNKSLMSN 825
           +S K         + YGKDRC  + K+   N
Sbjct: 401 YSNK--------KVFYGKDRCAFITKTQQHN 423

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  176 bits (447), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 92/225 (40%), Positives = 132/225 (58%), Gaps = 22/225 (9%)

Query: 596 ISKTLEQHATTTSQVVNSLGA--DAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIE 653
           IS TL Q +   + +  S G   + GNRT+Y+GN+    K+++ICN VRGG+LQ++K + 
Sbjct: 501 ISNTLLQQSAAAAAIATSAGGPNNLGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLT 560

Query: 654 HKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRN 713
            +H+CF+TFI+ +AA  FYA S +  + +     K+GWG +  PLP  +ALAV+ GASRN
Sbjct: 561 DRHVCFVTFIDPTAAAQFYAMSSLHGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRN 620

Query: 714 VYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVN 773
           VY+   +F    K  N P + E            LR  F +YG +EQIN+L + +CC++N
Sbjct: 621 VYLGNIDFENDIKLHNPPIFTEL----------SLRNIFQQYGDVEQINFLPEKNCCFIN 670

Query: 774 FLNISAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNV 818
           F NIS AI  +E   N          N  +  L IN+GKDRCGN+
Sbjct: 671 FTNISNAILAIEKIKN----------NPDFKDLKINFGKDRCGNI 705

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 61/221 (27%), Positives = 108/221 (48%), Gaps = 26/221 (11%)

Query: 621 RTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFIDPI 680
           RT+Y+GNI S   V+D+ + VR G+++N+K +  K   FI+F++ S+A+ F++++ +  +
Sbjct: 268 RTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAFISFVDESSALLFHSDAILKRL 327

Query: 681 VLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVS----------------LPEFAFK 724
            +    +KIGWG      P      VT GA+RNVY+                     +  
Sbjct: 328 NIGGRDIKIGWGKPTPIDPIVATSIVTDGATRNVYIGQLSNSSNNNTSSSSSSTSPSSPS 387

Query: 725 DKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLV 784
           +   +D E ++      L + ++LR D   YG I+ +  ++D    +V+  +I +AI++V
Sbjct: 388 NNTSDDLEKKKNIDDSPLTE-EKLREDLKDYGEIDCVKIVQDKGFAFVHMSSILSAIKVV 446

Query: 785 EDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSN 825
            +           + N  Y    I YGKDRC  + K+   N
Sbjct: 447 NNL---------AQTNPYYQNKRIFYGKDRCAFITKTQQHN 478

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  171 bits (434), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 124/200 (62%), Gaps = 21/200 (10%)

Query: 619 GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678
           GNRTIY+GN+    K+E+ICN VRGG+LQ++K +  +H+CF+TFI+ +AA  FYA S + 
Sbjct: 340 GNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSSLH 399

Query: 679 PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ 738
            + +HN   KIGWG +  PLP  +ALAV+ GASRN+Y+   +FA  DK    P + E   
Sbjct: 400 GLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFA-ADKKSQHPIFTE--- 455

Query: 739 KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEK 798
                    LR  F ++G +EQIN+L + +CC++NF NIS+AI  ++            K
Sbjct: 456 -------AALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKI----------K 498

Query: 799 FNNRYDGLIINYGKDRCGNV 818
               +  L IN+GKDRCGNV
Sbjct: 499 SIPTFKDLKINFGKDRCGNV 518

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 108/211 (51%), Gaps = 20/211 (9%)

Query: 618 AGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFI 677
           A +RT+Y+GN+      +++ + VR G+++ VK +  K   FI+F+E ++A+ F++++ +
Sbjct: 100 APSRTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAIL 159

Query: 678 DPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKD---KFINDPEYQ 734
             + + +  +KIGWG   +  P   A     GA+RNVY+       KD   ++  DP  +
Sbjct: 160 KRLNIDDRDIKIGWGKPTQIDPIVAAGITNDGATRNVYIGKLN-TNKDICAQWGVDPNEE 218

Query: 735 EYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESK 794
              +       ++LR D S +G +E +  + +    +V+F +I AAI++V +  N     
Sbjct: 219 VITE-------EKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANLAN----- 266

Query: 795 FSEKFNNRYDGLIINYGKDRCGNVNKSLMSN 825
                N  Y    I YGKDRC  + K+   N
Sbjct: 267 ----INPYYAQKKIFYGKDRCAFITKTQQHN 293

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  171 bits (433), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 124/200 (62%), Gaps = 21/200 (10%)

Query: 619 GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678
           GNRTIY+GN+    K+E+ICN VRGG+LQ++K +  +H+CF+TFI+ +AA  FYA S + 
Sbjct: 393 GNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSSLH 452

Query: 679 PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ 738
            + +HN   KIGWG +  PLP  +ALAV+ GASRN+Y+   +F   D+ +  P + E   
Sbjct: 453 GLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFE-DDRKLEQPIFTE--- 508

Query: 739 KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEK 798
                    LR  F ++G +EQIN+L + +CC++NF NIS+AI  ++            K
Sbjct: 509 -------TSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKI----------K 551

Query: 799 FNNRYDGLIINYGKDRCGNV 818
               +  L IN+GKDRCGNV
Sbjct: 552 SIPTFKDLKINFGKDRCGNV 571

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 108/212 (50%), Gaps = 22/212 (10%)

Query: 618 AGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFI 677
           A +RT+Y+GN+       ++ + VR G++++VK +  K   FI+F++ ++A+ F++++ +
Sbjct: 153 APSRTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAIL 212

Query: 678 DPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSL----PEFAFKDKFINDPEY 733
             + + +  +KIGWG   +  P   A     GA+RNVY+      P+     ++  DP  
Sbjct: 213 KRLNIDDRDIKIGWGKPTQIDPIVAAGINNDGATRNVYLGKLNTNPKMC--AQWGADPNE 270

Query: 734 QEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVES 793
           +   +       ++LR D + +G +E +  + +    +V+F +I +AI++V +  N    
Sbjct: 271 ETITE-------EKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVVANLAN---- 319

Query: 794 KFSEKFNNRYDGLIINYGKDRCGNVNKSLMSN 825
                 N  Y    I YGKDRC  + K+   N
Sbjct: 320 -----VNPYYAQKKIFYGKDRCAFITKTQQHN 346

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  171 bits (432), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 123/200 (61%), Gaps = 21/200 (10%)

Query: 619 GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678
           GNRT+Y+GN+    K+E+ICN VRGG+LQ+VK +  +H+CF+TFI+ +AA  FYA S + 
Sbjct: 399 GNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSLH 458

Query: 679 PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ 738
            + +HN   KIGWG +   LP A+ALAV+ GASRN+YV   +F   D+   +  + E   
Sbjct: 459 GLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDFNAIDE-TGETIFTE--- 514

Query: 739 KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEK 798
                    LR  F ++G +EQIN+L + +CC++NF NIS AI  ++            K
Sbjct: 515 -------QNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKI----------K 557

Query: 799 FNNRYDGLIINYGKDRCGNV 818
            N  +  L +N+GKDRCGNV
Sbjct: 558 CNPYFKNLKVNFGKDRCGNV 577

 Score = 93.2 bits (230), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 107/212 (50%), Gaps = 22/212 (10%)

Query: 618 AGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFI 677
           A +RT+Y+GNI      + + + VR G+++ +K +  +   FI+F++ S+A+ F++++ +
Sbjct: 158 APSRTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAIL 217

Query: 678 DPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSL----PEFAFKDKFINDPEY 733
             + +    +K+GWG      P   A   + GA+RNVY+      P+ A   +F  DP  
Sbjct: 218 KRLNIEGRDIKVGWGKPTPIDPIVAAGIASDGATRNVYIGRLNTDPQLA--PQFGTDPNE 275

Query: 734 QEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVES 793
           +       +   ++LR D + +G IE I  ++D    +V+F +I +AI++V +       
Sbjct: 276 E-------IVSEEKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNL------ 322

Query: 794 KFSEKFNNRYDGLIINYGKDRCGNVNKSLMSN 825
                 N  Y    I YGKDRC  + K+   N
Sbjct: 323 ---ASVNPYYTNKKIFYGKDRCAFITKTQQHN 351

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  171 bits (434), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 127/201 (63%), Gaps = 23/201 (11%)

Query: 619 GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678
           GNRTIY+GN+    +VE+ICNVVRGG+LQ+VK +  +++CF+TFI+ +AA  F+A S + 
Sbjct: 497 GNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMSSLH 556

Query: 679 PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ 738
            + +     K+GWG +  PL  A+ALAV+ GASRN+Y+   +FA  DK  ++P + E   
Sbjct: 557 GLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFA-TDKKRDNPIFTE--- 612

Query: 739 KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAH-NPVESKFSE 797
                  D LR  FS YG +EQIN+L + +CC++NF NIS AI  ++    NPV      
Sbjct: 613 -------DSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKIKSNPV------ 659

Query: 798 KFNNRYDGLIINYGKDRCGNV 818
                +  L IN+GKDRCGN+
Sbjct: 660 -----FKDLKINFGKDRCGNI 675

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 118/240 (49%), Gaps = 41/240 (17%)

Query: 618 AGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFI 677
           A +RT+Y+GNI S   V+++ + VR G++++VK I  K   FI+F++ ++A+ F++++ +
Sbjct: 219 APSRTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAFISFLDENSALLFHSDAIL 278

Query: 678 DPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVS-LPEFAF------------- 723
             + ++   +KIGWG      P      +  GA+RNV++  L   +F             
Sbjct: 279 KRLNINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQLKTKSFDPNKAKVTKMPPS 338

Query: 724 KDKFINDPEYQEYHQK-----------------YKLPQAD-QLRIDFSKYGGIEQINYLK 765
           ++  IN     E  +K                  + P +D +LR D + +G I+ I  ++
Sbjct: 339 RNHDINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAKLRKDLADFGDIDCIKIVE 398

Query: 766 DSHCCWVNFLNISAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSN 825
           D    +++F +I++AI+ V + ++          N+ Y    I YGKDRC  + K+   N
Sbjct: 399 DKGIAFIHFASITSAIKCVHNLNS---------MNDYYSTKKIFYGKDRCAFITKTQQHN 449

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  169 bits (427), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 122/200 (61%), Gaps = 21/200 (10%)

Query: 619 GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678
           GNRT+Y+GN+    K+E+ICNVVRGGILQ +K +  +H+CF+TFI+  AA  FYA S + 
Sbjct: 401 GNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMSSLH 460

Query: 679 PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ 738
            I +     ++GWG +  PLP A+ALAV+ GASRNVY+   +F           Y++  +
Sbjct: 461 GITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-----------YEDSKR 509

Query: 739 KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEK 798
           +  +  AD LR  F +YG +EQ+N+L + +C +VN+ NIS AI  ++            K
Sbjct: 510 QEPIFTADYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKI----------K 559

Query: 799 FNNRYDGLIINYGKDRCGNV 818
            N  +  L IN+GKDRCG +
Sbjct: 560 SNPLFKNLKINFGKDRCGTI 579

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 106/210 (50%), Gaps = 18/210 (8%)

Query: 618 AGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFI 677
           A  +T+Y+GNI     V ++ + VR G+++ VK +  K   F+TF++ SAA+ F++++ +
Sbjct: 160 APRKTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAIL 219

Query: 678 DPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSL--PEFAFKDKFINDPEYQE 735
             + +    +KIGWG      P       + GA+RNVY+ L   +     +   DP  ++
Sbjct: 220 KRLHIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVGADPNDEK 279

Query: 736 YHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKF 795
             +       ++LR D  ++G I+ +  +++    +++F +I +A+++V +         
Sbjct: 280 ITE-------EKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVVANL-------- 324

Query: 796 SEKFNNRYDGLIINYGKDRCGNVNKSLMSN 825
               N  Y+   I YGKDRC  + K+   N
Sbjct: 325 -AGINPYYENKKIYYGKDRCAFITKTQQHN 353

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  168 bits (426), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 85/200 (42%), Positives = 122/200 (61%), Gaps = 21/200 (10%)

Query: 619 GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678
           GNRT+Y+GN+    K+E+ICN VR G+LQ+VK +  +H+CF+TFI+ +AA  FYA S + 
Sbjct: 407 GNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSLH 466

Query: 679 PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ 738
            ++L     K+GWG +  PLP  +ALAV+ GASRNVY+   +F  +D   N+  + E   
Sbjct: 467 GLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIGNIDFE-EDSKRNERVFTE--- 522

Query: 739 KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEK 798
                  D LR  F +YG +EQIN+L   +CC++N+ NIS AI  ++            K
Sbjct: 523 -------DNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKI----------K 565

Query: 799 FNNRYDGLIINYGKDRCGNV 818
            N  +  L IN+GKDRCGN+
Sbjct: 566 SNPYFKDLKINFGKDRCGNI 585

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 109/209 (52%), Gaps = 16/209 (7%)

Query: 618 AGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFI 677
           A +RT+Y+GNI +   V+++ + VR G++++VK +  K   FI+F++ S+A+ F++++ +
Sbjct: 166 APSRTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAIL 225

Query: 678 DPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVS-LPEFAFKDKFINDPEYQEY 736
             + +    +KIGWG   +  P       T GA+RNVY+  L   A   + +N P+  E 
Sbjct: 226 KRLNIEGRDIKIGWGKPTKIDPIVANGITTDGATRNVYIGQLYTDAEVAESLNIPKESE- 284

Query: 737 HQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFS 796
                +   ++L  D   YG I+ +  +K+    +++F +I +AI++V +          
Sbjct: 285 -----IVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVVNNL--------- 330

Query: 797 EKFNNRYDGLIINYGKDRCGNVNKSLMSN 825
              N  Y    I YGKDRC  + K+   N
Sbjct: 331 AASNRYYQNRKIFYGKDRCAFITKTQQHN 359

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  168 bits (425), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 122/200 (61%), Gaps = 21/200 (10%)

Query: 619 GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678
           GNRTIY+GN+    K+E+ICNVVRGG+LQ++K +  +H+CF+TFI+ +AA   YA + + 
Sbjct: 384 GNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMASLH 443

Query: 679 PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ 738
            + +HN   KIGWG +   L  A+ALAV+ GASRN+Y+   +F   D     P + E   
Sbjct: 444 GLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFK-ADSETEHPIFTE--- 499

Query: 739 KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEK 798
                    LR  F ++G +EQIN+L + +CC+VNF NIS AI  ++   N         
Sbjct: 500 -------QNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKIKN--------- 543

Query: 799 FNNRYDGLIINYGKDRCGNV 818
            N ++  L IN+GKDRCGNV
Sbjct: 544 -NPQFSDLKINFGKDRCGNV 562

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 104/210 (49%), Gaps = 18/210 (8%)

Query: 618 AGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFI 677
           A +RT+Y+GNI    +   + + VR G++++++ +  K   FI+F++ S+A+ F++++ +
Sbjct: 143 APSRTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAIL 202

Query: 678 DPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSL--PEFAFKDKFINDPEYQE 735
             + +    +KIGWG      P   +     GA+RNVY+     + +F  +   DP    
Sbjct: 203 KRLNIDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADP---- 258

Query: 736 YHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKF 795
              + ++    +LR D S YG IE +  + +    +V+F +I +AI++V           
Sbjct: 259 ---RDEVVTEQKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSL-------- 307

Query: 796 SEKFNNRYDGLIINYGKDRCGNVNKSLMSN 825
               N  Y    I YGKDRC  + K+   N
Sbjct: 308 -AAVNPYYANKKIFYGKDRCAFITKTQQHN 336

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  169 bits (428), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 85/200 (42%), Positives = 120/200 (60%), Gaps = 21/200 (10%)

Query: 619 GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678
           GNRT+Y+GN+    K+E+ICN VRGG+LQ++K ++ +H+CF+TFI+ +AA  FYA S + 
Sbjct: 456 GNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMSSLY 515

Query: 679 PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ 738
              +     K+GWG +  PLP A+ALAV+ GASRNVY+   +F   D     P + E   
Sbjct: 516 GFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFE-ADSKKEQPIFNE--- 571

Query: 739 KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEK 798
                    LR  F +YG +EQIN+L +  CC++NF NI+ AI  ++            K
Sbjct: 572 -------TALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKI----------K 614

Query: 799 FNNRYDGLIINYGKDRCGNV 818
            N  +  L IN+GKDRCGNV
Sbjct: 615 SNPHFKSLKINFGKDRCGNV 634

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/208 (28%), Positives = 106/208 (50%), Gaps = 20/208 (9%)

Query: 618 AGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFI 677
           A +RT+Y+GNI     ++++ + VR G+++  K +  K   FI+F+E S+A+ F++++ +
Sbjct: 221 APSRTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAIL 280

Query: 678 DPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYH 737
             + + N  +K+GWG      P   +  +  GA+RNVY+         K   +P  +E  
Sbjct: 281 KRLNIDNRDIKVGWGKPTVLDPSIASRIINDGATRNVYIGQGNNDRSSKENKEPLTEE-- 338

Query: 738 QKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSE 797
                    +LR D  +YG I+ I  + +    +V+F +I+ AI++V        S  ++
Sbjct: 339 ---------KLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVV--------STLAQ 381

Query: 798 KFNNRYDGLIINYGKDRCGNVNKSLMSN 825
           K N  Y    I YGKDRC  + K+   N
Sbjct: 382 K-NPFYQEKKIFYGKDRCAFITKTQQHN 408

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  166 bits (421), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 124/200 (62%), Gaps = 25/200 (12%)

Query: 619 GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678
           GNRTIY+GN+    K+E+ICNVVRGG+LQN+K +  +  CFITFI+ +AA  FYA S + 
Sbjct: 354 GNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMSSLH 413

Query: 679 PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ 738
            + +  +  K+GWG +  PL  A+ALA++ GASRN+Y+   +F  K+++ N+        
Sbjct: 414 GLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYFNE-------- 465

Query: 739 KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEK 798
                  + LR  F ++G +EQIN+L++  CC+VNF NI+ AI  ++   +  E      
Sbjct: 466 -------EHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKIKSLPE------ 512

Query: 799 FNNRYDGLIINYGKDRCGNV 818
               ++ L IN+GKDRCGN+
Sbjct: 513 ----FEDLKINFGKDRCGNI 528

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 115/212 (54%), Gaps = 32/212 (15%)

Query: 617 DAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSF 676
           +A +RT+Y+GNI     ++++ + VR G++++VK +  K   FI+FI+   A+ F++++ 
Sbjct: 124 NAPSRTVYLGNIPQGLTIKELLDHVRSGVVESVKILPTKLCAFISFIDERGALLFHSDAI 183

Query: 677 IDPIVLHNHTLKIGWG--NYVEPLPKAVALAVT-VGASRNVYVSLPEFAFKDKFINDPEY 733
           +  + +    +KIGWG  N+++ +   VA  +T  GA+RNVY+         +  +DP  
Sbjct: 184 LKRLNIRGKDIKIGWGKSNHIDSI---VAARITNDGATRNVYIG--------QLNDDP-- 230

Query: 734 QEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVES 793
                   +    +L  D  K+G I+ I +L +    +V+F +IS AI +V++      S
Sbjct: 231 -------TITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNL-----S 278

Query: 794 KFSEKFNNRYDGLIINYGKDRCGNVNKSLMSN 825
           K +EK+ N+     I YGKDRC  + K+   N
Sbjct: 279 KLNEKYKNKR----IFYGKDRCAFITKTQQHN 306

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  168 bits (425), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 122/201 (60%), Gaps = 23/201 (11%)

Query: 619 GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678
           GNRT+Y+GN+    KVE+ICNVVRGG+LQNVK +  +H+CF+TFI+ +AA  FYA S + 
Sbjct: 449 GNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSSLH 508

Query: 679 PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ 738
            I +     ++GWG +   L  A+ALAV+ GASRNVYV    F  +D    DP + E   
Sbjct: 509 GITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFD-EDSKREDPIFTE--- 564

Query: 739 KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAH-NPVESKFSE 797
                    LR  F ++G +EQINYL + +CC+VN+ NIS AI  ++    +PV      
Sbjct: 565 -------SSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKIKGHPV------ 611

Query: 798 KFNNRYDGLIINYGKDRCGNV 818
                +  L IN+GKDRCGNV
Sbjct: 612 -----FKDLKINFGKDRCGNV 627

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 112/214 (52%), Gaps = 23/214 (10%)

Query: 617 DAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSF 676
           +A ++T+Y+GN      V+++ + VR G++++V+ +  K   F++F++ SAA+ F++++ 
Sbjct: 206 NAPSKTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAI 265

Query: 677 IDPIVLHNHTLKIGWGNYVEPLPKAVALAVT-VGASRNVYV----SLPEFAFKDKFINDP 731
           +  + +    +KIGWG    P+   VA AV    A+RNVY+    + P+ + +   ++  
Sbjct: 266 LKRLHIDGRDIKIGWGKPT-PIDPVVATAVANDNATRNVYIGQLNTGPKLSSQVSPVDVT 324

Query: 732 EYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPV 791
           E         +   D+LR+D  ++G I+ I  +++    +V+F +I  AI+ V +  N  
Sbjct: 325 E--------PVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANLAN-- 374

Query: 792 ESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSN 825
                   N  Y    I YGKDRC  + K+   N
Sbjct: 375 -------INPYYRNKKIFYGKDRCAFITKTQQHN 401

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  164 bits (414), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 81/200 (40%), Positives = 121/200 (60%), Gaps = 23/200 (11%)

Query: 619 GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678
           GNRTIY+GN+++R ++E++CNVVRGG+LQ+VK++  +H+CF+TF + +AA  FYA + + 
Sbjct: 263 GNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFYAMASLH 322

Query: 679 PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ 738
            + +     KIGWG +  PLP  +A A++ GASRNVY       F +    DP   E+ +
Sbjct: 323 GLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPAVAEFFE 375

Query: 739 KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEK 798
           +  L QA       S +G +EQ+N + +  C +VNF N+ +AI  VE            K
Sbjct: 376 ERHLRQA------MSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVEQV----------K 419

Query: 799 FNNRYDGLIINYGKDRCGNV 818
              ++  L +NYGKDRCGNV
Sbjct: 420 KWPQFQQLKVNYGKDRCGNV 439

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/255 (22%), Positives = 123/255 (48%), Gaps = 36/255 (14%)

Query: 596 ISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHK 655
           ++  ++  AT +S  +N     A +RT+Y+GNI     + ++ + V+ G++++ +    K
Sbjct: 16  LAAPVDGSATVSSNPLNF--TSAPSRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAK 73

Query: 656 HICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVY 715
              F++F++ ++A+ F++++ ++ + + +  +KIGW       P       + GA+RNVY
Sbjct: 74  SCAFVSFVDENSALLFHSDAILNRLRIGDRDVKIGWATATLMDPLVATRIQSEGATRNVY 133

Query: 716 VS-LPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNF 774
           +  LP+                  +Y+L +      D S YG I+ +  L      +V+ 
Sbjct: 134 LGNLPDGV---------------SRYELTK------DLSVYGEIDSVKLLSSKGVAFVHM 172

Query: 775 LNISAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKV 834
            +I  AI  V +          ++ N  Y    +++GKDRC  V K L  ++ ++F    
Sbjct: 173 ASIGQAIHAVANL---------QRDNKIYSDRRVSFGKDRCAYVTK-LQQSRAAQFLGLP 222

Query: 835 KSISNNVKLKELEEK 849
           +   + V++++L ++
Sbjct: 223 E--EDAVRMEQLRDR 235

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  166 bits (421), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 121/200 (60%), Gaps = 21/200 (10%)

Query: 619 GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678
           GNRTIY+GN+    K+E+ICN VRGG+LQ++K +  +H+CF+TFI+ +AA   YA + + 
Sbjct: 386 GNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTSLH 445

Query: 679 PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ 738
            + +HN   KIGWG +   L  A+ALAV+ GASRN+Y+   +F   D   + P + E   
Sbjct: 446 GLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFK-ADSERDVPVFTE--- 501

Query: 739 KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEK 798
                    LR  F +YG +EQIN+L +  CC+VNF NIS AI  ++            K
Sbjct: 502 -------QNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKI----------K 544

Query: 799 FNNRYDGLIINYGKDRCGNV 818
            N ++  L IN+GKDRCGNV
Sbjct: 545 SNEQFKDLKINFGKDRCGNV 564

 Score = 93.6 bits (231), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 104/210 (49%), Gaps = 18/210 (8%)

Query: 618 AGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFI 677
           A +RT+Y+GNI    +V ++ + VR G++++V+ +  K   FI+F++ S+A+ F++++ +
Sbjct: 145 APSRTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAIL 204

Query: 678 DPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSL--PEFAFKDKFINDPEYQE 735
             + +    +K+GWG      P   A     GA+RNVY+     +     +F  DP    
Sbjct: 205 KRLNIGGRDIKVGWGKPTPIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADP---- 260

Query: 736 YHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKF 795
              +  +   ++LR D   YG IE +  + +    +V+F +I +AI++V           
Sbjct: 261 ---RDLIATEEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSL-------- 309

Query: 796 SEKFNNRYDGLIINYGKDRCGNVNKSLMSN 825
               N  Y    I YGKDRC  V K+   N
Sbjct: 310 -ATVNPYYSNKKIFYGKDRCAFVTKTQQHN 338

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  163 bits (412), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 123/200 (61%), Gaps = 21/200 (10%)

Query: 619 GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678
           GNRT+Y+G++    K+E+ICN VRGG+LQ++K +  +++CF+TFI+ +AA  FYA S + 
Sbjct: 413 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 472

Query: 679 PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ 738
              +     K+GWG +  PLP A+ALAV+ GASRNVYV   +FA  D   ++  + E   
Sbjct: 473 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFA-SDSLNDERIFTE--- 528

Query: 739 KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEK 798
                  + LR  F +YG +EQIN+L + +CC++N+ NIS AI  ++            K
Sbjct: 529 -------NNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI----------K 571

Query: 799 FNNRYDGLIINYGKDRCGNV 818
            N  +  L IN+GKDRCGNV
Sbjct: 572 SNPYFKDLKINFGKDRCGNV 591

 Score =  103 bits (257), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 68/222 (30%), Positives = 113/222 (50%), Gaps = 25/222 (11%)

Query: 605 TTTSQVVNSLG-ADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFI 663
           +  SQ  NSL    A  RT+Y+GN+     V+++ + VR G++++VK I  K   FI+F+
Sbjct: 168 SVNSQANNSLNFTSAPTRTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFV 227

Query: 664 EASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAF 723
           + SAA+ F++++ +  + + +  +KIGWG      P   A   T GA+RNVY+       
Sbjct: 228 DESAALLFHSDAILKRLNIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIGRMTV-- 285

Query: 724 KDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRL 783
                   E +E H        +QLR D  +YG I+ I  +K+    +++F +I  AI++
Sbjct: 286 --------EGEESHL-----SEEQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKV 332

Query: 784 VEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSN 825
           V +   P+ + +       Y    I YGKDRC  + K+   N
Sbjct: 333 VTNL--PIRNPY-------YQNKRIFYGKDRCAFITKTQQHN 365

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  162 bits (409), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 83/200 (41%), Positives = 121/200 (60%), Gaps = 21/200 (10%)

Query: 619 GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678
           GNRT+Y+G++    K+E+ICN VRGG+LQ++K +  +++CF+TFI+ +AA  FYA S + 
Sbjct: 429 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 488

Query: 679 PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ 738
              +     K+GWG +  PLP A+ALAV+ GASRNVYV   +F   D   ++  + E   
Sbjct: 489 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFV-GDSLRDERVFTE--- 544

Query: 739 KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEK 798
                    LR  F +YG +EQIN+L + +CC++N+ NIS AI  ++            K
Sbjct: 545 -------SNLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI----------K 587

Query: 799 FNNRYDGLIINYGKDRCGNV 818
            N  +  L IN+GKDRCGNV
Sbjct: 588 SNPYFKDLKINFGKDRCGNV 607

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 109/208 (52%), Gaps = 24/208 (11%)

Query: 618 AGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFI 677
           A +RT+Y+GN+     V+++ + VR G++++VK I  K   F++FI+ SAA+ F++++ +
Sbjct: 198 APSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAIL 257

Query: 678 DPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYH 737
             + + +  +KIGWG      P   A   T GA+RNVY+               E +E H
Sbjct: 258 KRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTI----------EGEESH 307

Query: 738 QKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSE 797
                   +QLR+D  +YG I+ I  +K+    +++F +I  AI++V +   P+ + +  
Sbjct: 308 LS-----EEQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNL--PIRNPY-- 358

Query: 798 KFNNRYDGLIINYGKDRCGNVNKSLMSN 825
                Y    I YGKDRC  + K+   N
Sbjct: 359 -----YQNKRIFYGKDRCAFITKTQQHN 381

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  162 bits (409), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 121/200 (60%), Gaps = 21/200 (10%)

Query: 619 GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678
           GNRT+Y+G++    K+E+ICN VRGG+LQ++K +  +++CF+TFI+ +AA  FYA S + 
Sbjct: 442 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 501

Query: 679 PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ 738
              +     K+GWG +  PLP A+ALAV+ GASRNVYV          F++D    E   
Sbjct: 502 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVSDSLRDE--- 552

Query: 739 KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEK 798
             ++     LR  F +YG +EQIN+L + +CC+VN+ NIS AI  ++            K
Sbjct: 553 --RIFTESNLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKI----------K 600

Query: 799 FNNRYDGLIINYGKDRCGNV 818
            N  +  L IN+GKDRCGNV
Sbjct: 601 SNPYFKDLKINFGKDRCGNV 620

 Score =  103 bits (257), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 110/208 (52%), Gaps = 24/208 (11%)

Query: 618 AGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFI 677
           A +RT+Y+GN+     V+++ + VR G++++VK I  K   FI+F++ SAA+ F++++ +
Sbjct: 211 APSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAIL 270

Query: 678 DPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYH 737
             + + +  +KIGWG      P   A   T GA+RNVY+       ++  +++       
Sbjct: 271 KRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIDGEESHLSE------- 323

Query: 738 QKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSE 797
                   +QLRID  +YG I+ I  +K+    +++F +I  AI++V +   P+ + +  
Sbjct: 324 --------EQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVVTNL--PIRNPY-- 371

Query: 798 KFNNRYDGLIINYGKDRCGNVNKSLMSN 825
                Y    I YGKDRC  + K+   N
Sbjct: 372 -----YQNKRIFYGKDRCAFITKTQQHN 394

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  160 bits (405), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 122/200 (61%), Gaps = 21/200 (10%)

Query: 619 GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678
           GNRT+Y+G++    K+E+ICN VRGG+LQ++K +  +++CF+TFI+ +AA  FYA S + 
Sbjct: 431 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 490

Query: 679 PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQ 738
              +     K+GWG +  PLP A+ALAV+ GASRNVYV          +++D    E   
Sbjct: 491 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDYVSDSVRDE--- 541

Query: 739 KYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEK 798
             ++    +LR  F +YG +EQIN+L + +CC++N+ NIS AI  ++            K
Sbjct: 542 --RIFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI----------K 589

Query: 799 FNNRYDGLIINYGKDRCGNV 818
            N  +  L IN+GKDRCGNV
Sbjct: 590 SNPYFKDLKINFGKDRCGNV 609

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 64/208 (30%), Positives = 110/208 (52%), Gaps = 24/208 (11%)

Query: 618 AGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFI 677
           A +RT+Y+GN+     V+++ + VR G++++VK I  K   FI+F++ SAA+ F++++ +
Sbjct: 200 AQSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAIL 259

Query: 678 DPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYH 737
             + + +  +KIGWG      P   A   T GA+RNVY+               E +E H
Sbjct: 260 KRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTI----------EGEESH 309

Query: 738 QKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSE 797
                   +QLR D  +YG I+ I  +K+    +++F +I  AI++V +   P+ + + +
Sbjct: 310 LS-----GEQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVVTNL--PIRNLYYQ 362

Query: 798 KFNNRYDGLIINYGKDRCGNVNKSLMSN 825
             N R     I YGKDRC  + K+   N
Sbjct: 363 --NKR-----IFYGKDRCAFITKTQQHN 383

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  157 bits (398), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/204 (39%), Positives = 118/204 (57%), Gaps = 29/204 (14%)

Query: 619 GNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFID 678
           GNRT+Y+GN+ +  ++EDICN +R G+LQN+K +  +H+CF+TFI+  +A  FYA S I 
Sbjct: 413 GNRTVYLGNLPNDIRIEDICNTIRCGLLQNIKLLSDRHVCFVTFIDPVSAAQFYAMSSIY 472

Query: 679 PIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAF----KDKFINDPEYQ 734
             VL     K+GWG +  PL   + LAV+ GASRNVY+   +F      ++++  D    
Sbjct: 473 GFVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYIGNIDFTADGTKRERYFTDS--- 529

Query: 735 EYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESK 794
                        LR  FS+YG +EQIN+L   +CC+VN+ NI+ AI  ++   N     
Sbjct: 530 ------------NLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAIDKIKN----- 572

Query: 795 FSEKFNNRYDGLIINYGKDRCGNV 818
                N  +  L IN+GKDRCGN+
Sbjct: 573 -----NPTFKNLKINFGKDRCGNI 591

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 108/208 (51%), Gaps = 15/208 (7%)

Query: 618 AGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFI 677
           A +RT+Y+GNI       D+ + VR G+++ VK +  K   FI+F++ ++++ F++++ +
Sbjct: 165 APSRTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAIL 224

Query: 678 DPIVLHNHTLKIGWGNYVEPLPKAVALAV-TVGASRNVYVSLPEFAFKDKFINDPEYQEY 736
             + +    +KIGWG    PL   +A +V T GA+RN+++        +K   D +   Y
Sbjct: 225 KRLNIDGKDIKIGWGK-PSPLSPIIATSVATDGATRNIFIGQLNTTDHNK-QKDNDATIY 282

Query: 737 HQK---YKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVES 793
           H       +   ++LR D  +YG I+ I   K+    +V+F +I +AI++V +  N    
Sbjct: 283 HGSDDFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLSNS--- 339

Query: 794 KFSEKFNNRYDGLIINYGKDRCGNVNKS 821
                 N  Y    I YGKDRC  + K+
Sbjct: 340 ------NPYYSKKKIYYGKDRCAFITKT 361

>ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {ON}
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 389

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 81/209 (38%), Gaps = 27/209 (12%)

Query: 621 RTIYIGNINSRSKVEDICNVVRGGILQNV----------KYIEHKHICFITFIEASAAIH 670
           + I +GNI  R+ +  I   +  G L+N+          K IE      + F+   AA  
Sbjct: 183 KAIVLGNIPKRTGIASILAQIHAGPLENIIVHTDDEQALKKIE------LDFLTHEAAYS 236

Query: 671 FYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFIND 730
           F      +   ++   L   WG   E   K         +S +          K K+IN 
Sbjct: 237 FMKYGRTNMFKINGQHLTPEWGKSSEHKTKKGNEWDDQQSSSDDQDFCRSLIMK-KYINC 295

Query: 731 PEYQEYHQKYKLPQADQLRI-----DFSKYGGIEQIN-YLKDSHCCWVNFLNISAAIRLV 784
            +  +Y + YK    + L +     DF  +G I +I   +    C  +NF N+ +A++ +
Sbjct: 296 TKRTKYSEAYKESPLEPLNLSEIKQDFGTFGEILEITPVVSRKLCISINFFNMESAMKAM 355

Query: 785 EDAHNPVESKFSEKFNNRYDGLIINYGKD 813
           ++  NP        FNN      I YGKD
Sbjct: 356 KEYENPNSDLHKAYFNN----WAIWYGKD 380

>TPHA0D01210 Chr4 complement(253331..254425) [1095 bp, 364 aa] {ON}
           Anc_8.670 YOR242C
          Length = 364

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 87/204 (42%), Gaps = 22/204 (10%)

Query: 621 RTIYIGNINSRSKVEDICNVVRGGILQNVKYIEH------KHICFITFIEASAAIHFYAN 674
           R IYI +I S   ++ I + + GG L+++K I+H           + F++ + A +F   
Sbjct: 163 RVIYIRDIPSNVSMKSIISQIYGGPLESLKLIKHDESRSRNQDMELVFLKKADATNFLRY 222

Query: 675 SFIDPIVLHNHTLKI-GWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEY 733
           S         H   I G   Y EP      L         +  ++       ++    E 
Sbjct: 223 S-------RTHLFHINGKRLYSEPGSNNNLLNSNKAFDSTINNNISRTLIMKRYNKTTEK 275

Query: 734 QEYHQKYKLP---QADQLRIDFSKYGGIEQINYLKDSHCCW-VNFLNISAAIRLVEDAHN 789
           QE   K  L      +++R DF ++G I  I  +     C  +++ NI AA+  ++   +
Sbjct: 276 QEQVSKEFLIDYFDIEEVRKDFFQFGNIVDITPIVSRKVCLSISYYNIKAAMDAMKAYDD 335

Query: 790 PVESKFSEKFNNRYDGLIINYGKD 813
           P  S+F +K++  +   ++ YGKD
Sbjct: 336 PY-SEFHKKYSEEW---VVWYGKD 355

>TDEL0A06160 Chr1 complement(1078577..1079713) [1137 bp, 378 aa]
           {ON} Anc_8.670 YOR242C
          Length = 378

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 36/68 (52%), Gaps = 5/68 (7%)

Query: 747 QLRIDFSKYGGIEQIN-YLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEKFNNRYDG 805
           ++R DF  +G ++ I   +    C  ++F ++ +AIR ++D  +P  + + + F N    
Sbjct: 306 EIRHDFGIFGKVQDIAPIVSRKLCISISFYSVHSAIRAMDDYEDPSSALYKKYFKN---- 361

Query: 806 LIINYGKD 813
             + YGKD
Sbjct: 362 WAVWYGKD 369

>KLLA0A04103g Chr1 (369258..371615) [2358 bp, 785 aa] {ON} similar
           to uniprot|Q12502 Saccharomyces cerevisiae YOR322C
          Length = 785

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 815 CGNVNKSLMSNKNSRFYKKVK-----SISNNVKLKELEEKRKADTERLNSLRKTS 864
           C +  +  M   N R  +KVK       ++  KLK+LEEK K D ER   +RK+S
Sbjct: 299 CSDDRRWRMRKLNWRIEEKVKVRAHGCQAHKAKLKQLEEKVKQDEERDRQIRKSS 353

>Skud_4.35 Chr4 (62864..63817) [954 bp, 317 aa] {ON} YDL218W (REAL)
          Length = 317

 Score = 33.5 bits (75), Expect = 2.9,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 11/56 (19%)

Query: 512 SNPFEQQLPYSYEEDDDQRTNVRSGSLPA----NPQFPNMPNLPKGYISPNPNMNY 563
           S PFE+  PY         TNVR+G + A    N  + + PN    Y + +PN  Y
Sbjct: 189 SEPFEETAPYD-------NTNVRTGDVEAGAGDNTAYTSEPNADARYTTNDPNAQY 237

>KLTH0E10868g Chr5 (975831..976856) [1026 bp, 341 aa] {ON} similar
           to uniprot|Q12046 Saccharomyces cerevisiae YDL209C
          Length = 341

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 10/59 (16%)

Query: 620 NRTIYIGNI-----NSRSKVEDICNVVRG-----GILQNVKYIEHKHICFITFIEASAA 668
           NRT+Y+G I     N + K   I N +R      G L+ ++Y+E+K+  FI +   ++A
Sbjct: 137 NRTLYVGGITGALNNQQLKASQIENRLRFSFGKLGPLERIRYVENKNCAFIKYKHQASA 195

>KAFR0C04350 Chr3 (860142..862133) [1992 bp, 663 aa] {ON} Anc_1.342
           YBR260C
          Length = 663

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 74/167 (44%), Gaps = 16/167 (9%)

Query: 782 RLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYK-KVKSISNN 840
           RL +D  + + S  +EK  +RY+ L  ++ K R  +  K+ ++ + S+  + + + +   
Sbjct: 149 RLEKDVSDAIHS--AEKAQSRYNSLCQDWDKLRMSDPTKTKLTLRGSKTTREQEEELLRK 206

Query: 841 VKLKELEEKRKADTERLNSLRKTSSSDGQ----------LSKLD-AFGIGIDTVSNNEED 889
           + + +LE K+K D    NSLR T  +  +          + +LD A  I +   +   E+
Sbjct: 207 IDIADLEYKQKVDHS--NSLRNTFITKERPRIVLELKDLILELDTAMAIQVQKYTIWTEN 264

Query: 890 GNIEKGNTLSKIDTDVNGFNALGFKIEPKHDMMNETMDNNTEGNNTL 936
             +  G T+S  D        +   +  + D+ N     N  G N+L
Sbjct: 265 LVLNSGVTISPFDKSSRSMKQVASSVTTEKDLYNFLNKYNHSGKNSL 311

>KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some
           similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 436

 Score = 32.7 bits (73), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 46/105 (43%), Gaps = 10/105 (9%)

Query: 595 PISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVR-GGILQNVKYIE 653
           P S T  +  T T    +  G +  +R +Y+GN++     E +    + GG + NVK + 
Sbjct: 41  PESSTKPEEPTVTPANASRGGRETSDRILYVGNLDLAVTEEMLKQYFQVGGSIANVKILM 100

Query: 654 HK-----HICFITFIEA-SAAIHFYANSFIDPIVLHNHTLKIGWG 692
            K     +  F+ F +   A + F     +D   + NH +KI W 
Sbjct: 101 DKNNKQANYAFVEFHQPHDANVAFQT---LDGKQIENHVIKINWA 142

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 117,134,019
Number of extensions: 5390414
Number of successful extensions: 18554
Number of sequences better than 10.0: 134
Number of HSP's gapped: 19068
Number of HSP's successfully gapped: 195
Length of query: 1081
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 961
Effective length of database: 39,721,479
Effective search space: 38172341319
Effective search space used: 38172341319
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 71 (32.0 bits)