Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0B002708.850ON47647623820.0
NDAI0E002608.850ON49846813360.0
TBLA0B029008.850ON52046612421e-167
TDEL0B001908.850ON49246312331e-166
YMR285C (NGL2)8.850ON51546412291e-165
Smik_13.5018.850ON51546412271e-165
Suva_13.4758.850ON51546412221e-164
Kpol_237.18.850ON50346312101e-162
KAFR0L019608.850ON51146312091e-162
SAKL0D01166g8.850ON50546212071e-162
Skud_13.4588.850ON51446412001e-161
TPHA0I003208.850ON52944612001e-160
KNAG0K006508.850ON48246911931e-160
KLTH0C03608g8.850ON49546211921e-160
ZYRO0C14872g8.850ON49646511861e-159
CAGL0I02684g8.850ON49346211831e-158
NCAS0C003108.850ON55646511861e-158
NDAI0K003708.850ON56846411631e-154
TBLA0D033008.850ON48046411441e-153
Kwal_27.102048.850ON49446011411e-152
ABL118W8.850ON50446211161e-148
KLLA0C06248g8.850ON51646510911e-144
Ecym_46198.850ON48744710771e-142
Suva_13.258.850ON50246610321e-135
YML118W (NGL3)8.850ON50546910211e-134
Smik_13.168.850ON50244910021e-131
Skud_13.238.850ON4984699821e-128
KAFR0A028608.850ON4784739481e-123
CAGL0B02387g8.850ON4714669401e-122
KNAG0G034708.850ON4664679181e-119
Kwal_26.71127.78ON7422452382e-20
KLTH0D02310g7.78ON7392442133e-17
KNAG0D048407.78ON7792802001e-15
SAKL0B10032g7.78ON7312471991e-15
TDEL0H037307.78ON7972461982e-15
KAFR0K006707.78ON7952471972e-15
ZYRO0D05302g7.78ON8572481946e-15
TPHA0H026807.78ON8722831939e-15
ACR288W7.78ON7362471921e-14
Kpol_1040.147.78ON7842451911e-14
Skud_1.407.78ON8692441902e-14
Suva_1.457.78ON8312441866e-14
CAGL0H06149g7.78ON8732431866e-14
Ecym_73547.78ON7852471831e-13
YAL021C (CCR4)7.78ON8372441831e-13
NDAI0H025207.78ON8982401822e-13
TBLA0A046607.78ON8962471751e-12
KLLA0F15884g7.78ON7902361723e-12
Smik_1.457.78ON8392441714e-12
NCAS0F016407.78ON8552531643e-11
TDEL0H036007.90ON3662671161e-05
KAFR0D012507.90ON3562511115e-05
Kwal_26.71707.90ON3722501098e-05
CAGL0F01001g7.90ON3592771098e-05
Kpol_1044.67.90ON3722411099e-05
SAKL0B09768g7.90ON3682421071e-04
KNAG0L005507.90ON3812731062e-04
KLLA0F07733g7.90ON3712681053e-04
KLTH0D02574g7.90ON3682521043e-04
Skud_15.1157.90ON363255990.001
NCAS0I005007.90ON389242980.002
YOL042W (NGL1)7.90ON363255970.002
Ecym_26367.90ON367264970.003
NDAI0A085307.90ON365281960.003
Suva_15.1277.90ON363255920.011
ACR277C7.90ON37890910.012
Smik_15.1257.90ON363232870.040
ZYRO0D05588g7.90ON356113870.043
TBLA0I033103.529ON50567790.42
TPHA0L005307.90ON39181760.81
Skud_16.906.190ON60847741.5
NDAI0A021507.309ON78937697.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0B00270
         (476 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      922   0.0  
NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   519   0.0  
TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   483   e-167
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   479   e-166
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   478   e-165
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   477   e-165
Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   475   e-164
Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   470   e-162
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   470   e-162
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   469   e-162
Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   466   e-161
TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   466   e-160
KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   464   e-160
KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   463   e-160
ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   461   e-159
CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   460   e-158
NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850      461   e-158
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   452   e-154
TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...   445   e-153
Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   444   e-152
ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...   434   e-148
KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   424   e-144
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   419   e-142
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   402   e-135
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...   397   e-134
Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   390   e-131
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   382   e-128
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   369   e-123
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   366   e-122
KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   358   e-119
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    96   2e-20
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    87   3e-17
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    82   1e-15
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    81   1e-15
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    81   2e-15
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    80   2e-15
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    79   6e-15
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    79   9e-15
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    79   1e-14
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    78   1e-14
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    78   2e-14
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    76   6e-14
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    76   6e-14
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    75   1e-13
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    75   1e-13
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      75   2e-13
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    72   1e-12
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    71   3e-12
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    70   4e-12
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      68   3e-11
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    49   1e-05
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    47   5e-05
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    47   8e-05
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    47   8e-05
Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119...    47   9e-05
SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {...    46   1e-04
KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90...    45   2e-04
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    45   3e-04
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    45   3e-04
Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042...    43   0.001
NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90 ...    42   0.002
YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putat...    42   0.002
Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {O...    42   0.003
NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa] ...    42   0.003
Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042...    40   0.011
ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON} S...    40   0.012
Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042...    38   0.040
ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} simila...    38   0.043
TBLA0I03310 Chr9 (803817..805334) [1518 bp, 505 aa] {ON} Anc_3.5...    35   0.42 
TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90...    34   0.81 
Skud_16.90 Chr16 (162354..164180) [1827 bp, 608 aa] {ON} YPL189W...    33   1.5  
NDAI0A02150 Chr1 (486774..489143) [2370 bp, 789 aa] {ON} Anc_7.309     31   7.5  

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/476 (94%), Positives = 451/476 (94%)

Query: 1   MNXXXXXXXXXXXXXHDNSPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRP 60
           MN             HDNSPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRP
Sbjct: 1   MNSSPSTQRRRRSSQHDNSPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRP 60

Query: 61  FLTLHDNEPDNGESKHEFSILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYN 120
           FLTLHDNEPDNGESKHEFSILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYN
Sbjct: 61  FLTLHDNEPDNGESKHEFSILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYN 120

Query: 121 PDIMCLQEIDFKYVKEFWSVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDF 180
           PDIMCLQEIDFKYVKEFWSVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDF
Sbjct: 121 PDIMCLQEIDFKYVKEFWSVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDF 180

Query: 181 DELLAGDIPPRTKTRNIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQ 240
           DELLAGDIPPRTKTRNIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQ
Sbjct: 181 DELLAGDIPPRTKTRNIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQ 240

Query: 241 CYLMLSEMNKFLSFLNEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIE 300
           CYLMLSEMNKFLSFLNEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIE
Sbjct: 241 CYLMLSEMNKFLSFLNEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIE 300

Query: 301 CSTSYTYSKKRNGDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQL 360
           CSTSYTYSKKRNGDMDVN            FIKKQPTDPRPAFFQPTKEQAALVNTIQQL
Sbjct: 301 CSTSYTYSKKRNGDMDVNEKEQSDSEEDEEFIKKQPTDPRPAFFQPTKEQAALVNTIQQL 360

Query: 361 HNSLPFRAISLYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDK 420
           HNSLPFRAISLYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDK
Sbjct: 361 HNSLPFRAISLYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDK 420

Query: 421 NDDVETLETFEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQLTK 476
           NDDVETLETFEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQLTK
Sbjct: 421 NDDVETLETFEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQLTK 476

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  519 bits (1336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/468 (52%), Positives = 324/468 (69%), Gaps = 22/468 (4%)

Query: 21  EYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEFSI 80
           EYI++IR +R  K +  RE RM+ G +PDIP ELQF +RP LTLHD++P  G       I
Sbjct: 37  EYITKIRAEREKKRELEREYRMKHGFEPDIPSELQFIKRPLLTLHDDDPVKGTM---LKI 93

Query: 81  LTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWSV 140
           +TYNCLAQ LI RD+FP SG ALKW RRSK ++NELKYY+ D++ LQEIDF   K++W +
Sbjct: 94  MTYNCLAQSLIQRDLFPGSGQALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKI 153

Query: 141 QFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIGLI 200
               LGY  +F+KK  KIHGV+IAW+ ++F       +DFDE L+G I PRT+T+N+GL+
Sbjct: 154 VLAKLGYDCEFYKKNGKIHGVLIAWKRNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLV 213

Query: 201 VALQFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLNEHSG 260
           +AL+FL  N +  + +  G+++ TTHLFWH FGTFERTRQCY+M+ +M+KF+  L    G
Sbjct: 214 IALEFL--NKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL---GG 268

Query: 261 ITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKR--------- 311
           I  WYPF TGDFNSQPKDAPY+S+T+KP+ + +E + VIECS +Y YSKKR         
Sbjct: 269 IEKWYPFFTGDFNSQPKDAPYVSITSKPVSFQNETKIVIECSAAYKYSKKRNGEEEEKNE 328

Query: 312 ----NGDMDV-NXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPF 366
                 ++D  +             I  QP++ RP  F PT+EQA LV+ +  LHNSL  
Sbjct: 329 GKEKQHEIDSSDSSDAETDEEKEEIIPNQPSNARPLHFTPTREQAELVSQLAALHNSLNL 388

Query: 367 RAISLYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVET 426
           RAISLYSVGYR V PEN++INN RGEPE S W   WSGLLDYIF+++ W+ K  ++ V++
Sbjct: 389 RAISLYSVGYRKVDPENAYINNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDS 448

Query: 427 LETFEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
           L+TFE+ N +K+ G LK+P  KEM  H+ PY+GEYPSDHL +M +L+L
Sbjct: 449 LKTFERENNVKLRGLLKMPQSKEMCEHAIPYKGEYPSDHLCMMIQLEL 496

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  483 bits (1242), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 232/466 (49%), Positives = 319/466 (68%), Gaps = 15/466 (3%)

Query: 17  DNSPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKH 76
           D SPE+I+++R +R    +  R++ + QG+DPD P ELQF +RP L +H+NEP  G    
Sbjct: 62  DISPEHIAQVRAKREAARKAKRDALLAQGIDPDCPKELQFIKRPILQMHENEPVKG---F 118

Query: 77  EFSILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKE 136
           +FS++TYNCLAQ LI R +FPE G+ALKW RRSK ++NE K+YNPDI+CLQEID    + 
Sbjct: 119 KFSLMTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQS 178

Query: 137 FWSVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRN 196
           FW  +F  LGY  +F+KK  K HGV + W+  +F+  D+  VD+D+ L+GDI PRT T N
Sbjct: 179 FWKEEFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNN 238

Query: 197 IGLIVALQFLDNNNNNPSRESH--GIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSF 254
           I L+++L+F         +  +  GI++ TTHLFWHPFGT+ERTRQCY++L++M +F+  
Sbjct: 239 IALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDR 298

Query: 255 LN--EHSG---ITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSK 309
           +N  +++G    ++WYPF  GDFNSQP D+PY+SMT+KPI+Y    +TVIECSTS+ +SK
Sbjct: 299 VNILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSK 358

Query: 310 KRNGDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAI 369
           KR+                  F K QP  P P  +Q   EQ  LV  +Q+LHNSL  RAI
Sbjct: 359 KRD----GEEGDDEEGGNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAI 414

Query: 370 SLYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLET 429
           SLYS GY  VHPENS I+N R EPE S+W   W GLLDY+FYIK+W+    N ++++LE 
Sbjct: 415 SLYSAGYSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFT-PNKEIDSLED 473

Query: 430 FEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQLT 475
           FE+ N +KI G+L++P  KE+  H QP+EGEYPSDHL ++C+++L 
Sbjct: 474 FERENDIKIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVELC 519

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  479 bits (1233), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 231/463 (49%), Positives = 310/463 (66%), Gaps = 13/463 (2%)

Query: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEF 78
           SPE+++++R +R    +  RE  + +G+DPD PPELQF +RP LTLH++EP  G S   F
Sbjct: 36  SPEHVAKVRAEREAARKAKREEMLAKGMDPDHPPELQFIKRPLLTLHEDEPIEGLS---F 92

Query: 79  SILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFW 138
            +LTYNCLAQ LI R +FP+SG++LKW RRSK +  E K+YN D++CLQEID+   ++FW
Sbjct: 93  KLLTYNCLAQALIRRKLFPDSGDSLKWFRRSKVLQYEFKHYNADVLCLQEIDYIQYQQFW 152

Query: 139 SVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIG 198
             +   LGY  +F+K+  K HGV IAW+  +F+  D+  +D+D+  +G I  RT T N G
Sbjct: 153 KDELDKLGYDTQFYKQPCKNHGVSIAWKRHLFQLTDRMLIDYDKESSGKIEKRTLTHNSG 212

Query: 199 LIVALQFLDNNNNN-PSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFL-- 255
           LI+AL+F D    + P     GI+V T+HLFWHPFGT+ERTRQCY++L +M +F+  +  
Sbjct: 213 LILALKFTDAAKQSCPHIRKSGILVGTSHLFWHPFGTYERTRQCYVVLKKMKEFMKRVNV 272

Query: 256 ---NEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRN 312
              N    +++W PF  GDFNSQP D PY+SMT+KP++Y    +TV+ECSTSYT+SK RN
Sbjct: 273 LQNNNDGNLSHWVPFFCGDFNSQPFDTPYLSMTSKPVEYTGRAKTVVECSTSYTFSKLRN 332

Query: 313 GDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISLY 372
                             F K QP  P P  F  T EQ  LV  +Q+LHNS+  RAISLY
Sbjct: 333 ---GEEDAEDEEGGNIEKFGKDQPQTPVPETFDATPEQQKLVEEMQELHNSIDMRAISLY 389

Query: 373 SVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETFEK 432
           +VGY  VHPENS I+N RGEPE S+W   W GLLDYI  I  W+  D+   V++LETFEK
Sbjct: 390 AVGYGEVHPENSGIDNDRGEPEMSNWANTWRGLLDYILLITQWDSSDRK-KVDSLETFEK 448

Query: 433 TNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQLT 475
            N+LK+ G L++P   EM+HH QP+EGEY SDHL++MC ++LT
Sbjct: 449 ENSLKLRGLLRMPPASEMSHHGQPHEGEYASDHLSMMCTIELT 491

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  478 bits (1229), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 226/464 (48%), Positives = 314/464 (67%), Gaps = 14/464 (3%)

Query: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEF 78
           +PE+I+++R +R    +  R++ + QG+DPD PPEL F RRPFL+LH+ EP  G     F
Sbjct: 56  TPEHIAKVRAEREVMRKAKRDAMLAQGVDPDCPPELHFIRRPFLSLHEAEPVTG---FRF 112

Query: 79  SILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFW 138
            ++TYNCLAQ LI R +FP+SG+ALKW RRSK ++NE KYYN D++CLQEID    + FW
Sbjct: 113 KLMTYNCLAQALIRRKLFPDSGDALKWYRRSKVLLNEFKYYNSDVICLQEIDHIQFQSFW 172

Query: 139 SVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIG 198
             +F  LGY  ++++   K HGV I WR  +F   D+  +D+D+  +  I  RT T N+G
Sbjct: 173 KDEFSKLGYDGQYYRNATKNHGVAIMWRRELFHQVDKMLIDYDKESSESISTRTTTNNVG 232

Query: 199 LIVALQFLDNNNNNPSRESH---GIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFL 255
           L++AL+F +   +N  ++S    GI++ TTHLFWHPFGT+ERTRQCY++L +M +F+  +
Sbjct: 233 LVLALKFSEKVLSNLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYIVLKKMKEFMHRV 292

Query: 256 N----EHSG-ITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKK 310
           N    E+ G +++W+PF  GDFNSQP D PY+SMT+KP+ Y +  +TVI CSTSY +SK 
Sbjct: 293 NVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYRNRAKTVIGCSTSYKFSKV 352

Query: 311 RNGDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAIS 370
           R+G+   +            + K QP  P P  F   +EQ+ LV+ + QLHNSL  RAIS
Sbjct: 353 RDGEEGADDEEGGNIEK---YGKDQPESPVPEKFHANEEQSELVDKMAQLHNSLDMRAIS 409

Query: 371 LYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETF 430
           LYSVGY+NVHPEN+ ++N RGEPE S+W   W GLLDY+FY+K W+ +    +VETL  F
Sbjct: 410 LYSVGYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDPQSNCQEVETLGDF 469

Query: 431 EKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
           EK N +K  GFL++P   EM  H QP+ GEY SDHL+++C L+L
Sbjct: 470 EKENKVKCRGFLRMPPGNEMTKHGQPHVGEYASDHLSMVCDLEL 513

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  477 bits (1227), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 226/464 (48%), Positives = 315/464 (67%), Gaps = 14/464 (3%)

Query: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEF 78
           +PE+I++IR +R    +  R++ + QG+DPD PPEL F +RPFL LH+ EP  G     F
Sbjct: 56  TPEHIAKIRAERDAMRKAKRDAMLAQGVDPDCPPELHFIKRPFLVLHEKEPVTG---FRF 112

Query: 79  SILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFW 138
            ++TYNCLAQ LI R +FP+SG+ALKW RRS+ ++NE KYY  D++CLQEID    + FW
Sbjct: 113 KLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFKYYKADVICLQEIDHIQFQSFW 172

Query: 139 SVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIG 198
             +F  LGY  ++++   K HGV I WR  +F+  D+  +D+D+  + +I  RT T N+G
Sbjct: 173 KDEFNKLGYDGQYYRNSTKNHGVAIMWRREMFQQVDKMLIDYDKETSENISTRTTTNNVG 232

Query: 199 LIVALQFLD---NNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFL 255
           L++AL+F +   +N +  S +  GI++ TTHLFWHPFGT+ERTRQCY++L +M +F+  +
Sbjct: 233 LVLALKFSEKVLSNLSKSSSKKCGILIGTTHLFWHPFGTYERTRQCYVVLKKMKEFMHRV 292

Query: 256 N----EHSG-ITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKK 310
           N    E+ G +++W+PF  GDFNSQP D PY+SMT+KP+ Y +  +TVIECSTS+ +SK 
Sbjct: 293 NVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKNRAKTVIECSTSFKFSKA 352

Query: 311 RNGDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAIS 370
           R+GD   +            + K QP  P P  +   +EQ  LV+ + QLHNSL  RAIS
Sbjct: 353 RDGDESADDEEGGNIEK---YGKDQPESPVPENYHANEEQIELVDKMAQLHNSLDMRAIS 409

Query: 371 LYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETF 430
           LYSVGYRNVHPEN+ ++N RGEPE S+W   W GLLDY+FY+K W+L+    +VE L  F
Sbjct: 410 LYSVGYRNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDLRSNCQEVENLGDF 469

Query: 431 EKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
           EK N +K  GFL++P  KEM  H QP+ GEY SDHL+++C L+L
Sbjct: 470 EKVNEMKCRGFLRMPPGKEMTKHGQPHVGEYASDHLSMVCDLEL 513

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  475 bits (1222), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 222/464 (47%), Positives = 312/464 (67%), Gaps = 14/464 (3%)

Query: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEF 78
           +PE+I+++R +R    +  R+S + QG+DPD PPEL F +RPFL+LH+ EP  G     F
Sbjct: 56  TPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTG---FRF 112

Query: 79  SILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFW 138
            ++TYNCLAQ LI R +FP+SG+ALKW RRS+ ++NE ++YN D++CLQEID    + FW
Sbjct: 113 KLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFW 172

Query: 139 SVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIG 198
             +F  LGY  ++ +   K HGV I WR  +F+  D+  +DFD+ ++G+IP RT T N+G
Sbjct: 173 KEEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVG 232

Query: 199 LIVALQFLD---NNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFL 255
           L++AL+F +   +N    S +  GI++ T+HLFWHPFGT+ERTRQCY++L +M +F+  +
Sbjct: 233 LVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRV 292

Query: 256 N----EHSG-ITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKK 310
           N    E+ G +++W+PF  GDFNSQP D PY+SMT KP+ Y    +TVIECSTS+ +SK 
Sbjct: 293 NVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKV 352

Query: 311 RNGDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAIS 370
           R                   F K QP  P P  F   +EQ  LV+ + QLHNSL  RA+S
Sbjct: 353 R---DGEEGADEEEGGNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVS 409

Query: 371 LYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETF 430
           LYSV Y+NVHPEN+ ++N RGEPE S+W   W GLLDY+FYIK W+L+    +V++L+ F
Sbjct: 410 LYSVAYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDF 469

Query: 431 EKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
           EK N +K  GFL++P   EM  H QP+ GEY SDHL+++C ++L
Sbjct: 470 EKDNEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIEL 513

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  470 bits (1210), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 225/463 (48%), Positives = 312/463 (67%), Gaps = 14/463 (3%)

Query: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEF 78
           SPE I   R +RA   ++ R+  + +GLDPD PPELQF +RP L LH +EP  G     F
Sbjct: 46  SPEEIERKRAERAAAKEQKRKELLAKGLDPDYPPELQFIKRPMLHLHQDEPVTG---FNF 102

Query: 79  SILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFW 138
           +++TYNCLAQ LI R +FP+SG A+KW RRSK ++ E ++YN D++CLQEID    + FW
Sbjct: 103 TLMTYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFW 162

Query: 139 SVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIG 198
            V+F+ LGY  +F +   K HGV I W+  +FK  D+  +DFD+  + DIPPRT+T N G
Sbjct: 163 KVEFEKLGYESQFHRIASKNHGVAIVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTG 222

Query: 199 LIVALQFLDN--NNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLN 256
           LI++L+F D   +    + ++ GI++ TTHLFWHPFGT+ERTRQCY++L++M +F+  +N
Sbjct: 223 LILSLKFSDKILSTLPKNTKTTGIIIGTTHLFWHPFGTYERTRQCYVLLNKMKEFMHRVN 282

Query: 257 -----EHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKR 311
                    +++W PF  GDFNSQP D+PY+SMT+KPI+Y +  +TVI+CSTSY +SK R
Sbjct: 283 VLQNGNDGDLSHWVPFFCGDFNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLR 342

Query: 312 NGDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISL 371
           NG+ DV+            F K QP  P P  F   +EQ ALV  +  +HN L  RA SL
Sbjct: 343 NGEEDVD---DEEGGNIEKFGKDQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSL 399

Query: 372 YSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETFE 431
           YSVGY++VH EN+ I+NTRGEP  S+W   W GLLDYIF++  W+  D    V++LE FE
Sbjct: 400 YSVGYKHVHAENAGIDNTRGEPIISNWANTWRGLLDYIFHVNTWDF-DNRQAVDSLEKFE 458

Query: 432 KTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
             N++++ GFL++PL  EM  H QP+EGEY SDHL+++C ++L
Sbjct: 459 IENSIRLRGFLRMPLDSEMPKHGQPHEGEYASDHLSMICNIEL 501

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  470 bits (1209), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 228/463 (49%), Positives = 308/463 (66%), Gaps = 15/463 (3%)

Query: 20  PEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEFS 79
           PE+I+++R +R    +  +E+ + QGLDPD+PPELQF RRP L L   E   G    EF 
Sbjct: 54  PEHIAKVRAEREAMRKSKQEAMLAQGLDPDLPPELQFIRRPLLALSKAESTAG---FEFK 110

Query: 80  ILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWS 139
           I+TYNCLAQ LI R +FP+SG A+KW RRSK ++NE KYY+ D++CLQE+D    + FW 
Sbjct: 111 IMTYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLNEFKYYDSDVICLQEVDRIQFQTFWK 170

Query: 140 VQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIGL 199
            +F  LGY  +F  K  K HG+ I W+ S+F   D+  +D+D+ ++G+IPPRT T N+GL
Sbjct: 171 EEFDKLGYDSQFHAKPSKNHGISILWKRSLFTMTDKMLIDYDKEISGNIPPRTTTNNVGL 230

Query: 200 IVALQFLDNNNNN-PSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLNEH 258
           ++AL+F        P+    GI+V TTHLFWHPFGT+ERTRQCY++L++  +F+  +N  
Sbjct: 231 VLALKFSPKVLERFPNTRKSGIIVGTTHLFWHPFGTYERTRQCYIVLNKTKEFMHRVNVL 290

Query: 259 SGITN-----WYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRNG 313
               +     WY F  GDFNSQP D PY+SMT+KP++Y +  +TVIECSTSYT+SK R  
Sbjct: 291 QNNNDEIKDHWYTFFGGDFNSQPFDTPYLSMTSKPVKYSNRAKTVIECSTSYTFSKSR-- 348

Query: 314 DMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISLYS 373
                            F K QP  P P+FF  + EQ +LV  +++LHNSL  RAISLYS
Sbjct: 349 -DGEEDAEDEEGGNIEKFGKDQPATPVPSFFDASSEQQSLVANMEKLHNSLDMRAISLYS 407

Query: 374 VGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETFEKT 433
           VGY  VH EN+ ++NTRGEPE S+W   W+GLLDY+F IK+W+  DK   V++L+ FE  
Sbjct: 408 VGYGTVHIENAGLDNTRGEPEISNWAHAWNGLLDYLFVIKSWDFSDK-IQVDSLKKFEDE 466

Query: 434 NTLKILGFLKLPLRKEMAH--HSQPYEGEYPSDHLALMCKLQL 474
           N LK+  FLK+P + EM    H QP+ GEYPSDHL+++CKL+L
Sbjct: 467 NELKVKAFLKMPTKAEMGKFGHGQPHVGEYPSDHLSMICKLEL 509

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  469 bits (1207), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 231/462 (50%), Positives = 312/462 (67%), Gaps = 14/462 (3%)

Query: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEF 78
           SPE+I+E R QR       RE+ +  GLDP++PP+LQF +RP L LH+ EP  G    +F
Sbjct: 50  SPEHIAEKRAQREAARAAKREAMLAHGLDPNVPPDLQFIKRPLLCLHEEEPVKG---FKF 106

Query: 79  SILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFW 138
            I+TYN LAQ LI R +FP SGNA+KW +RSK ++NE K+Y+ D+ CLQEID    + FW
Sbjct: 107 KIMTYNALAQALIRRKLFPSSGNAVKWFKRSKVLLNEFKHYDADVHCLQEIDHIQYQAFW 166

Query: 139 SVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIG 198
             +F+ LGY+ +F +   K HGV I WR S+F   D   VD+D+  +GDIPPRT T+N G
Sbjct: 167 KEEFQKLGYASQFHRIGTKNHGVAIVWRCSLFTMVDTMLVDYDKEPSGDIPPRTTTKNAG 226

Query: 199 LIVALQFLDNNNNN-PSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFL-- 255
           LI+AL+F D   N  P  +  GI++ TTHLFWHPFGTFERTRQCY++L++M + +  +  
Sbjct: 227 LILALKFTDKVLNQFPGTKKSGILIGTTHLFWHPFGTFERTRQCYVVLNKMKELIHRVNV 286

Query: 256 ---NEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRN 312
              N+    ++WYPF+ GDFNSQP D PY+SMT+KP+ Y    +TVIECSTS+T+SK R+
Sbjct: 287 LQNNQDRDYSHWYPFICGDFNSQPFDTPYLSMTSKPVTYRGRAKTVIECSTSFTFSKLRD 346

Query: 313 GDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISLY 372
                             F K QP  P P  F  T+EQ ALV  ++ LHNSL  RAISLY
Sbjct: 347 ----GEEGEDEEGGNIEKFGKGQPEHPVPKEFHATEEQTALVKQMESLHNSLDMRAISLY 402

Query: 373 SVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETFEK 432
           +VGY++VHPEN+ ++N  GEPE S+W   W GLLDYIF++K WN  D++  V+ ++ FE+
Sbjct: 403 AVGYKHVHPENAGLDNDSGEPEISNWAETWRGLLDYIFFVKNWNGTDRS-SVDKIDVFER 461

Query: 433 TNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
            N +KI G L++P  +EM  H QP+EGEYPSDHL++MC+++L
Sbjct: 462 ENGIKIRGLLRMPPGEEMTKHGQPHEGEYPSDHLSMMCEIEL 503

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  466 bits (1200), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 220/464 (47%), Positives = 307/464 (66%), Gaps = 14/464 (3%)

Query: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEF 78
           +PE+I+++R +R    +  R++ +  G+DPD PPEL F +RP L+L + EP  G     F
Sbjct: 55  TPEHIAKVRAEREAMRKAKRDAMLAHGVDPDCPPELHFIQRPLLSLGEGEPVTG---FRF 111

Query: 79  SILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFW 138
            ++TYNCLAQ LI R +FP+SG+ALKW RRSK ++NE KYYN D++CLQE+D    + FW
Sbjct: 112 KLMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFW 171

Query: 139 SVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIG 198
             +F  +GY  ++ +   K HGV I WR S+F+  D+  +D+D+  +G I  RT T N+G
Sbjct: 172 KGKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVG 231

Query: 199 LIVALQF---LDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFL 255
           L++AL+F   + +     S +  GI++ TTHLFWHPFGT+ERTRQCY++L +M +F+  +
Sbjct: 232 LVLALKFSKEVLSKLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRV 291

Query: 256 N-----EHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKK 310
           N         +++W+PF  GDFNSQP D PY+SMT+KP+ Y    +TVIECSTS+ +SK 
Sbjct: 292 NVLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKV 351

Query: 311 RNGDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAIS 370
           R+G+   +            F K QP  P P  F    EQ  +V+ + QLHNSL  RAIS
Sbjct: 352 RDGEEGADDEEGGNIEK---FGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAIS 408

Query: 371 LYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETF 430
           LYSVGY++VHPEN+ ++N RGEPE S+W   W GLLDY+FYIK W+L+    +VE L  F
Sbjct: 409 LYSVGYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDF 468

Query: 431 EKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
           EK N +K  GFL++P   EM  H QP+ GEYPSDHL+++C L+L
Sbjct: 469 EKKNEIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLEL 512

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  466 bits (1200), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 224/446 (50%), Positives = 305/446 (68%), Gaps = 23/446 (5%)

Query: 42  MQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEFSILTYNCLAQGLIMRDMFPESGN 101
           +  GLDPD PPELQF RRP LTLHD+EP   E    F+++TYNCLAQ LI R +FP+SG 
Sbjct: 92  LANGLDPDCPPELQFIRRPLLTLHDDEP---EKSFTFTLMTYNCLAQALIRRKLFPDSGE 148

Query: 102 ALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWSVQFKSLGYSFKFFKKEKKIHGV 161
           A+KW RRS+ ++NE KYYNPD++CLQEID    + FW  +FK +GY+ +F +   K HGV
Sbjct: 149 AVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGV 208

Query: 162 VIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIGLIVALQFLDN--------NNNNP 213
            I W++++F+  D+  +DFD+ L+GDI PRTKT N GLI++L++ D+         NNN 
Sbjct: 209 AIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNK 268

Query: 214 SRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFL-----NEHSGITNWYPFL 268
           S    GI++ TTHLFWHPFGT+ERTRQC+++L+++ +F   +     N    + +W  F 
Sbjct: 269 S----GIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFF 324

Query: 269 TGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRNGDMDVNXXXXXXXXXX 328
            GDFNSQP D PY+S+T+KP++Y +  + VIECSTSYTYSK RN   D +          
Sbjct: 325 CGDFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRN--GDDDEAEDEEGGNI 382

Query: 329 XXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISLYSVGYRNVHPENSFINN 388
             F K QP  P P  + PT EQA LV+ ++ LHNSL  +A SLY+VGY+ VHPENS ++N
Sbjct: 383 EKFGKDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDN 442

Query: 389 TRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETFEKTNTLKILGFLKLPLRK 448
            +GEPE S+W   W GLLDYIFY+  W+  D   +VE  E FEK N +K+ G+L++P   
Sbjct: 443 KKGEPEISNWAHSWRGLLDYIFYVDHWDFSDCK-EVEDFEKFEKKNHMKLRGYLRMPPAT 501

Query: 449 EMAHHSQPYEGEYPSDHLALMCKLQL 474
           EM+ + QP++GEYPSDHL++MCK++L
Sbjct: 502 EMSKYGQPHQGEYPSDHLSMMCKIEL 527

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  464 bits (1193), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 230/469 (49%), Positives = 311/469 (66%), Gaps = 21/469 (4%)

Query: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGES-KHE 77
           S E I+ IR +R  K    RE+   QG   DIP EL+F  RP L++H +     E  +  
Sbjct: 22  SEEEIARIRAERKAK----REAAALQGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLP 77

Query: 78  FSILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEF 137
            +++TYNCLAQ LI R +FP+SG ALKW RRS+ ++N+ K+Y PD++CLQE+D      F
Sbjct: 78  VTLMTYNCLAQALIRRKLFPDSGPALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSF 137

Query: 138 WSVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNI 197
           W  +F+ LGY+ +F KK+ K HGV + WR  +F   D+  +DFD+  +GD+PPRT T N 
Sbjct: 138 WRGEFEKLGYAAQFHKKQTKNHGVAVVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNA 197

Query: 198 GLIVALQF----LDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLS 253
           GL++AL+F    L  + + P     GI+V TTHLFWHPFGTFERTRQCY++L++M +F+ 
Sbjct: 198 GLVIALKFTEQALTGHRDTPRS---GILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMH 254

Query: 254 FL----NEHSGIT-NWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYS 308
            +    NE+ G   +W+PF  GDFNSQP DAPY+SMT+KP+ Y    RTVIECSTSYT+S
Sbjct: 255 RVNVLQNENDGNNQHWFPFFCGDFNSQPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFS 314

Query: 309 KKRNGDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRA 368
           K+R+   D              F K QP  P PA F+P  EQ ALV+ ++ LHNSL  RA
Sbjct: 315 KQRD-GEDAAADEEEEGGNIEIFGKDQPHHPVPATFEPNAEQCALVHQMETLHNSLDMRA 373

Query: 369 ISLYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLE 428
           +SLYSVGYRNVHPEN+  +N RGEPE S+W   W+GLLDY+FY+  W+ KD+   V+TLE
Sbjct: 374 VSLYSVGYRNVHPENAGADNARGEPEISNWAHTWNGLLDYLFYVGHWDFKDRT-GVDTLE 432

Query: 429 TFEKTNTLKILGFLKLPLRKEMAH--HSQPYEGEYPSDHLALMCKLQLT 475
            FE+ + + +   L++P ++EM    H QP+ GEYPSDHLA++C L+L 
Sbjct: 433 EFEQDSGVTVKRLLRMPSKQEMQQFGHGQPHTGEYPSDHLAMVCDLELA 481

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  463 bits (1192), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 223/462 (48%), Positives = 302/462 (65%), Gaps = 14/462 (3%)

Query: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEF 78
           SPE+I+E+R QR    ++ RE  + +GLDPD PP+LQF  RP L+L+ +E  NG     F
Sbjct: 40  SPEHIAEVRAQREAAKKKKREDMIARGLDPDFPPDLQFIHRPMLSLNPSENANG---FVF 96

Query: 79  SILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFW 138
            ++TYNCLAQ LI R +FP SGNALKW +RS+ ++NE  +YN D++CLQE+D+   + FW
Sbjct: 97  KLMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFW 156

Query: 139 SVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIG 198
             +F+ LGY  +F +   K HG+ I W+  +F   D+  +D+D+  +G + PRT T+N+G
Sbjct: 157 KEEFEKLGYESQFHRHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVG 216

Query: 199 LIVALQFLDNN-NNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLN- 256
           L +AL F        P     GI+V TTHLFWHPFGTFERTRQCY+ML++M +F+  +N 
Sbjct: 217 LAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINV 276

Query: 257 -EHSGITN---WYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRN 312
            +  G T    WYPF  GDFNSQP D PY+S+++KP+ Y    +TVIECSTSYT+SK R+
Sbjct: 277 LQDKGATQENLWYPFFCGDFNSQPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARD 336

Query: 313 GDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISLY 372
           G+                F   QP  P P  F  T+EQ  LV ++  LHNSL  R IS+Y
Sbjct: 337 GE----ECDDEEGGNIEKFGDGQPEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIY 392

Query: 373 SVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETFEK 432
           SVGY++VH EN+ ++N   EPE S+W   W GLLDYIF+IK W+  DK    E LE F+ 
Sbjct: 393 SVGYKHVHAENAGLDNNFNEPEISNWAETWRGLLDYIFFIKKWDFSDKASP-EELEAFQD 451

Query: 433 TNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
            N +KI G L++P  KEM +H QP+EGEY SDHL++MC+L+L
Sbjct: 452 ENGIKIRGLLRMPPAKEMPNHGQPHEGEYGSDHLSMMCELEL 493

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  461 bits (1186), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 228/465 (49%), Positives = 306/465 (65%), Gaps = 17/465 (3%)

Query: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEF 78
           SPE+I+++R +R       +E+ M QG+DPD PPELQF +RP L LH  E   G    +F
Sbjct: 40  SPEHIAKVRAEREAARAAKKEAMMAQGIDPDFPPELQFIKRPILPLHKGENVEG---FKF 96

Query: 79  SILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFW 138
            ++TYNCLAQ LI R +FP SG+ALKW RRSK ++NE KYYN D++CLQEID+   + FW
Sbjct: 97  KLMTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFW 156

Query: 139 SVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIG 198
             +   LGY  +F ++  K HGV I W+   F   D+  +DFD   +GDIPPRT T N G
Sbjct: 157 KDELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAG 216

Query: 199 LIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLN-- 256
           LI++L+F D      + +  GI+V TTHLFWHPFGTFERTRQCY++L+++ +F   +N  
Sbjct: 217 LILSLKFSDKVAQEHNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVL 276

Query: 257 ------EHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKK 310
                 +HS   +WYPF  GDFNSQP D+PY+SMT KPI+Y    +TVIECSTSYT+SK 
Sbjct: 277 QNGNDGDHS---HWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKM 333

Query: 311 RNGDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAIS 370
           R+   + +            F   QP  P P  ++    +  LV  +Q LHNSL  RA+S
Sbjct: 334 RD--GEEDDAEEEEGGNIEKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVS 391

Query: 371 LYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETF 430
           LYSV YR VHPEN+ ++N RGEPE S+W   W GLLDY+F+I+ W+  D   ++++LE+F
Sbjct: 392 LYSVAYRKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDFSDCK-EIDSLESF 450

Query: 431 EKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQLT 475
           E+ N+LKI G L++P  KEM  H QP+ GEYPSDHL ++C+L+L 
Sbjct: 451 ERENSLKIRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELELV 495

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  460 bits (1183), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 223/462 (48%), Positives = 301/462 (65%), Gaps = 15/462 (3%)

Query: 21  EYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEFSI 80
           E I+ IR +R    +  R+  +++G+DPD PPELQF RR  L LH+ EP  G    +  I
Sbjct: 38  EEIARIRAEREAMREAKRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEG---LKIKI 94

Query: 81  LTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWSV 140
           ++YNCLAQ LI R +FP+SG ALKW RRS+ ++NE K+Y+PD++CLQEID+   + FW  
Sbjct: 95  MSYNCLAQALIRRKLFPDSGEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKE 154

Query: 141 QFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIGLI 200
           +F+ LGYS +F +K  K HGV I W+   F+  D+  +DFD   +GDI PRT T N  LI
Sbjct: 155 EFQKLGYSSQFHRKPSKNHGVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALI 214

Query: 201 VALQFLDNNNNNPSR---ESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFL-- 255
           +AL+F         +   +  GI+V TTHLFWHPFGT+ERTRQCY++L++M +F+  +  
Sbjct: 215 LALKFTQKVKMMGKKLLDDKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNV 274

Query: 256 ---NEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRN 312
              N    +++WYPF  GDFNSQP D+PY+SMT KPI+Y    +TVIECSTS+ +SKKR 
Sbjct: 275 LQNNNDGDMSHWYPFFCGDFNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRE 334

Query: 313 GDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISLY 372
              D              F K QP  P P  F    EQ  LV+ +++LHNSL  RA+SLY
Sbjct: 335 SGEDAE---DEEGGNIEKFGKDQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLY 391

Query: 373 SVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETFEK 432
           SV Y  VHPENS ++N RGEPE S+W   W GLLDY+F I+ W   D+  +++TLE FE 
Sbjct: 392 SVAYHKVHPENSGLDNERGEPEISNWAHTWRGLLDYMFMIRNWEFDDRT-EIDTLEDFEN 450

Query: 433 TNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
           +N +KI G L++P   EM+ H QP+ GEYPSDHL L+ +++L
Sbjct: 451 SNNIKIRGLLRMPPGSEMSTHGQPHVGEYPSDHLCLLSEVEL 492

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score =  461 bits (1186), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 231/465 (49%), Positives = 306/465 (65%), Gaps = 24/465 (5%)

Query: 21  EYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEFSI 80
           E I++IR +R  K    +E+ + QGLDP+  P+LQF +RP L LH+ EP  G    + SI
Sbjct: 104 EEIAKIRAERQAK----KEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTG---FKISI 156

Query: 81  LTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWSV 140
           +TYNCLAQ LI R +FP+SG+ALKW +RSK + NE K+YNPD++CLQEID    + FW  
Sbjct: 157 MTYNCLAQALIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKA 216

Query: 141 QFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIGLI 200
           +F+ +GY  +F +K+ K HGV I WR  +F   D+  +DFD+  +G+IPPRT T N GL 
Sbjct: 217 EFEKVGYESQFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLA 276

Query: 201 VALQF----LDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFL- 255
           ++L+F    L   +N  SR   GI+V TTHLFWHPFGT+ERTRQCY++L++M +F+  + 
Sbjct: 277 LSLKFTEKALSKFSNGTSR--MGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRIN 334

Query: 256 ----NEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKR 311
               N     ++WYPF  GDFNSQP D PY+SMT+KPI Y    +TVIECSTSY +SKKR
Sbjct: 335 VLQNNNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKR 394

Query: 312 NGDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISL 371
                              F K QP  P P  F   +EQ  LV  ++ LHNSL  RAISL
Sbjct: 395 ---DGEEDADEEEGGNIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISL 451

Query: 372 YSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETFE 431
           Y VGYR VHPEN+ ++N  GEPE S+W   W+GLLDYI +IK W   D    V+TLE FE
Sbjct: 452 YGVGYRKVHPENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGF-DDCQHVDTLEKFE 510

Query: 432 KTNTLKILGFLKLPLRKEMAH--HSQPYEGEYPSDHLALMCKLQL 474
           K N++K+ G+L++P   EM+   H QP+ GEYPSDHL+++C+L+L
Sbjct: 511 KENSIKVRGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELEL 555

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  452 bits (1163), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 219/464 (47%), Positives = 305/464 (65%), Gaps = 22/464 (4%)

Query: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEF 78
           SPE I+++R +R    + ++E++ +  +   IPPELQF +RP L LH+ EP  G    +F
Sbjct: 118 SPEEIAKLRAER----KLLKEAKKEVSV---IPPELQFIKRPILYLHEEEPVQG---FKF 167

Query: 79  SILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFW 138
           S++TYNCLAQ LI R +FP+SG+ALKW RRSK ++NE  YY+PDI+CLQE+D    + FW
Sbjct: 168 SMMTYNCLAQALIRRKLFPDSGDALKWYRRSKVLLNEFTYYSPDIICLQEVDHIQYQSFW 227

Query: 139 SVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIG 198
             +F+ LGY  ++ +K  K HGV I WR S+F   D+  ++FD+  +G++PPRT T N+G
Sbjct: 228 KTEFEKLGYQSQYHRKGVKNHGVSIIWRRSLFTMTDKMLIEFDKESSGNVPPRTTTNNVG 287

Query: 199 LIVALQFLDNNN---NNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFL 255
           LI++L+F         N      GI++ TTHLFWHPFGT+ERTRQCY++L++M +F+  +
Sbjct: 288 LILSLKFTPEAKAQFKNVETTKTGIIIGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRV 347

Query: 256 -----NEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKK 310
                N    +++WYPF  GDFNSQP D+PY+SM  KP++Y    +TVIECSTSY +SKK
Sbjct: 348 NVLQNNNDRDLSHWYPFFCGDFNSQPFDSPYLSMVRKPVEYSGRAKTVIECSTSYKFSKK 407

Query: 311 RNGDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAIS 370
           R                   F   QP  P P  F    EQ  LV  +++LHNSL  RAIS
Sbjct: 408 R---DGEEDVDDEEGGNIEKFGIDQPQTPVPEEFIANGEQTILVKDMEKLHNSLNMRAIS 464

Query: 371 LYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETF 430
           LY VGY+NVHPEN+ I+N  GEPE S+W   W+GLLDY+ ++K W   D     ETL+ F
Sbjct: 465 LYGVGYKNVHPENASIDNECGEPEISNWAHTWNGLLDYLLFVKEWTFSDCT-KTETLKQF 523

Query: 431 EKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
           E++N+++I GFL++P   EM  H QP+ GEYPSDHL+++C ++L
Sbjct: 524 EESNSMRIRGFLRMPPANEMTKHGQPHVGEYPSDHLSMLCSIEL 567

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score =  445 bits (1144), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 228/464 (49%), Positives = 307/464 (66%), Gaps = 24/464 (5%)

Query: 25  EIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHE---FSIL 81
           EIRKQR     + RE ++ QG DPD P EL F +RP L L    P +G S  +   FS++
Sbjct: 21  EIRKQREIFKSKKREKKLIQGEDPDHPIELSFIKRPILYL----PHHGHSNRKGFKFSLM 76

Query: 82  TYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWSVQ 141
           TYNCLAQ +I R++F +SG ALKW RRSK ++NE+ YYNPDI+CLQEID    + FW  Q
Sbjct: 77  TYNCLAQAMIRREVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQ 136

Query: 142 FKS-LGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIGLI 200
            +S L  +  ++K++ K HGV+IAW+ SIFK  D   VDFD++   +I  RT TRNI + 
Sbjct: 137 LESNLNMNTFYYKQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMY 196

Query: 201 VALQFLDN--NNNNPS------RESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFL 252
           VAL+F D     N P+      +   G +++TTHLFWHPFGTFERTRQCY++L +M KF+
Sbjct: 197 VALKFNDEFITKNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFI 256

Query: 253 SFLNEHSGI-TNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKR 311
             LN    + T+WYPF+ GDFNS P+DAPY+SMT+KPI+Y    + VIECST+Y +SK+R
Sbjct: 257 DILNVKDHLKTHWYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRR 316

Query: 312 NGDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISL 371
           NG++  +             +  QP D  P  F PT EQA LV+ +Q LHN L  RA SL
Sbjct: 317 NGEIGDSDEEEEKK------LINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSL 370

Query: 372 YSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDV-ETLETF 430
           Y + Y+ V P N  INN RGEPEF+SW   W G+LDYI Y+  W++ +   ++ E+LE F
Sbjct: 371 YGLAYKIVDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEF 430

Query: 431 EKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
           EK N L I G LK+PL K+M  H+QP+E EYPSDH++++C++++
Sbjct: 431 EKNNQLLIKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEI 474

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  444 bits (1141), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 223/460 (48%), Positives = 296/460 (64%), Gaps = 13/460 (2%)

Query: 20  PEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEFS 79
           PE+I+E+R +R    +  RE  + +GLDP+ PP+LQF  RP L L  N    G     F 
Sbjct: 41  PEHIAEVRAKREAAKKAKREEMLARGLDPEFPPDLQFISRPMLPLDSNYSPEG---FVFK 97

Query: 80  ILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWS 139
           I+TYNCLAQ LI R +FP SGNALKW +RS+ ++NE  +Y  D+ CLQEID+   + FW 
Sbjct: 98  IMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWK 157

Query: 140 VQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIGL 199
            +F  LGY  +F +   K HG+ I W+  +F   D+  VD+D+  +G + PRT T+N+GL
Sbjct: 158 EEFGKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGL 217

Query: 200 IVALQFLDNN-NNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLN-- 256
           ++AL F     +  P     GI+V TTHLFWHPFGTFERTRQCY++L++M  F+  +N  
Sbjct: 218 VLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVL 277

Query: 257 --EHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRNGD 314
               S    WYPF  GDFN+QP D PY+SM++KP+ Y D  +TVIECSTSYT+SK R+G+
Sbjct: 278 QDGSSPEKKWYPFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARDGE 337

Query: 315 MDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISLYSV 374
                           F   QP  P P  ++   EQ  LV T+ +LHNSL  RAIS+YSV
Sbjct: 338 ----ECDDEEGGNIEKFGDGQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSV 393

Query: 375 GYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETFEKTN 434
            Y++VHPEN+  +NT  EPE S+W   W GLLDYIF+IK WN  D N   E L+TFEK N
Sbjct: 394 AYKHVHPENAGRDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTD-NKRPEELQTFEKEN 452

Query: 435 TLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
            +KIL  L++P  +EM +H QP+EGEY SDHL+LMC+++L
Sbjct: 453 DVKILSLLRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIEL 492

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score =  434 bits (1116), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 220/462 (47%), Positives = 284/462 (61%), Gaps = 24/462 (5%)

Query: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEF 78
           S E I +IR QR  K    +E+  +QG +     ++ F +RP L  + +E         F
Sbjct: 59  SAEEIEKIRAQRKAK----KEAAGKQGGE-----DVGFIKRPLLVCNGDEAKG----FVF 105

Query: 79  SILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFW 138
            ++TYNCLAQ LI R +FP SGNALKW +RSK +++EL+YYNPD++CLQEID    K FW
Sbjct: 106 RMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKSFW 165

Query: 139 SVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIG 198
               +  GY  KF +   K HG+ I WR S+F   D+  +DFDE  +G+I  RT T+N+G
Sbjct: 166 MDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDETLIDFDEEQSGEIERRTTTKNVG 225

Query: 199 LIVALQFLDN-NNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFL-- 255
           LIVAL++ D      P     GIVV T+HLFWHPFGT+ER RQCY++LS M  FL  L  
Sbjct: 226 LIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTYERARQCYIILSRMKVFLKRLRL 285

Query: 256 ---NEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRN 312
                    + W+PF  GDFNSQP DAPY+SM +KPI Y    RTVIECSTSY +S  R+
Sbjct: 286 LERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPIIYEGRARTVIECSTSYKFSSLRD 345

Query: 313 GDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISLY 372
           G                 F   QP  P P  F  T EQ ALV+ +Q LHN+L  RAISLY
Sbjct: 346 G----CAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQRALVDAMQSLHNALDMRAISLY 401

Query: 373 SVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETFEK 432
           S+ YR VHPEN+ I+N RGEPE S+W   W GLLDYI Y+  W+  D N +V+ +  F+K
Sbjct: 402 SLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMYVMPWDFSD-NTEVDDIGEFQK 460

Query: 433 TNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
             ++ +   L++P   EM  H QP+EGEYPSDHL+LMC+L+L
Sbjct: 461 NTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCELEL 502

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  424 bits (1091), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 208/465 (44%), Positives = 299/465 (64%), Gaps = 16/465 (3%)

Query: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHE- 77
           +PEYI+E+R +R       +E+ + QG+DP +P +L+F +RP L +  +   +G+S  E 
Sbjct: 57  TPEYIAEMRAKREAAKIAKKEALIAQGIDPKLPADLRFIKRPMLAVPRD--SSGQSTREV 114

Query: 78  --FSILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVK 135
              SI+TYNCLAQ LI R +FP SGNA+KW +RS+ ++NE KYYN D++CLQEID    K
Sbjct: 115 CPISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYK 174

Query: 136 EFWSVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTR 195
            FW ++F  LGY  +F     K HGV+IAW++ +F   D+  +D+D+   G I PRT T+
Sbjct: 175 SFWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTK 234

Query: 196 NIGLIVALQFLDNN-NNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSF 254
           N+G++++L+F        P  +  GI++ TTHLFWHPFGT+ERTRQCY++L ++ +F + 
Sbjct: 235 NVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNR 294

Query: 255 L----NEHSGI-TNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSK 309
           +    NE  G  ++W  F  GDFNSQP DAPY+S+T+KP++Y    +TVIECSTS+T+SK
Sbjct: 295 INVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSK 354

Query: 310 KRNGDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAI 369
            R+     +            F K QP  P P  F   +EQ  L   ++ LHN +  RAI
Sbjct: 355 LRD----GDEGEGEEGGNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAI 410

Query: 370 SLYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLET 429
           SLYS+ Y  VHPENS ++N R EPE S+W   W GLLDY++Y+ +W+  D    ++ L T
Sbjct: 411 SLYSIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCT-KIDELST 469

Query: 430 FEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
           FE+   +++L  L++P  KEM  H QP+EGEYPSDHL ++ KL +
Sbjct: 470 FEQNYGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGI 514

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  419 bits (1077), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 207/447 (46%), Positives = 285/447 (63%), Gaps = 18/447 (4%)

Query: 35  QRIRESRMQQGLDPDIPP-ELQFQRRPFLTLHDNEPDNGESKHEFSILTYNCLAQGLIMR 93
           Q   ES  QQ + P+I    L+F  RP L L   +         FS++TYNCLAQ LI R
Sbjct: 50  QAATESNDQQ-MAPNITSLNLEFIARPMLPLKVTQ--TVHKGFSFSLMTYNCLAQSLIRR 106

Query: 94  DMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWSVQFKSLGYSFKFFK 153
            +FP SG ALKWT+RS  ++ E K+YN D++CLQEID+     FW  +  +LGY  +F +
Sbjct: 107 SLFPTSGRALKWTKRSMVLLKEFKHYNADVLCLQEIDYTQYYSFWMNRLSNLGYGSRFHR 166

Query: 154 KEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIGLIVALQFLDNNNNN- 212
            + K HGV I W+  +F + DQ  ++FD   +G+I PR  T N+G+I+AL F D    + 
Sbjct: 167 MDNKSHGVAIFWKKDLFIWMDQMLINFDNEDSGEIEPRKTTNNVGMILALGFSDKVKQSF 226

Query: 213 PSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKF-----LSFLNEHSGITNWYPF 267
           P     GI+V T+HLFWHPFGT+ERTRQCY++L++M +F     LS    H+ +T WYPF
Sbjct: 227 PGTVKSGIIVGTSHLFWHPFGTYERTRQCYVILNKMKEFIHRVHLSQNEHHTDLTKWYPF 286

Query: 268 LTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRNGDMDVNXXXXXXXXX 327
             GDFNSQP DAPY+S+T+KP+ Y    +TVIECS +Y +     G    N         
Sbjct: 287 FCGDFNSQPFDAPYLSITSKPVLYSGRAKTVIECSAAYKFPDLGAGARGANEDGGTVG-- 344

Query: 328 XXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISLYSVGYRNVHPENSFIN 387
                + +P DP P  FQPT E ++LV  +++LHNSL  RAISLY+V Y++VHP+N+ ++
Sbjct: 345 -----EDRPVDPVPESFQPTAEVSSLVQKMEKLHNSLDMRAISLYAVAYKHVHPDNAGLD 399

Query: 388 NTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETFEKTNTLKILGFLKLPLR 447
           N RGEPE S+W   W GLLDYI YI  W   + N +V++LE+FEK + + +   L++P  
Sbjct: 400 NERGEPEISNWAYTWRGLLDYIMYITPWQASN-NVEVDSLESFEKLSHITVQEMLRMPPA 458

Query: 448 KEMAHHSQPYEGEYPSDHLALMCKLQL 474
           KEM+ H QP++GEYPSDHLA+MCKL++
Sbjct: 459 KEMSSHGQPHDGEYPSDHLAMMCKLEV 485

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  402 bits (1032), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 208/466 (44%), Positives = 298/466 (63%), Gaps = 20/466 (4%)

Query: 16  HDNSPEYISEIRKQRANKWQRIRESRMQQGLDPDIP-PELQFQRRPFLTLHDNEPDNGES 74
           H  + E + +IR++RA K Q  R S + QG DPD P P+LQF +RPFL LH +E   G +
Sbjct: 40  HQLTKEQVKKIREERAQKRQSRRNSLISQGKDPDFPTPDLQFIKRPFLHLH-HEIAQGST 98

Query: 75  KH-----EFSILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEI 129
           +      +  I+TYN LAQ LI R+ FP+SG+ALKW +RSK +++ELK Y PDI+ LQE+
Sbjct: 99  ESTPNSLDVKIMTYNTLAQTLIRRNFFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEV 158

Query: 130 DFKYVKEFWSVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGD-I 188
           D+  +K FW   F+ LG+   F + + K HG++IAW    F+  ++  +D+D +LAG+ I
Sbjct: 159 DYNELK-FWQENFRKLGFDLTFKRHDGKTHGLLIAWNSGKFQLENEWMLDYDNILAGNAI 217

Query: 189 PPRTKTRNIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEM 248
           P RT+T+NI LI +L+    N ++PS +  G++VA THLFWHPFG FER RQ YL+L+++
Sbjct: 218 PARTRTKNIALIASLRL--KNISDPSTD--GVIVANTHLFWHPFGVFERLRQSYLVLAKI 273

Query: 249 NKFLSFLNEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYS 308
            + +    +++G   W+  L GDFN++P++ PY+++T KP+      R + ECS +Y YS
Sbjct: 274 QE-IKACPKYNG---WHSVLMGDFNTEPEEPPYLAITRKPVALTGSARVMAECSLAYRYS 329

Query: 309 KKRNGDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRA 368
           KKRNG+                    QP +P+P  F  T EQ ALV+ +  LHNSL  R 
Sbjct: 330 KKRNGEEGGQDDEECDEQSRGEGRFNQPQNPKPKSFTATSEQKALVDQLVALHNSLHVRG 389

Query: 369 ISLYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLE 428
           +SLY +GY  V PENS  +N  GEPE S+W   W GLLDYIFYI+  +    +D    ++
Sbjct: 390 VSLYGLGYGKVQPENSHESN--GEPELSNWANSWCGLLDYIFYIEHSDEHSAHDQ-NPVD 446

Query: 429 TFEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
            FE  N L+++G+LK+P  KEM  HSQP+EGEY SDH++LMC+L+ 
Sbjct: 447 DFENKNNLRVMGYLKMPRAKEMPKHSQPFEGEYASDHVSLMCQLRF 492

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score =  397 bits (1021), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 207/469 (44%), Positives = 289/469 (61%), Gaps = 28/469 (5%)

Query: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIP-PELQFQRRPFLTL-HDNEP------- 69
           S + I +IR++RA K Q  R S + QG DPD P P+LQF  RPFL + HDN         
Sbjct: 41  SVDQIKKIREERAQKRQVRRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATI 100

Query: 70  DNGESKHEFSILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEI 129
              +   +  I+TYN LAQ LI RD FPESG ALKW +RSK +++ELK Y PD++ LQE+
Sbjct: 101 QVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEV 160

Query: 130 DFKYVKEFWSVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGD-I 188
           D+  +  FW   F  LG+   F + E K HG+++AW +  F+  +   +D+D +LAG+ I
Sbjct: 161 DYNELN-FWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVI 219

Query: 189 PPRTKTRNIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEM 248
             RT+T+NI LI++L F    +++    S GI+VA THLFWHPFG FER RQ YL+L ++
Sbjct: 220 SARTRTKNIALIISLYFKGITDSS----SRGIIVANTHLFWHPFGVFERLRQSYLVLQKI 275

Query: 249 NKFLSFLNEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYS 308
            +  +     S    W+  L GDFN++P++ PY+++T +P+     +R ++ECS +Y YS
Sbjct: 276 QEIKAC----SKYNGWHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAYRYS 331

Query: 309 KKRNGDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRA 368
           KKRNG+                    QP +P+P  F  TKE+ ALVN +  LHNSL  + 
Sbjct: 332 KKRNGEESDQDDEECDEKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNSLHVKG 391

Query: 369 ISLYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDV---E 425
           +SLY +GY  VHPEN+  N + GEP  S+W   W GLLDYIFYI+     D N D    E
Sbjct: 392 VSLYGIGYGKVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEG----DHNQDTRQKE 445

Query: 426 TLETFEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
            L  FE  N +KI+G+L++P  +EM  HSQP+EGEY SDH++LMC+++L
Sbjct: 446 PLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  390 bits (1002), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 198/449 (44%), Positives = 281/449 (62%), Gaps = 29/449 (6%)

Query: 40  SRMQQGLDPDIP-PELQFQRRPFLTLHDNEPDNG---------ESKHEFSILTYNCLAQG 89
           S + QG DPD P P+LQF  RP L +   +  N           S  +  I+TYN LAQ 
Sbjct: 62  SLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQT 121

Query: 90  LIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWSVQFKSLGYSF 149
           LI RD FP+SG+ALKW +RSK +++ELK Y PDI+ LQE+D+  +K FW   F  LG+  
Sbjct: 122 LIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDL 180

Query: 150 KFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGD-IPPRTKTRNIGLIVALQFLDN 208
            F +   K HG+++AW +  F+  ++  +D+D++LAG+ I  RT+T+NI LIV+L+F D 
Sbjct: 181 SFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDT 240

Query: 209 NNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLNEHSGITNWYPFL 268
            N +    ++GIVVA THLFWHPFG FER RQ YL+L ++ +   F   H     W+  L
Sbjct: 241 RNAS----TNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEIKDFPKYHG----WHSLL 292

Query: 269 TGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRNGDMDVNXXXXXXXXXX 328
            GDFN++P++ PY+++T+KP+      R ++ECS +Y YSKKRNG+              
Sbjct: 293 MGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGEESDQDDEDYDENSR 352

Query: 329 XXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISLYSVGYRNVHPENSFINN 388
                 QP +P+P  F  TKE+  LVN +  LHNSL  + ISLY +GY  VHPEN+  N 
Sbjct: 353 GERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPENA--NE 410

Query: 389 TRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVE---TLETFEKTNTLKILGFLKLP 445
             GEPE S+W   W GLLDYIFYI++    D N+  +   +L  FE+ N + ++G+L++P
Sbjct: 411 GHGEPELSNWANTWCGLLDYIFYIES----DDNNSAQQEKSLNVFEENNGVNVIGYLRMP 466

Query: 446 LRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
            ++EM  HSQP+EGEY SDH++LMC+++L
Sbjct: 467 CKQEMPKHSQPFEGEYASDHISLMCQIRL 495

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  382 bits (982), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 202/469 (43%), Positives = 292/469 (62%), Gaps = 33/469 (7%)

Query: 21  EYISEIRKQRANKWQRIRESRMQQGLDPDIP-PELQFQRRPFLTLHDNEPDNGE------ 73
           ++I +IR++RA + Q  R S + QG DPD P P+LQF  RPFL ++     + +      
Sbjct: 45  DHIKKIREERAQRRQSRRNSLISQGKDPDFPTPDLQFIERPFLHVYREVSQDSKTSGMQV 104

Query: 74  --SKHEFSILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDF 131
             S  +  I+TYN LAQ LI RD FP+SG+ALKW +RSK +++ELK Y PDI+ LQE+D+
Sbjct: 105 PPSSLDVQIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDY 164

Query: 132 KYVKEFWSVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGD-IPP 190
             +  FW   F  LG+   F + E K HG+++AW +  F+  ++  +D+D +LAG+ I  
Sbjct: 165 NELG-FWHENFHKLGFGSTFRRHEGKTHGLMVAWNNEKFQQDNEWMLDYDTILAGNAISA 223

Query: 191 RTKTRNIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNK 250
           RT+T+NI LIV+L   +  N + S    G++VA THLFWHPFG FER RQ +L+L ++ +
Sbjct: 224 RTRTKNIALIVSLSVKNMTNLSTS----GVIVANTHLFWHPFGVFERLRQSFLVLKKIEE 279

Query: 251 FLSFLNEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKK 310
             +    +     W+  L GDFN++P++ PYM++T +P+      R + ECS +Y YSK 
Sbjct: 280 IKTCPKYYG----WHSLLMGDFNTEPEEPPYMAITRRPLTLTGSARAMTECSLAYRYSKM 335

Query: 311 RNGDMDVNXXXXXXXXXXXXFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAIS 370
           RNG+ + +                QP +P+P +F  TKEQ  LVN +  LHNSL  + IS
Sbjct: 336 RNGE-ESDQDEECDEESTGEGQHDQPQNPKPKYFVATKEQKNLVNQLVALHNSLHVKGIS 394

Query: 371 LYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDV-----E 425
           LY + Y  VHP+NS  N+  GEPE S+W   W GLLDYIFYI      ++ND+V     E
Sbjct: 395 LYGLSYGKVHPDNSKENH--GEPELSNWANTWCGLLDYIFYI------ERNDNVSSSKDE 446

Query: 426 TLETFEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
            ++ FE  N +KI+G+L++P  +EM  HSQP+EGEY SDH++LMC+L+L
Sbjct: 447 PVKNFEDQNNVKIIGYLRMPRAEEMPKHSQPFEGEYASDHISLMCQLRL 495

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  369 bits (948), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 196/473 (41%), Positives = 293/473 (61%), Gaps = 34/473 (7%)

Query: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPD-IPPELQFQRRPFLTLHD-NEPDNGESKH 76
           +PE+IS+IRK R  K     E+      +P+ +  +  F +R  L L +  E DN     
Sbjct: 21  TPEFISKIRKLREKKRAENEEN------NPEFLNSKYDFIKRAILQLPNVEELDNSV--- 71

Query: 77  EFSILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKE 136
           +  I+TYN L+Q LI R+++P++ +A+KW  RSK ++NE+KYYN DIMC QE+D     +
Sbjct: 72  DLKIMTYNTLSQSLIRREIYPDAHDAIKWHVRSKVILNEIKYYNCDIMCFQEVDVIQWDK 131

Query: 137 FWSVQFKSLGYSFKFFK--KEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGD-IPPRTK 193
           FW  +   LGY  +F+K  +  K+HGV I WR ++F+ +D  +++FD+++AG+ I   T+
Sbjct: 132 FWLPELSKLGYEGEFYKDFRGPKVHGVAIFWRSNLFEQFDVIKINFDDIVAGNAISKTTR 191

Query: 194 TRNIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLS 253
           T N+GLIVAL+F  +N    ++   GIV+ TTHLFWHPFGTFERTRQ  ++L +  K + 
Sbjct: 192 TWNVGLIVALKFKSSN----AKFRSGIVIGTTHLFWHPFGTFERTRQLAILLKKFRKLID 247

Query: 254 FLNEHSGITN-----WYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYS 308
            LN   G  N     W P LTGDFNSQP D PY+S+T+KP+    E +TVIECST+Y +S
Sbjct: 248 NLNTECGHINEMSNRWLPILTGDFNSQPCDMPYLSITSKPVSASGEAKTVIECSTAYKFS 307

Query: 309 KKRNGDMDVNXXXXXXXXXXX-------XFIKKQPTDPRPAFFQPTKEQAALVNTIQQLH 361
           ++R+G ++ +                     +  P DPRP+ F+ T EQ  L+  ++++H
Sbjct: 308 RRRSGSINSSEEVDHNEETQSEKEVEEEEDEESNPIDPRPSHFEATSEQKDLIAKLEKVH 367

Query: 362 NSLPFRAISLYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKN 421
           NS+  +A SL+ + Y+ VH   S   N + EPE S   I W+GLLDYIF ++ WN  +K 
Sbjct: 368 NSINLKATSLFGIAYKKVH---SIGLNCKNEPELSHTSIFWTGLLDYIFILEPWNEVEKT 424

Query: 422 DDVETLETFEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
            D  +LE FEK  +L++ G LK+P  KE+  + QP++G+YPSDHL+++C L +
Sbjct: 425 -DWGSLEDFEKRMSLRVKGLLKMPEMKELPKNVQPHQGQYPSDHLSMICDLNV 476

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  366 bits (940), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 199/466 (42%), Positives = 265/466 (56%), Gaps = 28/466 (6%)

Query: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEF 78
           +P  I   R+ R  K Q++RE  + +GLDPD P E QF  RP L +     DN E     
Sbjct: 23  TPAEIEAKREARRLKKQKLREELLSRGLDPDFPAECQFIERPILLVPHG--DNYERGLPL 80

Query: 79  SILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFW 138
           SI+TYNCLAQ LI R+MFPESG ALKW  RSK +++E+K+YN DI CLQEID      FW
Sbjct: 81  SIMTYNCLAQTLIRREMFPESGPALKWFVRSKVLLHEIKHYNADICCLQEIDDVQYDLFW 140

Query: 139 SVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIG 198
           S +    GY   +F ++ K HGV+IAW++ +F+      ++FD+     I PRT+T N+G
Sbjct: 141 SEELPKFGYKTIYFHQDSKSHGVMIAWKEELFQLESHMNIEFDKEAPAGIQPRTRTNNVG 200

Query: 199 LIVALQFLD---NNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFL 255
           L+VAL F D     NN       G+++ T HLFWHPFGT++RTRQC ++     K L F 
Sbjct: 201 LLVALAFTDAFRARNNRIRTSRSGVIIGTFHLFWHPFGTYDRTRQCLVI---KKKILEFA 257

Query: 256 NEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRN--- 312
               G  ++    TGDFNSQP   PY+ +T    Q + + RT IE ST+Y YS++RN   
Sbjct: 258 GTVKG--DYCKMFTGDFNSQPNSVPYLVLTQPRAQLNTQQRTSIEASTAYRYSERRNLGK 315

Query: 313 GDMDVNXXXXXXXXXXXXFIKKQPTD----PRPAFFQPTKEQAALVNTIQQLHNSLPFRA 368
                             +   Q TD    PRP  F  T+EQ  LVN +    N +P  A
Sbjct: 316 EYSMEEEEEEEEEEEKREYEYDQGTDPWNTPRPDEFDSTEEQRQLVNNLIDRCNDVPLCA 375

Query: 369 ISLYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLE 428
            SLYS+GY  V P +   ++   EPE SSW   W+GLLDYIFY+        N    T  
Sbjct: 376 TSLYSIGYHTVDPTHIADHH---EPELSSWSTKWAGLLDYIFYV--------NQRPSTPA 424

Query: 429 TFEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
           TFE  N + I G+L++P   +M +HSQPY GEYPSDH+++MC L++
Sbjct: 425 TFETANNIAIAGYLQMPTHAQMHNHSQPYTGEYPSDHISMMCALEI 470

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  358 bits (918), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 191/467 (40%), Positives = 273/467 (58%), Gaps = 26/467 (5%)

Query: 19  SPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTL-HDNEPDNGESKHE 77
           +PEYI  IR  R  K +R +  R       D+  E+ F +RP L + +       +    
Sbjct: 13  TPEYIERIRALRREKREREKAERA------DVAREI-FIKRPLLEVPYVGGVPCRDGYVR 65

Query: 78  FSILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEF 137
             I+TYN LAQ LI R  FP++ +A+KW RRS+ +I EL+YY+ D++CLQE D     +F
Sbjct: 66  VKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKF 125

Query: 138 WSVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKF--YDQCQVDFDELLAG-DIPPRTKT 194
           W  +F  LGY   FF    K+HGV I W+ S+F+    D+  +  D+ +AG DI   T T
Sbjct: 126 WVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTPLDKLPLCLDDYVAGDDIAATTGT 185

Query: 195 RNIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSF 254
           R + L VAL+   +  + P      I+ +TTHLFWH FGTFERTRQ +++LSE+NKF+  
Sbjct: 186 RTVALAVALRLKHHKTSRP------IIFSTTHLFWHLFGTFERTRQLFVILSELNKFIKK 239

Query: 255 LNEHSGITN--WYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRN 312
           + +         Y F TGDFNSQP DAPY+S+T KP+Q     +++IECS SY YSK+RN
Sbjct: 240 VTDAHCPRGQRCYTFFTGDFNSQPCDAPYLSLTDKPVQLKGRAKSIIECSLSYRYSKRRN 299

Query: 313 GDMDVNXXXXXXXXXXXXFIKKQ---PTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAI 369
             ++ +             ++ +   P DPRP  +    EQ   V  +Q LHN +P + +
Sbjct: 300 SILEDDEDSMVREPSDQESVEDETNRPQDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGV 359

Query: 370 SLYSVGYRNVHPENS--FINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETL 427
           SLY +GY  VHPENS  +  +   EP+ S   +HWSGLLDYIF I  W+  +    +  L
Sbjct: 360 SLYGIGYHLVHPENSNKYSTSVNQEPQLSHRALHWSGLLDYIFLITEWS--ENATKISDL 417

Query: 428 ETFEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474
           +  E+   +KI G+L++PL++EM  H++P+E EYPSDHLA+MC + L
Sbjct: 418 QALERQTGIKINGYLRMPLKEEMCDHTEPHENEYPSDHLAMMCDISL 464

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 96.3 bits (238), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/245 (29%), Positives = 112/245 (45%), Gaps = 37/245 (15%)

Query: 74  SKHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYNPDIMCLQEIDFK 132
           +K  F++L+YN L Q      M+  + + AL W  R + +  ++ YY+ DI+CLQE++ K
Sbjct: 406 AKKSFTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECK 465

Query: 133 YVKEFWSVQFKSLGYSFKFFKK----------EKKIHGVVIAWRDSIFKFYDQCQVDFDE 182
             ++FW+   +  GY+  F  K           KK+ G  + +RDS FK   +  VDF  
Sbjct: 466 TYEDFWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSS 525

Query: 183 L--------LAGDIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFG 233
           +           D   R   + N+ L+V LQ L        +    +  ATTHL W P  
Sbjct: 526 VWMKHKKFQRTEDYLNRAMNKDNVALLVKLQHL--------KSGEHVWAATTHLHWDPQF 577

Query: 234 TFERTRQCYLMLSEMNKFLSFLNEHSGITNWYPF------LTGDFNSQPKDAPYMSMTTK 287
              +T Q  ++L  M K    + EHSG  N          + GDFNSQ   A Y  ++T 
Sbjct: 578 NDVKTFQVGVLLDHMEK---VIKEHSGYNNSQELKKVPVIICGDFNSQVDSAVYELLSTG 634

Query: 288 PIQYH 292
            ++ H
Sbjct: 635 SVRQH 639

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 86.7 bits (213), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 107/244 (43%), Gaps = 31/244 (12%)

Query: 75  KHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYNPDIMCLQEIDFKY 133
           K  F+IL+YN L Q      M+  + + AL W  R + +  ++  YN DI+CLQE++ K 
Sbjct: 405 KKSFTILSYNTLCQHYATPKMYRFTPSWALSWEYRREKLKEQILSYNTDIVCLQEVECKT 464

Query: 134 VKEFWSVQFKSLGYSFKFFKK----------EKKIHGVVIAWRDSIFKFYDQCQVDFDEL 183
            ++FW+   +  GYS  F  K           KK+ G    ++DS FK   +  VDF  +
Sbjct: 465 YEDFWAPLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKEAVDFSSV 524

Query: 184 --------LAGDIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGT 234
                      D   R   + N+ L+V LQ +        +    +  ATTHL W P   
Sbjct: 525 WMKHKKFQRTEDYLNRAMNKDNVALVVKLQHI--------KSGEHVWAATTHLHWDPQFN 576

Query: 235 FERTRQCYLMLSEMNKFL---SFLNEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQY 291
             +T Q  ++L  M K +   +  N    +      + GDFNSQ   A Y  + T  +  
Sbjct: 577 DVKTFQVGVLLDYMEKVIKEQNNCNNTQELKKVPVVICGDFNSQTNSAVYELLNTGNVSK 636

Query: 292 HDEM 295
           H ++
Sbjct: 637 HRDI 640

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 118/280 (42%), Gaps = 46/280 (16%)

Query: 48  PDIPPELQFQRRPFLTLH-DNEP--------------DNGESKHEFSILTYNCLAQGLIM 92
           P+IP       RPF+ L  D EP              D+  +K  F++L+YN L Q    
Sbjct: 393 PEIP---LVHDRPFVELDIDGEPKHEYESLQESSQGVDHELTKKSFTVLSYNTLCQHYAT 449

Query: 93  RDMFPESGN-ALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWSVQFKSLGYSFKF 151
             M+  + + AL W  R   + +++  Y+ DIMCLQE++ +  ++FW    +  GYS  F
Sbjct: 450 PKMYRYTPSWALSWEYRRAKLRDQILSYSCDIMCLQEVEARTFEDFWLPLLEKHGYSGSF 509

Query: 152 FKK----------EKKIHGVVIAWRDSIFKFYDQCQVDFDELL--------AGDIPPRTK 193
             K           KK+ G  + ++ + F+   + +VDF              D   R  
Sbjct: 510 HAKTRAKLLQHRDSKKVDGCCVFFKRTKFRLIKKEEVDFSSTWMKHEKFQRTEDFLNRAM 569

Query: 194 TR-NIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFL 252
            + NI L   LQ + +  +        I VATTHL W P     +T Q  ++L  +   +
Sbjct: 570 NKDNIALYFKLQHIASGEH--------IWVATTHLHWDPKFNDVKTFQVGVLLDHLQTLI 621

Query: 253 SFLNEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYH 292
              N    +      + GDFNS    A Y  +++  ++ H
Sbjct: 622 RQDNPRQDVKKAPVIICGDFNSYIDSAVYELLSSGSVKDH 661

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 108/247 (43%), Gaps = 37/247 (14%)

Query: 75  KHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYNPDIMCLQEIDFKY 133
           K  F++L+YN L Q      M+  + + AL W  R   +  ++  +  D++CLQE++ K 
Sbjct: 396 KRSFTLLSYNTLCQHYATPKMYRYTPSWALSWDYRRDKLKEQIISFQADVVCLQEVECKT 455

Query: 134 VKEFWSVQFKSLGYSFKFFKK----------EKKIHGVVIAWRDSIFKFYDQCQVDFDEL 183
            ++FW+   +  GY+  F  K           KK+ G  + +++S FK   +  VDF  +
Sbjct: 456 FEDFWAPFLQKHGYTGVFHAKTRARTMQSKDSKKVDGCCVFYKNSEFKLVFKDAVDFSSV 515

Query: 184 --------LAGDIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGT 234
                      D   R   + N+ L V LQ L  N          I V TTHL W P   
Sbjct: 516 WMKHKKFQRTEDYLNRAMNKDNVALFVKLQHLKTNEQ--------IWVTTTHLHWDPQFN 567

Query: 235 FERTRQCYLMLSEMNKFLSFLNEHSGITNWYPF------LTGDFNSQPKDAPYMSMTTKP 288
             +T Q  ++L  M K    L + +G+ N          + GDFNSQ   A Y   ++  
Sbjct: 568 DVKTFQVGVLLDYMEK---LLRDQNGVGNNQEMKKVPLVICGDFNSQLDSAVYELFSSGT 624

Query: 289 IQYHDEM 295
           ++ H ++
Sbjct: 625 VRRHKDV 631

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 107/246 (43%), Gaps = 31/246 (12%)

Query: 74  SKHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYNPDIMCLQEIDFK 132
           SK  F++L+YN L Q      M+  + + AL W  R + +  ++  Y  D++CLQE++ K
Sbjct: 460 SKRSFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLTEQILSYMTDVICLQEVEAK 519

Query: 133 YVKEFWSVQFKSLGYSFKFFKK----------EKKIHGVVIAWRDSIFKFYDQCQVDFDE 182
             +E+W+   +  GYS  F  K           KK+ G  + +R++ FK   +  VDF  
Sbjct: 520 TFEEYWAPLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCVFYRENEFKLAYKDAVDFSG 579

Query: 183 L--------LAGDIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFG 233
           +           D   R   + N+ + + LQ +        +    + + TTHL W P  
Sbjct: 580 VWQKHKKFQRTEDYLNRAMNKDNVAIYLKLQHI--------KSGESVWIVTTHLHWDPQF 631

Query: 234 TFERTRQCYLMLSEMNKFL---SFLNEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQ 290
              +T Q  +++  +   L   S              L GD NS+   A Y  ++T  +Q
Sbjct: 632 NDVKTFQVGVLMDHIENLLKEQSNAQSKQEAKKCPVILCGDLNSEIHSAVYELLSTGRVQ 691

Query: 291 YHDEMR 296
            HD+++
Sbjct: 692 AHDDIK 697

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 108/247 (43%), Gaps = 30/247 (12%)

Query: 72  GESKHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYNPDIMCLQEID 130
           G  K  F+IL+YN L Q      M+  + + AL+W  R + +  ++  Y  DI+CLQE++
Sbjct: 460 GLLKKSFTILSYNTLCQHYATPKMYRYTPSWALRWDYRREKLKEQILSYGCDILCLQEVE 519

Query: 131 FKYVKEFWSVQFKSLGYSFKFF----------KKEKKIHGVVIAWRDSIFKFYDQCQVDF 180
            K  ++FW+   +  GY+  F           K  KK+ G  + ++ S FK   +  +DF
Sbjct: 520 SKTYEDFWAPLLEKNGYTGYFHCKTRAKTMQAKDSKKVDGCCVFYKKSKFKLITKEALDF 579

Query: 181 DEL--------LAGDIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHP 231
                         D   R   + N+ + + LQ +        +    + V TTHL W P
Sbjct: 580 SGAWQKHKRFQRTEDYLNRAMNKDNVAIYMKLQHV--------QSGEYLWVVTTHLHWDP 631

Query: 232 FGTFERTRQCYLMLSEMNKFLSFLNEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQY 291
                +T Q  ++L  M   +   N    +  +   +TGDFNS    A Y   +T  ++ 
Sbjct: 632 KFNDVKTFQVGVLLDHMESIIKEENPKQDVKKFPIIITGDFNSYLTSAVYELFSTGNVKD 691

Query: 292 H--DEMR 296
           H  DE+R
Sbjct: 692 HPDDEIR 698

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 79.3 bits (194), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 108/248 (43%), Gaps = 37/248 (14%)

Query: 74  SKHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYNPDIMCLQEIDFK 132
           +K  F+I++YN L Q      M+  + + AL W  R + +  E+  Y  DI+CLQE++ K
Sbjct: 520 AKRSFTIMSYNILCQHYATPKMYRYTPSWALSWDHRRQRLTEEVMSYMTDIVCLQEVEAK 579

Query: 133 YVKEFWSVQFKSLGYSFKFFKK----------EKKIHGVVIAWRDSIFKFYDQCQVDFDE 182
             +E W+      GYS  F  K           KK+ G  + +++S FK   + +VDF  
Sbjct: 580 TYEEHWAPLMLKQGYSGVFHAKTRAKTMHSKDSKKVDGCCVFYKESEFKLQFKDEVDFSS 639

Query: 183 L--------LAGDIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFG 233
                       D   R   + N+ + + L  L        +    + +ATTHL W P  
Sbjct: 640 TWMKHKKFQRTEDYLNRAMNKDNVVIYIKLNHL--------KSGESVWIATTHLHWDPQF 691

Query: 234 TFERTRQCYLMLSEMNKFLSFLNEHSGITNWYP------FLTGDFNSQPKDAPYMSMTTK 287
              +T Q  +++  + + +    EH   ++          + GDFNSQ   A Y  ++T 
Sbjct: 692 NDVKTFQVGILMDHLEELIK---EHGSPSSRQDPKKSPVIICGDFNSQKDSAVYELLSTG 748

Query: 288 PIQYHDEM 295
            +Q H ++
Sbjct: 749 HVQSHKDI 756

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 79.0 bits (193), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 123/283 (43%), Gaps = 34/283 (12%)

Query: 37  IRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEFSILTYNCLAQGLIMRDMF 96
           +++ R    ++ D  P+ +F     + L D+       K  F++L+YN L Q      M+
Sbjct: 502 LKKDRKFITINADEEPQEEFDT---MALSDSHISTEMLKKSFTVLSYNTLCQHYATPKMY 558

Query: 97  PESGN-ALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWSVQFKSLGYSFKFFKK- 154
             + +  L W  R + + N++     D++CLQE++ +  ++FW    +  GY   F  K 
Sbjct: 559 RYTPSWVLSWDTRREQLKNQILGIQSDVICLQEVEAQTYEDFWLPLLQKRGYLGIFHAKT 618

Query: 155 ---------EKKIHGVVIAWRDSIFKFYDQCQVDFDEL--------LAGDIPPRTKTR-N 196
                     KK+ G  I +++S FK   Q  VDF  +           D   R   + N
Sbjct: 619 RAKTMQSKDSKKVDGCCIFYKESEFKLQHQESVDFSGVWMKHKKFQRTEDYLNRAMNKDN 678

Query: 197 IGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLN 256
           + L V L+ ++      S ES  + V TTHL W P     +T Q  ++L  +   L   N
Sbjct: 679 VALFVKLEHIN------SGES--VWVVTTHLHWDPQFNDVKTFQVGVLLDHLESLLKDYN 730

Query: 257 EHSG---ITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMR 296
             S    I      + GD NS  + A Y  ++T  ++ H++++
Sbjct: 731 NASSKQEIRKCPVIICGDLNSHLQSAVYELLSTGHVKVHEDIQ 773

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/247 (27%), Positives = 106/247 (42%), Gaps = 37/247 (14%)

Query: 75  KHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYNPDIMCLQEIDFKY 133
           K  F++L+YN L Q      M+    + AL W  R + + +E+  Y  DI+CLQE++ K 
Sbjct: 395 KKSFTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKDEVLAYQTDIICLQEVESKT 454

Query: 134 VKEFWSVQFKSLGYSFKFFKK----------EKKIHGVVIAWRDSIFKFYDQCQVDFDEL 183
            +EFW    +  GYS  F  K           KK+ G  I +++S F    +  +DF  +
Sbjct: 455 YEEFWLPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVFKDAIDFSSV 514

Query: 184 --------LAGDIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGT 234
                      D   R   + N+ LI+ L+          R    + V TTHL W P   
Sbjct: 515 WMKHKKFQRTEDYLNRAMNKDNVALIIKLRH--------ERTGEHVWVVTTHLHWDPHFN 566

Query: 235 FERTRQCYLMLSEMNKFLSFLNEHSGITN-----WYPF-LTGDFNSQPKDAPYMSMTTKP 288
             +T Q  +ML  + K L    +H G+ +       P  + GDFNSQ   A      T  
Sbjct: 567 DVKTFQVAVMLDYIEKLLK---QHGGVGSPQDKKKIPLVICGDFNSQLDSAVVELFNTGS 623

Query: 289 IQYHDEM 295
           ++ H ++
Sbjct: 624 VRSHKDI 630

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 106/245 (43%), Gaps = 31/245 (12%)

Query: 75  KHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYNPDIMCLQEIDFKY 133
           K  F++L+YN L Q      M+  + + AL W  R + + +++  +  D++CLQE++ K 
Sbjct: 449 KKSFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSFKSDVICLQEVESKS 508

Query: 134 VKEFWSVQFKSLGYSFKFFKK----------EKKIHGVVIAWRDSIFKFYDQCQVDFDEL 183
            +EFW    +  GY+  F+ K           KK+ G  I +++S F    +  VDF  +
Sbjct: 509 YEEFWLPLLQKNGYAGTFYAKTRAKTMQTKDSKKVDGCCIFYKESEFNVLYKDSVDFSGV 568

Query: 184 --------LAGDIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGT 234
                      D   R   + N+ L + L+ +        +    + V TTHL W P   
Sbjct: 569 WMKHKKFQRTEDYLNRAMNKDNVALYMKLEHI--------KSGESVWVVTTHLHWDPQFN 620

Query: 235 FERTRQCYLMLSEMNKFLSFLNEHSG---ITNWYPFLTGDFNSQPKDAPYMSMTTKPIQY 291
             +T Q  ++L  + + L   N  S    I      + GD NS    A Y  ++T  +Q 
Sbjct: 621 DVKTFQVGILLDHLEELLKDNNNASSKQEIRKCPVIICGDLNSHLDSAVYELLSTGHVQV 680

Query: 292 HDEMR 296
           H ++ 
Sbjct: 681 HKDIE 685

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 103/244 (42%), Gaps = 31/244 (12%)

Query: 74  SKHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYNPDIMCLQEIDFK 132
           +K  FS+L+YN L Q      M+  + + AL W  R   +  ++  Y+ D++CLQE++ K
Sbjct: 533 AKKTFSVLSYNTLCQHYATPKMYRYTPSWALTWDYRRSKLKEQILSYDSDVLCLQEVESK 592

Query: 133 YVKEFWSVQFKSLGYSFKFFKK----------EKKIHGVVIAWRDSIFKFYDQCQVDFDE 182
             +++W       GY+  F+ K           KK+ G  I ++   FK   +  +DF  
Sbjct: 593 TFEDYWVPLLDKHGYTGIFYAKARAKTMHSKDSKKVDGCCIFFKRDQFKLVTKDAMDFSG 652

Query: 183 L--------LAGDIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFG 233
                       D   R   + N+ L + LQ + + +         I V TTHL W P  
Sbjct: 653 AWMKHKKFQRTEDYLNRAMNKDNVALFLKLQHVSSGDT--------IWVVTTHLHWDPKF 704

Query: 234 TFERTRQCYLMLSEMNKFL---SFLNEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQ 290
              +T Q  ++L  +   L   +  N    I      + GDFNS    A Y  ++T  +Q
Sbjct: 705 NDVKTFQVGVLLDHLESLLKEDTTHNSRQDIKKSPVLICGDFNSYINSAVYELISTGRVQ 764

Query: 291 YHDE 294
            H E
Sbjct: 765 VHQE 768

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 104/244 (42%), Gaps = 31/244 (12%)

Query: 74  SKHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYNPDIMCLQEIDFK 132
           +K  F++L+YN L Q      M+  + + AL W  R   +  ++  Y+ D++CLQE++ K
Sbjct: 495 AKRSFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYSSDVLCLQEVESK 554

Query: 133 YVKEFWSVQFKSLGYSFKFFKK----------EKKIHGVVIAWRDSIFKFYDQCQVDFDE 182
             +++W    +  GY+  F  K           KK+ G  I ++   FK  ++  +DF  
Sbjct: 555 TFEDYWVPLLEKHGYTGVFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKMVNRDSMDFSG 614

Query: 183 L--------LAGDIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFG 233
                       D   R   + N+ L + LQ + + +         I V TTHL W P  
Sbjct: 615 AWMKHKKFQRTEDYLNRAMNKDNVALFLKLQHVSSGDT--------IWVVTTHLHWDPKF 666

Query: 234 TFERTRQCYLMLSEMNKFL---SFLNEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQ 290
              +T Q  ++L  +   L   +  N    I      + GDFNS    A Y  ++T  +Q
Sbjct: 667 NDVKTFQVGVLLDHLETLLKEDTTHNSRQDIKKSPVLICGDFNSYINSAVYELISTGRVQ 726

Query: 291 YHDE 294
            H E
Sbjct: 727 AHQE 730

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 106/243 (43%), Gaps = 30/243 (12%)

Query: 75  KHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYNPDIMCLQEIDFKY 133
           K  F++L+YN L Q      M+  + + AL W  R + +  ++  +N DI+CLQE++ K 
Sbjct: 535 KKSFTMLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILNFNTDIICLQEVEAKT 594

Query: 134 VKEFWSVQFKSLGYSFKFFKK----------EKKIHGVVIAWRDSIFK-FYDQCQVDFDE 182
            ++FW    +  GY+  F  K           KK+ G    ++ S FK  + +C VDF  
Sbjct: 595 FEDFWQPLLEKHGYTGLFHAKTRAKTMQSKDSKKVDGCCAFYKTSKFKMLFKEC-VDFSG 653

Query: 183 L--------LAGDIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFG 233
           L           D   R   + N+ +++ LQ +        +    + + TTHL W P  
Sbjct: 654 LWMKHKKFQRTEDYLNRAMNKDNVAIVMKLQHI--------QSGEIMWLVTTHLHWDPKF 705

Query: 234 TFERTRQCYLMLSEMNKFLSFLNEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHD 293
              +T Q  ++L  M   L   N    +  +   + GD NS    + Y   +T  +Q+H 
Sbjct: 706 NDVKTFQVGVLLDHMETLLKEQNPKQDVKKYPLVICGDLNSYLSSSVYELFSTGRVQHHH 765

Query: 294 EMR 296
           + +
Sbjct: 766 DGK 768

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 104/247 (42%), Gaps = 37/247 (14%)

Query: 75  KHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYNPDIMCLQEIDFKY 133
           K  F++L+YN L Q      M+    + AL W  R + +  E+  Y  D++CLQE++ K 
Sbjct: 442 KRSFTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKEEVLSYQTDVICLQEVESKT 501

Query: 134 VKEFWSVQFKSLGYSFKF----------FKKEKKIHGVVIAWRDSIFKFYDQCQVDFDEL 183
            +EFW    +  GYS  F           K  KK+ G  I +++S F    +  +DF  +
Sbjct: 502 YEEFWLPLLEKQGYSGVFHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCIFKDAIDFSSV 561

Query: 184 --------LAGDIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGT 234
                      D   R   + NI LIV L+               + V TTHL W P   
Sbjct: 562 WMKHKKFQRTEDYLNRAMNKDNIALIVKLKH--------ELSGEHVWVVTTHLHWDPHFN 613

Query: 235 FERTRQCYLMLSEMNKFLSFLNEHSGITN-----WYPF-LTGDFNSQPKDAPYMSMTTKP 288
             +T Q  ++L  + K L    + S I N       P  + GDFNSQ   A     TT  
Sbjct: 614 DVKTFQVGVLLDYIEKLLK---QQSNIGNPQEKKKVPLIICGDFNSQSHSAVVELFTTGF 670

Query: 289 IQYHDEM 295
           ++ H ++
Sbjct: 671 VKSHKDI 677

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 103/244 (42%), Gaps = 31/244 (12%)

Query: 74  SKHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYNPDIMCLQEIDFK 132
           +K  F++L+YN L Q      M+  + + AL W  R   +  ++  Y+ D++CLQE++ K
Sbjct: 501 AKRTFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESK 560

Query: 133 YVKEFWSVQFKSLGYSFKFFKK----------EKKIHGVVIAWRDSIFKFYDQCQVDFDE 182
             +E+W       GY+  F  K           KK+ G  I ++   FK   +  +DF  
Sbjct: 561 TFEEYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDFSG 620

Query: 183 L--------LAGDIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFG 233
                       D   R   + N+ L + LQ +      PS ++  I   TTHL W P  
Sbjct: 621 AWMKHKKFQRTEDYLNRAMNKDNVALFLKLQHI------PSGDT--IWAVTTHLHWDPKF 672

Query: 234 TFERTRQCYLMLSEMNKFLSFLNEHS---GITNWYPFLTGDFNSQPKDAPYMSMTTKPIQ 290
              +T Q  ++L  +   L     H+    I  +   + GDFNS    A Y  + T  +Q
Sbjct: 673 NDVKTFQVGVLLDHLETLLKEETSHNFRQDIKKFPVLICGDFNSYINSAVYELINTGRVQ 732

Query: 291 YHDE 294
            H E
Sbjct: 733 IHQE 736

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 96/240 (40%), Gaps = 28/240 (11%)

Query: 75  KHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYNPDIMCLQEIDFKY 133
           K  F+IL+YN L Q      M+  + + AL W  R + +  ++  Y  DI+CLQE++ K 
Sbjct: 566 KKSFTILSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILSYQSDILCLQEVESKT 625

Query: 134 VKEFWSVQFKSLGYSFKFF----------KKEKKIHGVVIAWRDSIFKFYDQCQVDFDEL 183
            +EFW    +   Y   F           K+ KK+ G  I ++ S FK   +  +DF   
Sbjct: 626 FEEFWGPLLEKYDYQGVFHIKTRAKTMQTKESKKVDGCCIFFKKSKFKLLAKEAMDFSGT 685

Query: 184 --------LAGDIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGT 234
                      D   R   + N+ L + LQ +             + V TTHL W P   
Sbjct: 686 WMKHKKFQRTEDYLNRAMNKDNVALYMKLQSI--------TSGETVWVVTTHLHWDPKFN 737

Query: 235 FERTRQCYLMLSEMNKFLSFLNEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDE 294
             +T Q  ++L  M   L   N    +      + GD NS    A Y   TT  +  H +
Sbjct: 738 DVKTFQVGILLDHMETLLKEENPKQDVKKANVVICGDLNSYLDSAVYELFTTGRVVNHQD 797

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 105/247 (42%), Gaps = 37/247 (14%)

Query: 75  KHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYNPDIMCLQEIDFKY 133
           K  F++L+YN L Q      M+  + + AL W  R   + +++  +  DI+CLQE++ + 
Sbjct: 561 KRSFTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRDKLKDQILSFKSDILCLQEVESRT 620

Query: 134 VKEFWSVQFKSLGYSFKFFKK----------EKKIHGVVIAWRDSIFKFYDQCQVDFDEL 183
             +FW    +  GY   F  K           KK+ G  I +++S FK   +  VDF  +
Sbjct: 621 YDDFWEPLLQKHGYKGIFHAKTRAKTMQTKDSKKVDGCCIFYKESEFKVLFKEAVDFSGI 680

Query: 184 --------LAGDIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGT 234
                      D   R   + N+ + + LQ +        +      + TTHL W P   
Sbjct: 681 WMKHKNFQRTEDYLNRAMNKDNVAIYMKLQHI--------KSGEVTWIVTTHLHWDPQFN 732

Query: 235 FERTRQCYLMLSEMNKFLSFLNEHSGITNWYP------FLTGDFNSQPKDAPYMSMTTKP 288
             +T Q  ++L  +    S L EHS I +          + GD NS    A Y  ++T  
Sbjct: 733 DVKTFQVGVLLDHLE---SLLKEHSNIHSKQDVKKCPIIICGDLNSYLDSAVYELLSTGH 789

Query: 289 IQYHDEM 295
           ++ H+++
Sbjct: 790 VEAHEDV 796

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 100/236 (42%), Gaps = 31/236 (13%)

Query: 67  NEPDNGESKHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYNPDIMC 125
           N  +N   K+ F++L+YN L        M+  + + AL W  R + +  +L  ++ D++C
Sbjct: 443 NHMNNTLLKNSFTLLSYNTLCHHYATPKMYRFTPSWALSWDYRREKLKEQLLDFDTDVIC 502

Query: 126 LQEIDFKYVKEFWSVQFKSLGYSFKFFKK----------EKKIHGVVIAWRDSIFKFYDQ 175
           LQE++    +E+W    +   YS  F  K           KK+ G  I ++   F+   Q
Sbjct: 503 LQEVETLTYEEYWVPLMEKYNYSCLFHAKTRAKTMHAKDSKKVDGCAIFYKKDQFQLVFQ 562

Query: 176 CQVDFDELLAG--------DIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIVVATTH 226
             +DF              D   R   + N+ LI  L+ L+ N N        + V TTH
Sbjct: 563 DSIDFSSAWRSHKKFHRTEDYLNRAMNKDNVALIAELKHLNTNEN--------VWVVTTH 614

Query: 227 LFWHPFGTFERTRQCYLMLSEMNKFLS---FLNEHSGITNWYPFLTGDFNSQPKDA 279
           L W P     +T Q  +ML  +   +     +N ++ I      + GDFNSQ   A
Sbjct: 615 LHWDPQFNDVKTFQVGVMLDYLETLIKQHHHVNNNNDIKKIPMVICGDFNSQLDSA 670

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 103/244 (42%), Gaps = 31/244 (12%)

Query: 74  SKHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYNPDIMCLQEIDFK 132
           +K  F++L+YN L Q      M+  + + AL W  R   +  ++  Y+ D++CLQE++ K
Sbjct: 503 AKRTFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESK 562

Query: 133 YVKEFWSVQFKSLGYSFKFFKK----------EKKIHGVVIAWRDSIFKFYDQCQVDFDE 182
             +++W       GY+  F  K           KK+ G  I ++   FK   +  +DF  
Sbjct: 563 TFEDYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKKDQFKLITKDAMDFSG 622

Query: 183 L--------LAGDIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFG 233
                       D   R   + N+ L + LQ +      PS ++  I   TTHL W P  
Sbjct: 623 AWMKHKKFQRTEDYLNRAMNKDNVALFLKLQHI------PSGDT--IWAVTTHLHWDPKF 674

Query: 234 TFERTRQCYLMLSEMNKFLSFLNEHS---GITNWYPFLTGDFNSQPKDAPYMSMTTKPIQ 290
              +T Q  ++L  +   L     H+    I      + GDFNS    A Y  ++T  +Q
Sbjct: 675 NDVKTFQVGVLLDHLETLLREETTHNFRQDIKKSPVLICGDFNSYINSAVYELISTGRVQ 734

Query: 291 YHDE 294
            + E
Sbjct: 735 INQE 738

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 102/253 (40%), Gaps = 28/253 (11%)

Query: 62  LTLHDNEPDNGESKHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYN 120
           L L D   +    K  F++L+YN L Q      M+  + + AL W  R + + +++  Y 
Sbjct: 510 LKLADANGNPDLEKKSFTLLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSYQ 569

Query: 121 PDIMCLQEIDFKYVKEFWSVQFKSLGYSFKFF----------KKEKKIHGVVIAWRDSIF 170
            DI+CLQE++ K  +EFWS   +   Y   F           K  KK+ G  I ++ S F
Sbjct: 570 SDILCLQEVESKTFEEFWSPLLEKYDYQGIFHIKTRAKTMQSKDSKKVDGCCIFFKKSKF 629

Query: 171 KFYDQCQVDFDEL--------LAGDIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIV 221
           K   +  +DF              D   R   + N+ L + LQ L             + 
Sbjct: 630 KLLFKEAMDFSGTWMKHKKFQRTEDYLNRAMNKDNVALYLKLQSL--------TSGESVW 681

Query: 222 VATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLNEHSGITNWYPFLTGDFNSQPKDAPY 281
           V TTHL W P     +T Q  ++L  M   L   N    +      + GD NS    A Y
Sbjct: 682 VVTTHLHWDPKFNDVKTFQVGILLDHMEALLKEENPKQDVKKANVVICGDLNSYFDSAVY 741

Query: 282 MSMTTKPIQYHDE 294
             ++T  +  H +
Sbjct: 742 ELLSTGRVVNHQD 754

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/267 (24%), Positives = 108/267 (40%), Gaps = 58/267 (21%)

Query: 56  FQRR--PFLTLHDNEPDNGESK---HEFSILTYNCLAQGLIMRDMFPESGNALK-WTRRS 109
           F RR  P  ++ ++ P +G  +    +F+ +TYN L+   +   ++    +  K W  R 
Sbjct: 2   FGRRFLPIKSITNSLPKSGSKRLIDDKFTFMTYNMLSPHYMWPQVYTYVPDEYKDWNYRH 61

Query: 110 KTMINE-LKYYNPDIMCLQEIDFKYVKEFW-SVQFKSLGYSFKFFKK---------EKKI 158
           K +  E L  Y  DIMCLQE+      ++W  V  +   Y  +F  K          K +
Sbjct: 62  KLLEKEILNSYRADIMCLQELTASDYHQYWEEVIDRDFHYGSRFIAKPPPQYWQKDAKDV 121

Query: 159 HGVVIAWRDSIFKFYDQCQVDFDELLA-------------------GDIPPR-------- 191
            GV I +  + F +     +  ++L+                    G   P+        
Sbjct: 122 DGVGIFYNLNKFDYISSTSIHLNDLIGSFDLDELSYLKSKQVKLTDGAGNPKGEKTLLEI 181

Query: 192 TKTRN-IGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNK 250
            K+RN +GL VAL+  D N           VV  THL+W  +   + T QC +++ ++ K
Sbjct: 182 LKSRNQVGLFVALKHKDTNTI--------FVVINTHLYW-KYDEVKLT-QCLIIMRKLAK 231

Query: 251 FLS--FLNEHSGITNWYPFL-TGDFNS 274
            +    + EH    N    +  GD NS
Sbjct: 232 IIRDLLVGEHGTTYNKMKVVFAGDLNS 258

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 99/251 (39%), Gaps = 36/251 (14%)

Query: 56  FQRRPFLTLHDNEPDNGESKHEFSILTYNCLAQGLIMRDMFPESGNALK-WTRRSKTMIN 114
           FQR+  L   +N   N  +   F++LTYN L+Q  +   ++       K W  R K +  
Sbjct: 2   FQRK--LINVNNTISNSTNLSSFTLLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEY 59

Query: 115 E-LKYYNPDIMCLQEIDFKYVKEFWSVQFKSLGYSFKFF---------KKEKKIHGVVIA 164
           E LK YN DI+CLQE+  +  + +W  +         F          K    + GV I 
Sbjct: 60  EILKLYNADIICLQELTSRDYEYYWRKKLSKFNKGSDFICKTPPKYWTKAADDLDGVGIF 119

Query: 165 WRDSIFKFYDQCQVDFDELLAGD--------------IPPRTKTRNIGLIVALQFLDNNN 210
           +   +F+  D   +   + L  D              +    + R I +   L  L+  N
Sbjct: 120 YNLDMFELIDSNGIRLSDFLISDFEQPELDYLASRKLVLTDGEGRQIKVSNILDVLEEKN 179

Query: 211 N-------NPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLNEHSGITN 263
                      R    +VV TTHL+W  +   + T QC +++ +++K +    +  G + 
Sbjct: 180 QVCLFMTLKHKRTGATVVVVTTHLYW-KYDEIKLT-QCMIIMRQLSKIMKDQLKKDGSSF 237

Query: 264 WYPFLTGDFNS 274
                 GD NS
Sbjct: 238 VKVLFAGDLNS 248

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 100/250 (40%), Gaps = 42/250 (16%)

Query: 68  EPDNGESKHEFSILTYNCLAQGLIMRDMFPESGNALK-WTRRSKTMINE-LKYYNPDIMC 125
           E  NG S+  F+ +TYN L+   +   ++       K W+ R + +  E L  Y  DIMC
Sbjct: 24  EIKNGTSRSTFTFMTYNMLSPYYMWPQVYTYVPEKYKEWSYRHRLLEREILNLYRADIMC 83

Query: 126 LQEIDFKYVKEFWSVQFKS-LGYSFKFFKKE---------KKIHGVVIAWRDSIFKFYDQ 175
           +QE+  K    FW   FKS + Y   F  K           ++ GV I +    F+    
Sbjct: 84  VQELTCKDYDGFWKGHFKSKMNYGSSFISKTPPKYWQRPPDEMDGVGIFYNLDKFEHIST 143

Query: 176 CQVDFDELLA-------------------GDIPPRTKTRNIGLIVALQFLDNNNNNPSRE 216
             +  ++L+                    G   P  K   + ++     +    +   +E
Sbjct: 144 TSIYLNDLIGLFNISELNYLKSTIITLTNGAGEPVDKDSLLNVLHGRNQVSLFVSLMHKE 203

Query: 217 SHGI-VVATTHLFWHPFGTFERTR--QCYLMLSEMNKFL-SFLNEHSGIT--NWYPFLTG 270
           +  + VV  THL+W     ++  +  QC  ++ ++++ + S L    G+T         G
Sbjct: 204 TRTLFVVINTHLYW----KYDEVKLCQCLTIMRKLHRVIKSLLMGREGVTYSKVKILFAG 259

Query: 271 DFNSQPKDAP 280
           D NS P D+P
Sbjct: 260 DLNSAP-DSP 268

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 65/277 (23%), Positives = 110/277 (39%), Gaps = 43/277 (15%)

Query: 59  RPFLTLHDNEPDNGESKHEFSILTYNCLAQGLIMRDMFPESGNALK-WTRRSKTMINEL- 116
           R F+ +  N   N  +K  F++L+YN L+   +   ++       K W  R K +  EL 
Sbjct: 4   RQFIPIGANVLKNS-AKPLFTLLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELL 62

Query: 117 KYYNPDIMCLQEIDFKYVKEFWSVQFKS-LGYSFKFFKKE---------KKIHGVVIAWR 166
             Y  DIMCLQE+  +    FW    ++ + Y   +  K          +++ GV I + 
Sbjct: 63  DKYRADIMCLQELTSEDYSNFWKKALQTNMNYGSNYIAKTPPQYWKRPVEQMDGVGIFYN 122

Query: 167 DSIFKFYDQCQVDFDELLAG---------DIPPRTKTRNIGLIVA----LQFLDNNNNNP 213
              F+F  +  +  ++LL           +  P T T   G  V     LQ L + N   
Sbjct: 123 LDKFEFISRSGIYLNQLLGVFSNNELEYLEKKPVTLTDGAGNQVGEQSLLQILKSKNQVA 182

Query: 214 ------SRESHGI-VVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLNEHSGITNWYP 266
                  +E+  + VV  THL+W       +  QC +++ E+ + +       G+ N   
Sbjct: 183 LFVSLKHKETGNVFVVINTHLYWKYDDV--KLTQCMIIMRELARIIE--KHLVGLENVTD 238

Query: 267 -----FLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTV 298
                  TGD NS   D+  ++     I  HD +  +
Sbjct: 239 DKIKILFTGDLNST-SDSLVINFLKGQIVSHDNLNVI 274

>Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119
           bp, 372 aa] {ON}
           (12595..13362,13366..13545,13548..13718) [1119 nt, 373
           aa]
          Length = 372

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 106/241 (43%), Gaps = 52/241 (21%)

Query: 76  HEFSILTYNCLAQGLIMRDMFPESGNALK-WTRRSKTMINEL-KYYNPDIMCLQEIDFKY 133
           H+F++LTYN L+   +   ++    +  K W  R   + +EL + Y  D+MCLQE+ ++ 
Sbjct: 35  HKFTLLTYNMLSPYYMWPQVYNYVPDEFKDWKYRHMLLEDELLRTYKADVMCLQELTWED 94

Query: 134 VKEFWSVQF-KSLGYSFKFFKK---------EKKIHGVVIAWRDSIFKFYDQCQVDFDEL 183
              +W   F K L Y  KF  K         E+++ G  I +    F++    ++  +++
Sbjct: 95  YLSYWKPVFGKQLNYGSKFVAKTPPKYWDKTEQQMDGEGIFFNLDKFEYISSTRLFLNDV 154

Query: 184 L---------------------AGD------IPPRTKTRN-IGLIVALQFLDNNNNNPSR 215
           +                     AG+      +    K RN + L V+L+  + NN     
Sbjct: 155 VNTFEEHELNYMKRKIVKLTDGAGNPVGEETLYEILKNRNQVCLFVSLKHKETNN----- 209

Query: 216 ESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLS--FLNEHSGITNWYPFLTGDFN 273
                VV  THL+W  +   + T QC +++ ++++ ++   +     ++    F+TGD N
Sbjct: 210 ---VFVVINTHLYWK-YDEVKLT-QCMIIMRKLSQIINELLIGADPSLSKDVIFITGDLN 264

Query: 274 S 274
           S
Sbjct: 265 S 265

>SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042W
          Length = 368

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 95/242 (39%), Gaps = 53/242 (21%)

Query: 76  HEFSILTYNCLAQGLIMRDMFPESGNALK-WTRRSKTMINEL-KYYNPDIMCLQEIDFKY 133
           ++F++LTYN L+   +   ++       K W  R + + +EL K Y  DIMCLQE+  K 
Sbjct: 28  NKFTLLTYNMLSPCYMWPQVYTYVPEKFKEWGYRHRLLEDELFKTYKADIMCLQELTTKD 87

Query: 134 VKEFWSVQFK-SLGYSFKFFKK---------EKKIHGVVIAWRDSIFKFYDQCQVDFDEL 183
              FW  Q K +L Y   F  K           ++ GV I +    F++     +  +++
Sbjct: 88  YHNFWDKQMKETLNYGSNFISKTPPKYWKRPTDEMDGVGIFYNLDKFEYISSSSIYLNDV 147

Query: 184 L---------------------AGDIPPRTKTRNI-------GLIVALQFLDNNNNNPSR 215
           L                     AG+   +    NI        L V+L+  D N      
Sbjct: 148 LGIFNVRELKYMKETMITLTNGAGEAIGKDNLMNILQGRNQVCLFVSLRHKDTNT----- 202

Query: 216 ESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFL-SFLNEHSGIT--NWYPFLTGDF 272
                VV  THL+W       +  QC  ++ ++ + + S L    G+T        +GD 
Sbjct: 203 ---VFVVINTHLYWKYDEV--KLSQCLTIMRKLERIIKSLLMGVEGVTYSKVKILFSGDL 257

Query: 273 NS 274
           NS
Sbjct: 258 NS 259

>KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90
           YOL042W
          Length = 381

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/273 (24%), Positives = 116/273 (42%), Gaps = 64/273 (23%)

Query: 75  KHE--FSILTYNCLAQGLIMRDMF---PESGNALKWTRRSKTMINEL-KYYNPDIMCLQE 128
           KH+  F++LTYN L+   +   ++   PE     +W  R   +  EL   Y  DIMC+QE
Sbjct: 34  KHDNRFTLLTYNILSPAYMWPQVYTYVPEQCK--QWEFRHDLLEQELLGKYKADIMCIQE 91

Query: 129 IDFKYVKEFWSVQFKS---LGYSF------KFFKKE-KKIHGVVIAWRDSIFKFYDQCQV 178
           +  +  ++FWS        +G  F      K++K+E  ++ GV I +   +F F     +
Sbjct: 92  MTKRDYQQFWSPIASGKCDMGSEFISKTAPKYWKREPDELDGVAIFYNRKMFDFVSSKGI 151

Query: 179 DFDELL---------------------AGDIPPRTKTRN-------IGLIVALQFLDNNN 210
             +++L                     AG+    T   N       + L V+LQ      
Sbjct: 152 YLNQMLDAFNDHELEYLGQKKLGLTDGAGNPTGETNLLNFLKLKNQVSLFVSLQ------ 205

Query: 211 NNPSRESHGI--VVATTHLFWHPFGTFERTRQCYLMLSEMNKFL-SFLNEHSGIT--NWY 265
                +S G+  VV  THL+W  +   + T QC +++ E+++ +   L +   +T     
Sbjct: 206 ----HKSTGMYFVVINTHLYWK-YDEVKLT-QCMVIMRELSQIIDDLLKDVPDVTKEKVK 259

Query: 266 PFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTV 298
              TGD NS  K++P ++     I  H ++  V
Sbjct: 260 IIFTGDLNST-KNSPVINFLRGNIISHLDLNMV 291

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 64/268 (23%), Positives = 107/268 (39%), Gaps = 59/268 (22%)

Query: 72  GESKHEFSILTYNCLAQGLIMRDMFPESGNALK-WTRRSKTMINELKY-YNPDIMCLQEI 129
           G     F++LTYN L+   +   ++    +  K W  R + + +EL Y Y  DI+CLQE+
Sbjct: 28  GPFNDRFTMLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQEL 87

Query: 130 DFKYVKEFWSVQFKS-LGYSFKFFKKE---------KKIHGVVIAWRDSIFKFYDQCQVD 179
                 EFW  Q  + + Y   F  K          + + GV I +    F++     + 
Sbjct: 88  TTNDYNEFWKKQMMNRMNYGSNFTAKTPPKYWTKPLECMDGVGIFYNLDKFEYLFSSSLY 147

Query: 180 FDELL---------------------AGDIPPR------TKTRN-IGLIVALQFLDNNNN 211
            ++L+                     AGD+          K RN + L V L+       
Sbjct: 148 LNDLVGTFDQQELHYLTHHNITLTNGAGDVIGEDSLYNVAKARNQVCLFVMLR------- 200

Query: 212 NPSRESHGIVVAT-THLFWHPFGTFERTR--QCYLMLSEMNKFL-SFLNEHSGIT--NWY 265
              RES  I+V   THL+W     ++  +  QC +++ ++ + +   L    G+T  N  
Sbjct: 201 --HRESKSIIVVINTHLYW----KYDEVKLVQCLIIMRKLQRIIKGLLMGIEGVTYSNVK 254

Query: 266 PFLTGDFNSQPKDAPYMSMTTKPIQYHD 293
              +GDFNS         +  K I++ D
Sbjct: 255 ILFSGDFNSSRDSLVIKFLNGKIIKHGD 282

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/252 (23%), Positives = 108/252 (42%), Gaps = 42/252 (16%)

Query: 68  EPDNGESKHEFSILTYNCLAQGLIMRDMFPESGNALK-WTRRSKTMINE-LKYYNPDIMC 125
           E  N  S+  F+++TYN L+   +   ++       K W+ R + +  E L  Y  DIMC
Sbjct: 20  EIRNSVSRSTFTLMTYNMLSPYYMWPQVYTYVPEKYKDWSYRHRLLEREILNLYRADIMC 79

Query: 126 LQEIDFKYVKEFWSVQFKS---LGYSF------KFFKK-EKKIHGVVIAWRDSIFKFYDQ 175
           +QE+  K  + FW   FK+    G S+      K++K+ E ++ GV I +  + F+    
Sbjct: 80  VQELTCKDYEGFWKNHFKTKMNYGSSYIAKTPPKYWKRPEDEMDGVGIFYNLNKFEHIST 139

Query: 176 CQVDFDELLA-------------------GDIPPRTKTRNIGLIVALQFLDNNNNNPSRE 216
             +  ++L+                    G   P  K   + ++     +    +   +E
Sbjct: 140 SSIYLNDLIGLFNISELNYLKSTIITLTNGAGEPIDKDSLLNVLHGRNQVSLFVSLLHKE 199

Query: 217 SHGI-VVATTHLFWHPFGTFERTR--QCYLMLSEMNKFL-SFLNEHSGIT--NWYPFLTG 270
           +  + VV  THL+W     ++  +  QC  ++ ++++ + S L    G+T         G
Sbjct: 200 TRTLFVVVNTHLYW----KYDEVKLCQCLTIMRKLHRVIKSLLMGMEGVTYSKVKILFAG 255

Query: 271 DFNSQPKDAPYM 282
           D NS P D+P +
Sbjct: 256 DLNSAP-DSPVI 266

>Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/255 (23%), Positives = 103/255 (40%), Gaps = 37/255 (14%)

Query: 78  FSILTYNCLAQGLIMRDMFPESGNALK-WTRRSKTMINEL-KYYNPDIMCLQEIDFKYVK 135
           F++LTYN L+   +   ++       K W+ R K +  EL   +  DIMCLQE+  +  +
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAERYKSWSYRHKLLEKELLNSFKADIMCLQEMTRRDYE 86

Query: 136 EFWSVQFK-SLGYSFKFFKKE---------KKIHGVVIAWRDSIFKFYDQCQVDFDELL- 184
           ++W      ++ Y  KF  K          + + GV I +    F F     +  ++LL 
Sbjct: 87  DYWHDSIGVNINYGSKFISKTPPKYWKKPLEDMDGVSIFYNLDKFDFISSSGIYLNQLLN 146

Query: 185 ------------AGDIPPRTKTRNIGLIVALQFLDNNN------NNPSRESHGI-VVATT 225
                          I     +  +G    L  L   N      +   +E+  I VV  T
Sbjct: 147 VFNERELKYLYNKRVILTDGASNVVGEDSLLDVLKGKNQVCLFVSLKHKETDTIFVVLNT 206

Query: 226 HLFWHPFGTFERTRQCYLMLSEMNKFLSFL--NEHSGITNWYPFLTGDFNSQPKDAPYMS 283
           HL+W  +   + T QC +++ E++K +  L   +  G        TGD NS  +D+  ++
Sbjct: 207 HLYW-KYDEVKLT-QCMIIMRELSKIIEQLLPGDAKGRGKVKILFTGDLNS-TRDSLVVN 263

Query: 284 MTTKPIQYHDEMRTV 298
                I  H ++  +
Sbjct: 264 FLQGQIVNHGDLNLI 278

>NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90
           YOL042W
          Length = 389

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 91/242 (37%), Gaps = 51/242 (21%)

Query: 77  EFSILTYNCLAQGLIMRDMFPESGNALK-WTRRSKTMINEL-KYYNPDIMCLQEIDFKYV 134
           +F++LTYN L+   +   ++    +  K W  R K + +EL   Y  DIMCLQE+  +  
Sbjct: 29  KFTLLTYNMLSPSYMWPQVYTYVPDPYKDWQYRHKLLESELLGSYKADIMCLQEMTSRDY 88

Query: 135 KEFWSVQFKS-LGYSFKFFKKE---------KKIHGVVIAWRDSIFKFYDQCQVDFDELL 184
            E W     S +GY  KF  K           +I GV I +    F F     +  ++ L
Sbjct: 89  NENWKRLLGSGIGYGSKFIAKSPPLYWEREVDEIDGVGIFYNLKKFDFISSSGIYLNQFL 148

Query: 185 --------------------AGDIPPRTKT--------RNIGLIVALQFLDNNNNNPSRE 216
                                  +P   K           + L V+L+            
Sbjct: 149 NVFSSTELEYLHSKRLVLTDGAGVPIGEKNLLDVISGKNQVCLFVSLKH--------KET 200

Query: 217 SHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLNEHSGITNWYPFL-TGDFNSQ 275
               VV  THL+W  +   + T QC +++ E++K +  L +          L TGD NS 
Sbjct: 201 GEMFVVINTHLYWK-YDEVKLT-QCMIIMRELSKIIDELVKGVDDPGKVKILFTGDLNST 258

Query: 276 PK 277
            K
Sbjct: 259 KK 260

>YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putative
           endonuclease, has a domain similar to a
           magnesium-dependent endonuclease motif in mRNA
           deadenylase Ccr4p; the authentic, non-tagged protein is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 363

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/255 (23%), Positives = 102/255 (40%), Gaps = 37/255 (14%)

Query: 78  FSILTYNCLAQGLIMRDMFPESGNALK-WTRRSKTMINEL-KYYNPDIMCLQEIDFKYVK 135
           F++LTYN L+   +   ++       K W+ R + +  EL   +  DIMCLQE+  +  +
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFKADIMCLQEMTARDYE 86

Query: 136 EFWSVQFK-SLGYSFKFFKKE---------KKIHGVVIAWRDSIFKFYDQCQVDFDELL- 184
           ++W       + Y  KF  K          K + GV I +  + F F     +  ++LL 
Sbjct: 87  DYWHDSIGVDVNYGSKFISKTPPKYWKKPVKDMDGVSIFYNLAKFDFISSSGIYLNQLLN 146

Query: 185 -----------AGDIPPRTKTRN-IGLIVALQFLDNNNNNP------SRESHGI-VVATT 225
                         +       N IG    L  L   N          +E+  I VV  T
Sbjct: 147 VFNQRELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLRHKETGTIFVVLNT 206

Query: 226 HLFWHPFGTFERTRQCYLMLSEMNKFLSFL--NEHSGITNWYPFLTGDFNSQPKDAPYMS 283
           HL+W  +   + T QC +++ E++K +  L   +  G        TGD NS  +D+  ++
Sbjct: 207 HLYW-KYDEVKLT-QCMIIMRELSKIIKQLLPGDVKGQERVKILFTGDLNST-RDSLVVN 263

Query: 284 MTTKPIQYHDEMRTV 298
                I  H ++  +
Sbjct: 264 FLQGQIVSHGDLNLI 278

>Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii ACR277C
          Length = 367

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 97/264 (36%), Gaps = 38/264 (14%)

Query: 67  NEPDNGESKHEFSILTYNCLAQGLIMRDMFPESGNALK-WTRRSKTMINELKY-YNPDIM 124
           N  +N  S    S+LTYN L+   +   ++    +  K W  R K +  EL Y +  DI+
Sbjct: 19  NGTNNVSSNKTLSVLTYNMLSPYYMWPQVYTYVPDKFKDWNYRHKLLEYELFYKHKADIL 78

Query: 125 CLQEIDFKYVKEFWSVQFK-SLGYSFKFFKK-EKKIHGVVIAWRDSIFKFYDQCQVDFDE 182
           CLQE+  +   +FW  Q K  L Y   F  K   K     +   D +  FY+  +++F  
Sbjct: 79  CLQELTTEDYNQFWRKQMKRRLSYGSNFISKPPPKYWTAGLQEMDGVGTFYNTEKLEFIS 138

Query: 183 ---LLAGDIPPRTKTRNIGLIVALQFLDNNNNNPSRESHG-------------------- 219
              +   D       R +  +   Q    N  N    +                      
Sbjct: 139 STVIYLNDFLSMFSKRELDWMSRRQITQTNGANDPVTTRSLLSILLDRNQVCLFVCLREK 198

Query: 220 -----IVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLN---EHSGITNWYPFLTGD 271
                IVV  THL+W       +  QC  ++ ++ + ++ L    E    +     L GD
Sbjct: 199 DTKSLIVVVNTHLYWKYDEV--KLSQCLTIMRKLKQVINKLTTTLEGVTYSQIKIILGGD 256

Query: 272 FNSQPKDAPYMSMTTKPIQYHDEM 295
            NS  +D+  +      I  H E+
Sbjct: 257 LNS-TRDSLLIKFLNGNIITHGEL 279

>NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa]
           {ON} Anc_7.90 YOL042W
          Length = 365

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/281 (20%), Positives = 106/281 (37%), Gaps = 41/281 (14%)

Query: 56  FQRR--PFLTLHDNEPDNGESKH----EFSILTYNCLAQGLIMRDMFPESGNALK-WTRR 108
           FQR+  P L   ++ P    S+     +F++L+YN L+   +   ++    +  K W  R
Sbjct: 2   FQRKFIPILRSSNSLPKIPLSRRIMNDKFTVLSYNMLSPSYMWPQVYTYVPDQYKDWNYR 61

Query: 109 SKTM-INELKYYNPDIMCLQEIDFKYVKEFWSVQF-KSLGYSFKFFKKEK---------K 157
              + +  L  Y  DIMC+QE+  +   ++W ++   ++GY  KF  K            
Sbjct: 62  HTLLELELLDKYKADIMCVQEMTKRDYIDYWQLKLGTTIGYGSKFIAKSPPKYWERHLLD 121

Query: 158 IHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTK---------TRNIGLIV----ALQ 204
           + GV I +    F F     +  +E L    P   +         T   G+ +      +
Sbjct: 122 LDGVAIFYNLQKFDFISSSGIYLNEFLDVFNPEELQYLKEKTLELTDGAGIKIDEKTLFE 181

Query: 205 FLDNNNN-------NPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLNE 257
            L   N                 ++  THL+W       +  QC +++ E++K +  L +
Sbjct: 182 ILSVKNQVSLFVCLKHKETGQVFIIINTHLYWKYDEV--KLSQCIIIMRELSKIIDELLQ 239

Query: 258 HSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTV 298
               +       GD NS  KD+  +      I  H  +  V
Sbjct: 240 DVRHSKVKIIFAGDLNST-KDSLVVKFLEGQILSHGALNMV 279

>Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 60/255 (23%), Positives = 101/255 (39%), Gaps = 37/255 (14%)

Query: 78  FSILTYNCLAQGLIMRDMFPESGNALK-WTRRSKTMINEL-KYYNPDIMCLQEIDFKYVK 135
           F++LTYN L+   +   ++       K W  R K +  EL   +  DIMCLQE+  +  +
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAERYKNWNYRHKLLEKELLTTFKADIMCLQEMTTRDYE 86

Query: 136 EFWSVQFK-SLGYSFKFFKKE---------KKIHGVVIAWRDSIFKFYDQCQVDFDELLA 185
            +W       + Y  KF  K          K + GV I +    F +     +  ++LL 
Sbjct: 87  NYWHNSIGVDINYGSKFISKTPPKYWEKPVKDMDGVSIFYNLEKFDYISSSGIYLNQLLN 146

Query: 186 GDIPPRTK-------------TRNIGLIVALQFLDNNN------NNPSRESHGI-VVATT 225
                  K             +  IG    L  L   N      +   +E++ I VV  T
Sbjct: 147 VFNERELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLKHKETNTIFVVLNT 206

Query: 226 HLFWHPFGTFERTRQCYLMLSEMNKFLSFL--NEHSGITNWYPFLTGDFNSQPKDAPYMS 283
           HL+W  +   + T QC +++ E++K +  L   + +         TGD NS  +D+  ++
Sbjct: 207 HLYW-KYDEVKLT-QCMIIMRELSKIIKQLLPGDANAQEKVKILFTGDLNS-TRDSLVVN 263

Query: 284 MTTKPIQYHDEMRTV 298
                I  H ++  V
Sbjct: 264 FLQGQIVNHGDLNLV 278

>ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL042W
           (NGL1)
          Length = 378

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 7/90 (7%)

Query: 59  RPFLTLHDNEPDNG-ESKHEFSILTYNCLAQGLIMRDMF---PESGNALKWTRRSKTMIN 114
           R  L ++      G  S+  F++LTYN L+   +   ++   PE     KW  R K +  
Sbjct: 22  RQLLPVYSGSASAGCRSERRFNLLTYNMLSPYYMWPQVYTYVPEPFK--KWEYRHKLLEY 79

Query: 115 ELKY-YNPDIMCLQEIDFKYVKEFWSVQFK 143
           EL + Y+ DI+CLQE+  K  ++FW  Q K
Sbjct: 80  ELFHKYHADILCLQELTGKDYEKFWRKQMK 109

>Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 92/232 (39%), Gaps = 46/232 (19%)

Query: 78  FSILTYNCLAQGLIMRDMFPESGNALK-WTRRSKTMINEL-KYYNPDIMCLQEIDFKYVK 135
           F++LTYN L+   +   ++       K W+ R K +  EL   +  DIMCLQE+  +  +
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHKLLERELLNTFKADIMCLQEMTARDYE 86

Query: 136 EFWSVQFK-SLGYSFKFFKKE---------KKIHGVVIAWRDSIFKFYDQCQVDFDELL- 184
           ++W       + Y  KF  K          K + GV I +    F +     +  ++LL 
Sbjct: 87  DYWRDYIGVDINYGSKFIPKTPPKYWKNPVKDMDGVSIFYNLEKFDYISSTGIYLNQLLN 146

Query: 185 -----------AGDIPPRTKTRNI-GLIVALQFLDNNN------NNPSRESHGI-VVATT 225
                         +       NI G    L  L   N      +   +E+  + VV  T
Sbjct: 147 VFNERELKYLFNKKVTLTDGASNIVGEDSLLDVLKGKNQVCLFVSLKHKETGTVFVVLNT 206

Query: 226 HLFWHPFGTFERTRQCYLMLSEMNKFLSFLNEHSGITNWYPFLTGDFNSQPK 277
           HL+W  +   + T QC +++ E++K +  L            L+GD  SQ K
Sbjct: 207 HLYWK-YDEVKLT-QCMIIMRELSKIIKQL------------LSGDVKSQRK 244

>ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 356

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 53/113 (46%), Gaps = 4/113 (3%)

Query: 72  GESKHEFSILTYNCLAQGLIMRDMFPESGNALK-WTRRSKTMINE-LKYYNPDIMCLQEI 129
           G +  + S+LTYN L+   +   ++    +  K W  R K +  E L  Y  DIMCLQE+
Sbjct: 16  GSNPAKLSVLTYNMLSPYYMWPQVYTYVPDEYKKWNYRHKLLQKEILGLYRADIMCLQEL 75

Query: 130 DFKYVKEFWS-VQFKSLGYSFKFFKK-EKKIHGVVIAWRDSIFKFYDQCQVDF 180
                +++W+ V  +   Y  K+  K   K     ++  D +  FYD  + D+
Sbjct: 76  TSLDYQQYWNKVLMEKYNYGSKYIAKPPPKYWERSLSEMDGVGVFYDLNKFDY 128

>TBLA0I03310 Chr9 (803817..805334) [1518 bp, 505 aa] {ON} Anc_3.529
           YGL219C
          Length = 505

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 6/67 (8%)

Query: 114 NELKYYNPDIMCLQEIDFKYVKEFWSVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFY 173
           N+ ++  P+I C    D   +  F  +QFKS+   F       K  GV I + D I  F 
Sbjct: 102 NQPEFIQPEINCNDSFDLPIIMNFKRIQFKSIMNCF------VKQSGVGITFNDVILDFQ 155

Query: 174 DQCQVDF 180
             C + F
Sbjct: 156 FDCSIKF 162

>TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90
           YOL042W
          Length = 391

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 3/81 (3%)

Query: 77  EFSILTYNCLAQGLIMRDMFPESGNALK-WTRRSKTMINEL-KYYNPDIMCLQEIDFKYV 134
           +F++LTYN L+   +   ++    +  K W  R K +  EL + Y  DIMCLQE+ ++  
Sbjct: 47  KFTMLTYNMLSPHYMWPQVYTYVPDQYKDWKYRHKLLEFELMQKYKADIMCLQELTWEDY 106

Query: 135 KEFWSVQF-KSLGYSFKFFKK 154
             +W  +  + + Y  KF  K
Sbjct: 107 ISYWKPKCNEKMNYGSKFVAK 127

>Skud_16.90 Chr16 (162354..164180) [1827 bp, 608 aa] {ON} YPL189W
          (REAL)
          Length = 608

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%)

Query: 34 WQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEFSI 80
          W  I      Q LD  I P+L+F+RR  L +  ++ +NG S    ++
Sbjct: 5  WSNIVHFFSVQALDSRIKPDLEFERRRKLFISSSKNENGSSSTAIAV 51

>NDAI0A02150 Chr1 (486774..489143) [2370 bp, 789 aa] {ON} Anc_7.309
          Length = 789

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 3/37 (8%)

Query: 204 QFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQ 240
           Q +D+N+N  +  +H I   +TH F H  GTF  T Q
Sbjct: 702 QLVDSNSNASTNTNHSI---STHKFSHSIGTFSSTTQ 735

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,880,276
Number of extensions: 2582368
Number of successful extensions: 6407
Number of sequences better than 10.0: 75
Number of HSP's gapped: 6309
Number of HSP's successfully gapped: 75
Length of query: 476
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 363
Effective length of database: 40,524,141
Effective search space: 14710263183
Effective search space used: 14710263183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)