Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0A141607.350ON45145121520.0
KLTH0H01254g7.350ON38138015840.0
SAKL0F11374g7.350ON38338315760.0
KLLA0D12342g7.350ON38438115750.0
Kwal_56.246427.350ON38138015620.0
TDEL0C019807.350ON38538215440.0
Kpol_530.317.350ON38037915400.0
Suva_4.787.350ON38538215120.0
TBLA0E00390singletonON38338315090.0
ZYRO0F11704g7.350ON38237815010.0
TPHA0F029707.350ON38137814990.0
Ecym_47237.350ON38138114940.0
Skud_4.897.350ON38537914890.0
YDL168W (SFA1)7.350ON38637814820.0
ACL148C7.350ON38138114750.0
Smik_4.707.350ON38637814650.0
CAGL0L01111g7.350ON38138014380.0
KAFR0B008807.350ON38137914030.0
NDAI0A018907.350ON42238813530.0
KNAG0C037907.350ON38238112931e-177
SAKL0A00880gsingletonON38838110131e-135
CAGL0J01441g2.480ON3722901942e-15
TBLA0I011402.480ON3772641871e-14
SAKL0C10164g3.118ON3512911835e-14
Suva_4.3943.118ON3512891817e-14
NCAS0I023503.118ON3512871782e-13
SAKL0B00814g8.16ON3543791773e-13
AER032W3.118ON3512841754e-13
KLTH0D05588g2.480ON3892641764e-13
YBR145W (ADH5)3.118ON3512881755e-13
KLTH0G15686g3.118ON3512841737e-13
Ecym_53313.118ON3482641721e-12
Skud_13.2402.480ON3752761721e-12
KLLA0D19929gsingletonON3863491721e-12
KLLA0F21010g3.118ON3502831711e-12
CAGL0I07843g3.118ON3522911711e-12
TPHA0G032102.480ON3772691712e-12
KNAG0K020003.118ON3502841674e-12
SAKL0F06270gna 1ON3512911674e-12
KLLA0B00451gsingletonON3863751668e-12
KLLA0F13530g2.480ON3752781651e-11
NCAS0I01720singletonON3512871622e-11
KAFR0G014203.118ON3512841622e-11
ZYRO0G03388g2.480ON3702901622e-11
KAFR0A007902.480ON3772911622e-11
ZYRO0B05940g3.118ON3792871622e-11
Suva_13.2612.480ON3752761613e-11
Skud_2.2723.118ON3512891613e-11
SAKL0B08184gna 2ON3732941613e-11
KLTH0G18986g8.16ON3543661604e-11
NDAI0H021602.480ON3812801604e-11
KLLA0B09064gna 2ON3742871604e-11
YMR083W (ADH3)2.480ON3752761604e-11
NCAS0A077802.480ON3732821595e-11
Smik_2.2843.118ON3512891595e-11
Skud_15.683.118ON3482871585e-11
Ecym_73912.480ON3752701595e-11
SAKL0E02838g2.480ON3772741587e-11
Smik_13.2662.480ON3752781588e-11
NDAI0A069303.118ON3512861578e-11
KLLA0F18260gsingletonON3482861578e-11
KLTH0E05588gna 1ON3482841569e-11
TBLA0E03430singletonON3512841561e-10
YOL086C (ADH1)3.118ON3482841561e-10
TBLA0E034403.118ON3512841551e-10
Suva_13.494na 3ON3482841552e-10
Suva_10.1548.16ON3562001542e-10
Smik_15.713.118ON3482871542e-10
AAR084WsingletonON3852891542e-10
Skud_13.477na 3ON3482871532e-10
Smik_13.520na 3ON3482841533e-10
KLTH0D00616g7.3ON3823111524e-10
ABR229C8.16ON3533491514e-10
YLR070C (XYL2)8.16ON3561881515e-10
Kwal_26.77992.480ON3872641515e-10
TDEL0A025602.480ON3732711498e-10
ABL033C2.480ON3732711499e-10
YAL060W (BDH1)7.3ON3822191481e-09
TPHA0M007303.118ON3502841472e-09
Smik_1.67.3ON3822191472e-09
Kwal_56.231983.118ON3512841462e-09
YMR303C (ADH2)na 3ON3482841452e-09
ZYRO0C12562gna 1ON3482871452e-09
Suva_15.813.118ON3482841452e-09
KLTH0A00418gsingletonON3562611452e-09
TDEL0D050503.118ON3512841443e-09
Skud_1.37.3ON3822191453e-09
Kwal_55.19574singletonON3562101434e-09
KAFR0L02010singletonON3512661434e-09
Kpol_1058.118.16ON3531061426e-09
TDEL0C003908.16ON3532681427e-09
TDEL0F03190na 1ON3512911419e-09
Suva_1.77.3ON3822211411e-08
KLLA0F00506g7.3ON3852081401e-08
Kpol_431.82.480ON3802491401e-08
TDEL0H044607.3ON3822791382e-08
ZYRO0G03410gsingletonON3733691372e-08
Smik_48.1singletonON3573771373e-08
Kpol_1049.187.2ON3862191364e-08
Suva_12.260singletonON3573931355e-08
TBLA0A042907.3ON3952171355e-08
Kpol_1036.193.118ON3532841355e-08
YJR159W (SOR1)na 4ON3573801346e-08
YDL246C (SOR2)singletonON3572381338e-08
KNAG0E025902.480ON3742711339e-08
KAFR0I001607.2ON3853041321e-07
CAGL0D00198g7.3ON3832991321e-07
Kwal_26.6684singletonON3562531312e-07
Kwal_55.20564singletonON2162301272e-07
Skud_20.2singletonON3573661302e-07
Skud_4.2singletonON3573661302e-07
SAKL0D14872g7.3ON3832201302e-07
KAFR0L02000singletonON3612641292e-07
NDAI0H020507.3ON3851041293e-07
KNAG0K01040singletonON3912181274e-07
Kwal_26.67397.3ON3822891266e-07
SAKL0D14894g7.2ON3852161258e-07
NCAS0A076707.2ON4392181222e-06
ZYRO0F02552g8.16ON3512681212e-06
NCAS0A076607.3ON3861051213e-06
TDEL0D037203.253ON3351401186e-06
YAL061W (BDH2)7.2ON4172691187e-06
NCAS0J003008.16ON3572761179e-06
KLLA0D05511g8.16ON3543581151e-05
KLLA0A10549g3.253ON3531421151e-05
KAFR0I001707.3ON3811201133e-05
YBR046C (ZTA1)3.253ON3341401123e-05
Skud_1.27.2ON4172081106e-05
KAFR0C005803.253ON3341421097e-05
Smik_1.57.2ON4172081071e-04
Suva_1.67.2ON4172081035e-04
KLLA0F00638gna 5ON3821361025e-04
KNAG0I00120singletonON3811241000.001
KNAG0D00110singletonON362216980.002
ZYRO0A03366g3.253ON349141960.003
Suva_6.13singletonON6859770.058
Kwal_47.17532na 6ON373227850.059
CAGL0H09944g3.253ON333140830.097
NDAI0H02950singletonON363216820.13
TPHA0H03100singletonON392281810.18
KLTH0E07964gna 6ON374202800.23
NCAS0D01220na 7ON36296800.28
KAFR0A08730singletonON360228780.50
SAKL0H22088gna 6ON376265760.82
Suva_7.5singletonON212100721.5
Smik_26.3singletonON12583701.6
Skud_86.1singletonON8959662.6
NCAS0C03020singletonON362110703.7
NDAI0H020607.2ON399101703.8
KLLA0F00528g7.2ON381292704.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0A14160
         (451 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa] ...   833   0.0  
KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly...   614   0.0  
SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {...   611   0.0  
KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} high...   611   0.0  
Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]...   606   0.0  
TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.3...   599   0.0  
Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON} (77132..7...   597   0.0  
Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W (...   587   0.0  
TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON}      585   0.0  
ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {...   582   0.0  
TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {O...   582   0.0  
Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar...   580   0.0  
Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W (...   578   0.0  
YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}  SFA1Bifunc...   575   0.0  
ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON} Syn...   572   0.0  
Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W (...   568   0.0  
CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highl...   558   0.0  
KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {O...   545   0.0  
NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350    525   0.0  
KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {O...   502   e-177
SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON...   394   e-135
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...    79   2e-15
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...    77   1e-14
SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {...    75   5e-14
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...    74   7e-14
NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118     73   2e-13
SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar ...    73   3e-13
AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic ho...    72   4e-13
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...    72   4e-13
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...    72   5e-13
KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]...    71   7e-13
Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar t...    71   1e-12
Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083...    71   1e-12
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...    71   1e-12
KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON} unip...    70   1e-12
CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {...    70   1e-12
TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {O...    70   2e-12
KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3....    69   4e-12
SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} simila...    69   4e-12
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...    69   8e-12
KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON} unip...    68   1e-11
NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON}               67   2e-11
KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {O...    67   2e-11
ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {...    67   2e-11
KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {O...    67   2e-11
ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly...    67   2e-11
Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083...    67   3e-11
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...    67   3e-11
SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON} unipro...    67   3e-11
KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]...    66   4e-11
NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480     66   4e-11
KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {...    66   4e-11
YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}  ADH3Mitoc...    66   4e-11
NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON} Anc_2...    66   5e-11
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    66   5e-11
Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {O...    65   5e-11
Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar t...    66   5e-11
SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON} unipro...    65   7e-11
Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083...    65   8e-11
NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON} Anc_3...    65   8e-11
KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]...    65   8e-11
KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {...    65   9e-11
TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON}               65   1e-10
YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON} ...    65   1e-10
TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.1...    64   1e-10
Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {...    64   2e-10
Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {...    64   2e-10
Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {O...    64   2e-10
AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-synteni...    64   2e-10
Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {...    64   2e-10
Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {...    64   3e-10
KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar ...    63   4e-10
ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON} S...    63   4e-10
YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON} ...    63   5e-10
Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {O...    63   5e-10
TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {O...    62   8e-10
ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON} S...    62   9e-10
YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}  BDH1NAD-depe...    62   1e-09
TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {...    61   2e-09
Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)     61   2e-09
Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086...    61   2e-09
YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON} ...    60   2e-09
ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly...    60   2e-09
Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {O...    60   2e-09
KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON...    60   2e-09
TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.1...    60   3e-09
Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)     60   3e-09
Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON...    60   4e-09
KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON}              60   4e-09
Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON} (41165....    59   6e-09
TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16 ...    59   7e-09
TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possib...    59   9e-09
Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)     59   1e-08
KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON...    59   1e-08
Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON} (21043..22...    59   1e-08
TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {O...    58   2e-08
ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {...    57   2e-08
Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR15...    57   3e-08
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    57   4e-08
Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159...    57   5e-08
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    57   5e-08
Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON} (51276....    57   5e-08
YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbi...    56   6e-08
YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}  SOR2...    56   8e-08
KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {O...    56   9e-08
KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2 Y...    55   1e-07
CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar ...    55   1e-07
Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W (...    55   2e-07
Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {O...    54   2e-07
Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)     55   2e-07
Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR1...    55   2e-07
SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]...    55   2e-07
KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON}              54   2e-07
NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {O...    54   3e-07
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    54   4e-07
Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W (...    53   6e-07
SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]...    53   8e-07
NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa] ...    52   2e-06
ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} simila...    51   2e-06
NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa] ...    51   3e-06
TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.2...    50   6e-06
YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative...    50   7e-06
NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16       50   9e-06
KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {...    49   1e-05
KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly...    49   1e-05
KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3 Y...    48   3e-05
YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}  ...    48   3e-05
Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)      47   6e-05
KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.2...    47   7e-05
Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)     46   1e-04
Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)     44   5e-04
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    44   5e-04
KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON}                  43   0.001
KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON}                   42   0.002
ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly...    42   0.003
Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON} ...    34   0.058
Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318...    37   0.059
CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {...    37   0.097
NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {O...    36   0.13 
TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {O...    36   0.18 
KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} simila...    35   0.23 
NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON}               35   0.28 
KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa] ...    35   0.50 
SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} simi...    34   0.82 
Suva_7.5 Chr7 (12884..13522) [639 bp, 212 aa] {ON} YLR460C (REAL)      32   1.5  
Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)      32   1.6  
Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159...    30   2.6  
NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {O...    32   3.7  
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    32   3.8  
KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON...    32   4.0  

>NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa]
           {ON} Anc_7.350
          Length = 451

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/451 (90%), Positives = 409/451 (90%)

Query: 1   MRLSLPRIIPALKNGAILFRGKPLTINKSLHNHSTVVLGGKPHIFSKAHLYCSPTFTQVK 60
           MRLSLPRIIPALKNGAILFRGKPLTINKSLHNHSTVVLGGKPHIFSKAHLYCSPTFTQVK
Sbjct: 1   MRLSLPRIIPALKNGAILFRGKPLTINKSLHNHSTVVLGGKPHIFSKAHLYCSPTFTQVK 60

Query: 61  GLHQNHYNMSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDA 120
           GLHQNHYNMSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDA
Sbjct: 61  GLHQNHYNMSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDA 120

Query: 121 YTLSGIDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTN 180
           YTLSGIDPEGAFPSIL               TNVKVGDHVIALYTAECGKCKFCKSGKTN
Sbjct: 121 YTLSGIDPEGAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGKCKFCKSGKTN 180

Query: 181 LCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDS 240
           LCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYT           PKAPLDS
Sbjct: 181 LCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTVVADVSVVAVDPKAPLDS 240

Query: 241 ISLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDK 300
           ISLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDK
Sbjct: 241 ISLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDK 300

Query: 301 KQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKG 360
           KQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKG
Sbjct: 301 KQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKG 360

Query: 361 WXXXXXXXXXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEF 420
           W                TRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEF
Sbjct: 361 WGESIIIGVAGAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEF 420

Query: 421 ITHRRPFTEINDAFEDLHHGDCLRTVLDLAK 451
           ITHRRPFTEINDAFEDLHHGDCLRTVLDLAK
Sbjct: 421 ITHRRPFTEINDAFEDLHHGDCLRTVLDLAK 451

>KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 381

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/380 (77%), Positives = 317/380 (83%)

Query: 72  TQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGA 131
           ++GKPITCTAAVAY AGKPLTVE+IVVDPPKAHEVRIK+EYTAVCHTDAYTLSG+DPEGA
Sbjct: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA 61

Query: 132 FPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQGK 191
           FPSIL               TNVK GDHVIALYTAEC +CKFCKSGKTNLCGSVRATQGK
Sbjct: 62  FPSILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121

Query: 192 GVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTG 251
           GVMPDGTSRFHN+KGE LLHFMGCSTFSQYT           PKAPLD   LLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTG 181

Query: 252 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATD 311
           YGAA+KTA+VQKGDTVA+FGAGTVGLSVVQGA  RGASKIIVVDIN+ KKQWS DFGATD
Sbjct: 182 YGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATD 241

Query: 312 FVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXXXX 371
           FVNP + LK+G+TIV KL+EMTDGGL++TFDCTGN  VMR ALEACHKGW          
Sbjct: 242 FVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAA 301

Query: 372 XXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEIN 431
                 TRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY +GKLKVDEFITHRR FT+IN
Sbjct: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDIN 361

Query: 432 DAFEDLHHGDCLRTVLDLAK 451
            AFEDLHHGDCLRTVLDL+K
Sbjct: 362 SAFEDLHHGDCLRTVLDLSK 381

>SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 383

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/383 (77%), Positives = 318/383 (83%)

Query: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128
           MS T GKPITC AAVAY AGKPLTVE+I+V+PPKAHEVRI+I YTAVCHTDAYTLSG+DP
Sbjct: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60

Query: 129 EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRAT 188
           EGAFPSIL               TNVK GDHV+ALYTAEC KCKFC SGKTNLCGSVRAT
Sbjct: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120

Query: 189 QGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGV 248
           QGKGVMPDGTSRF  + GE +LHFMGCSTFSQYT            +APLD I LLGCGV
Sbjct: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTVVADVSVVAVDSQAPLDRICLLGCGV 180

Query: 249 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFG 308
           TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAK+RGAS+IIVVDIN+ KKQW+ DFG
Sbjct: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240

Query: 309 ATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXX 368
           ATDFVNP +DLKEGETIV KLIE+TDGGL++TFDCTGN KVMRDALEACHKGW       
Sbjct: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 369 XXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFT 428
                    TRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY +G+LKVDEFITHRRPFT
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360

Query: 429 EINDAFEDLHHGDCLRTVLDLAK 451
           EIN AF+DLHHGDCLRTVLDL+K
Sbjct: 361 EINAAFDDLHHGDCLRTVLDLSK 383

>KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 384

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/381 (76%), Positives = 317/381 (83%)

Query: 70  SSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPE 129
           S+T GKPI C AAVAY AGKPLTVE+I+VD PKAHEVR+++ +TAVCHTDAYTLSG+DPE
Sbjct: 3   SATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPE 62

Query: 130 GAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQ 189
           GAFPSIL               TNVKVGDHV+ LYTAECGKCKFCKS KTNLCGSVRATQ
Sbjct: 63  GAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQ 122

Query: 190 GKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVT 249
           GKGVMPDGT+RFHN KGEPLLHFMGCSTFSQYT           P APL S+ LLGCGVT
Sbjct: 123 GKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVT 182

Query: 250 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGA 309
           TGYGAA+KTANVQ+GDTVAVFGAGTVGLSVVQGAKSRGASKIIVVD+N+ KKQWS DFGA
Sbjct: 183 TGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGA 242

Query: 310 TDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXX 369
           T FVNP +DLKEGETIV KLI+MTDGGL++TFDCTGNVKVMRDALEACHKGW        
Sbjct: 243 TGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSIIIGV 302

Query: 370 XXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTE 429
                   TRPFQL+TGRVWKGSAFGGIKGRSEMG L+  YQ G LKVD+FITH+RPFTE
Sbjct: 303 AAAGEEISTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTE 362

Query: 430 INDAFEDLHHGDCLRTVLDLA 450
           IN+AFEDLHHGDCLRTVLDLA
Sbjct: 363 INNAFEDLHHGDCLRTVLDLA 383

>Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]
           {ON} YDL168W (SFA1) - Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
           [contig 161] FULL
          Length = 381

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/380 (77%), Positives = 315/380 (82%)

Query: 72  TQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGA 131
           ++GKPITC AAVAY AGKPLT+E+IVVDPPKAHEVR+KI YTAVCHTDAYTLSG+DPEGA
Sbjct: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA 61

Query: 132 FPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQGK 191
           FPSIL               TNVK GDHVIALYTAEC +CKFCKSGKTNLCGSVRATQGK
Sbjct: 62  FPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121

Query: 192 GVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTG 251
           GVMPDGT+RFHN+KGE +LHFMGCSTFSQYT           PKAPLD   LLGCGVTTG
Sbjct: 122 GVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTG 181

Query: 252 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATD 311
           YGAA+KTANVQKGDTVAVFGAGTVGLSVVQGAK RGAS+IIVVDIN+ KKQW+ +FGATD
Sbjct: 182 YGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATD 241

Query: 312 FVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXXXX 371
           FVNP +DLK+G+TIV  L+EMTDGGL+YTFDCTGN  VMR ALEACHKGW          
Sbjct: 242 FVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAA 301

Query: 372 XXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEIN 431
                 TRPFQLVTGRVWKGSAFGGIKGRSEMGGLI DY +GKLKVDEFITHRR FT+IN
Sbjct: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDIN 361

Query: 432 DAFEDLHHGDCLRTVLDLAK 451
            AFEDLHHGDCLRTVLDL K
Sbjct: 362 SAFEDLHHGDCLRTVLDLLK 381

>TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.350
           YDL168W
          Length = 385

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/382 (76%), Positives = 314/382 (82%)

Query: 70  SSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPE 129
           ++T+GK ITC AAVAY AGKPLTVE+I V+ P+AHEVRIKIEYTAVCHTDAYTLSG+DPE
Sbjct: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPE 63

Query: 130 GAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQ 189
           GAFPSIL               TNVK GDHVIALYTAEC KCKFCKSGKTNLC SVRATQ
Sbjct: 64  GAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQ 123

Query: 190 GKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVT 249
           GKGVMPDGTSRF NQKGE L HFMGCSTFSQYT           P APL+SI LLGCGVT
Sbjct: 124 GKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTVVADVSVVAVDPSAPLESICLLGCGVT 183

Query: 250 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGA 309
           TGYGAA KTANVQKGDTVAVFGAGTVGLSV+QGAK RGAS+II+VDIN+ K+++  +FGA
Sbjct: 184 TGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGA 243

Query: 310 TDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXX 369
           TDF+NPK DLK+G+TIV+KLIEMTDGGL+YTFDCTGN KVMRDALEACHKGW        
Sbjct: 244 TDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303

Query: 370 XXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTE 429
                   TRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDY+ G LKVDEFIT+ RPFTE
Sbjct: 304 AAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE 363

Query: 430 INDAFEDLHHGDCLRTVLDLAK 451
           IN AFEDLH GDCLRTVLDL K
Sbjct: 364 INKAFEDLHAGDCLRTVLDLKK 385

>Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON}
           (77132..78274) [1143 nt, 381 aa]
          Length = 380

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/379 (77%), Positives = 310/379 (81%), Gaps = 1/379 (0%)

Query: 71  STQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEG 130
           ST GKPITC AAVAY A KPL VE+IVVDPPKAHEVRIKI  TAVCHTDAYTLSG+DPEG
Sbjct: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61

Query: 131 AFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQG 190
            FP +L               T VK GDHV+ALYTAECGKCKFC SGKTNLCGSVRATQG
Sbjct: 62  LFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQG 121

Query: 191 KGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTT 250
           KGVMPDGT RFHN+KGEPL HFMGCSTFS+YT           P APLDS+ LLGCGVTT
Sbjct: 122 KGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTT 181

Query: 251 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGAT 310
           GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKK+WS +FGAT
Sbjct: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241

Query: 311 DFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXXX 370
           DFVNP E L EG+ IV KL+EMTDGGL++TFDCTGNV VMRDALEACHKGW         
Sbjct: 242 DFVNPSE-LPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300

Query: 371 XXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEI 430
                  TRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DYQNG LKVDEFIT+RRPF EI
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360

Query: 431 NDAFEDLHHGDCLRTVLDL 449
           NDAFE+LHHG+CLRTVL  
Sbjct: 361 NDAFEELHHGNCLRTVLSF 379

>Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/382 (74%), Positives = 308/382 (80%)

Query: 70  SSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPE 129
           +ST GKPI C AA+AY A KPL+VE+I VDPPKAHEVRIKIEYTAVCHTDAYTLSG DPE
Sbjct: 3   ASTVGKPIQCIAAIAYDAKKPLSVEEITVDPPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62

Query: 130 GAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQ 189
           G FP IL               T VK GDHVIALYTAECGKCKFC SGKTNLC +VRATQ
Sbjct: 63  GLFPCILGHEGAGIVESVGDDVTTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQ 122

Query: 190 GKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVT 249
           G+G+MPD T+RFHN KGE + HFMGCSTFS+YT           PKAPLD+ SLLGCGVT
Sbjct: 123 GRGIMPDETTRFHNGKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAASLLGCGVT 182

Query: 250 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGA 309
           TGYGAA+KTANVQKGDTVAVFG GTVGLSV+QGAK+RGASKII +DINN KKQ+ FDFGA
Sbjct: 183 TGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKARGASKIIGIDINNKKKQYCFDFGA 242

Query: 310 TDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXX 369
           TDF+NPKEDL +G+TIV+KLIE TDGGL++TFDCTGN K+MRDALEACHKGW        
Sbjct: 243 TDFINPKEDLAKGQTIVEKLIETTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGV 302

Query: 370 XXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTE 429
                   TRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DYQNG LKV+EFITHRRPF E
Sbjct: 303 AAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGALKVEEFITHRRPFKE 362

Query: 430 INDAFEDLHHGDCLRTVLDLAK 451
           IN AFEDLH GDCLRTVL   K
Sbjct: 363 INQAFEDLHQGDCLRTVLKFDK 384

>TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/383 (74%), Positives = 310/383 (80%)

Query: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128
           MS TQGKPI C AAVAY A +PLTVE+I+V+PP+AHEVRIKI +TAVCHTDAYTLSG+DP
Sbjct: 1   MSETQGKPIKCLAAVAYKAAEPLTVEEIIVEPPEAHEVRIKITHTAVCHTDAYTLSGVDP 60

Query: 129 EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRAT 188
           EGAFP +L               ++VKVGDHVIALYTAECG CKFCKSGKTNLCGSVR T
Sbjct: 61  EGAFPCVLGHEGSGIVESVGEGVSSVKVGDHVIALYTAECGVCKFCKSGKTNLCGSVRET 120

Query: 189 QGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGV 248
           QGKGVMPDGTSRF N KGE LLHFMGCSTFSQYT             APL S+ LLGCGV
Sbjct: 121 QGKGVMPDGTSRFKNLKGESLLHFMGCSTFSQYTVVADVSVVAINKTAPLQSVCLLGCGV 180

Query: 249 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFG 308
           TTGYGAAIKTANVQK DTVAVFGAGTVGLSVVQGA++RGASKII+VD+N+ K+ +S  FG
Sbjct: 181 TTGYGAAIKTANVQKNDTVAVFGAGTVGLSVVQGAQARGASKIIMVDVNSKKETYSRQFG 240

Query: 309 ATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXX 368
           ATDF+NP  DLK GETIV KL+EMTDGGL++TFDCTGNVKVMRDALE CHKGW       
Sbjct: 241 ATDFINPMTDLKPGETIVSKLVEMTDGGLDHTFDCTGNVKVMRDALECCHKGWGQSIIIG 300

Query: 369 XXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFT 428
                    TRPFQLVTGRVWKGSAFGG+KGRSEMGGLIE YQ G LKVD+FIT++RPFT
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMGGLIESYQKGDLKVDQFITNKRPFT 360

Query: 429 EINDAFEDLHHGDCLRTVLDLAK 451
           EIN AFEDLHHGDCLRTVLDL K
Sbjct: 361 EINAAFEDLHHGDCLRTVLDLEK 383

>ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 382

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/378 (74%), Positives = 313/378 (82%)

Query: 71  STQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEG 130
           ST+GKP+T  AAVAY AGKPL+VE+I VDPPKAHEVRI+++ TAVCHTDAYTLSG DPEG
Sbjct: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61

Query: 131 AFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQG 190
           AFPSIL               T+VK GDHV+ALYTAECGKCKFCKSGKTNLCGSVRATQG
Sbjct: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121

Query: 191 KGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTT 250
           KGVMPDGTSRF N+KGE LLHFMGCSTFS+YT           PKAPL+S  LLGCGVTT
Sbjct: 122 KGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTVVADVSVVAVDPKAPLESACLLGCGVTT 181

Query: 251 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGAT 310
           GYGAA+KTANVQKGDTVA+FGAGTVGLSV QGAK+RGAS+II+VDIN+ KK++  +FGAT
Sbjct: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241

Query: 311 DFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXXX 370
           DF+NP  DL+ G+TIV+KLIEMTDGGL++TFDCTGNVKVMRDALEACHKGW         
Sbjct: 242 DFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKGWGVSVVIGVA 301

Query: 371 XXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEI 430
                  TRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DYQ G LKVDEFIT+RRPF +I
Sbjct: 302 ASGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQI 361

Query: 431 NDAFEDLHHGDCLRTVLD 448
           N+AFEDLH GD LRTVL+
Sbjct: 362 NEAFEDLHAGDSLRTVLN 379

>TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/378 (75%), Positives = 307/378 (81%), Gaps = 1/378 (0%)

Query: 71  STQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEG 130
           S  GKPITCTAA+AY A KPLTV +IVVDPPKAHEVRIKI  TAVCHTDAY+LSG+DPEG
Sbjct: 2   SAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEG 61

Query: 131 AFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQG 190
            FP +L               TNVKVGDHVIALYTAECGKCKFC SGKTNLCGSVRATQG
Sbjct: 62  LFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQG 121

Query: 191 KGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTT 250
           KGVMPDGT+RFH++ G+P+ HFMGCSTFSQYT                +  +LLGCGVTT
Sbjct: 122 KGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTT 181

Query: 251 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGAT 310
           GYGAAIKTAN+QKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVD+NNDKK WSF+FGAT
Sbjct: 182 GYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGAT 241

Query: 311 DFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXXX 370
           DFVNPKE LK+ E IV KLIEMTDGGL++TFDCTGNV VMR+ALEACHKGW         
Sbjct: 242 DFVNPKE-LKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVA 300

Query: 371 XXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEI 430
                  TRPFQLVTGRVW+GSAFGGIKGRSEMGGLI+DYQ+G LKVDEFIT RRPFTEI
Sbjct: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360

Query: 431 NDAFEDLHHGDCLRTVLD 448
           N AFEDLH+G CLRTVLD
Sbjct: 361 NAAFEDLHNGSCLRTVLD 378

>Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii ACL148C
          Length = 381

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/381 (73%), Positives = 304/381 (79%)

Query: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128
           MS T GK I C AA+AY AG PL +E I VDPPKAHEVRIKI +TA+CHTDAYTLSG+DP
Sbjct: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP 60

Query: 129 EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRAT 188
           EG FPSIL               TNVKVGDHVI LYTAEC +CKFC SGKTNLCGSVRAT
Sbjct: 61  EGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT 120

Query: 189 QGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGV 248
           QGKG+MPDGTSRF N KGE + HFMGCSTFS+YT            KAPLD + LLGCGV
Sbjct: 121 QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV 180

Query: 249 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFG 308
           TTGYGAA+KTA+VQKGDTVAVFGAGTVGLSVVQGA+SRGASKIIVVDIN+DKK+WSFDFG
Sbjct: 181 TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240

Query: 309 ATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXX 368
           ATDF+NP +DL +GETIV KLI+MTDGGL++TFDCTGN KVMRDALEACHKGW       
Sbjct: 241 ATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 369 XXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFT 428
                    TRPFQLVTGRVWKGSAFGGIKGRSEMG LI DY  GKLKVDEF+TH RPF+
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFS 360

Query: 429 EINDAFEDLHHGDCLRTVLDL 449
           EIND   DLHHGDCLRTVL+ 
Sbjct: 361 EINDGLTDLHHGDCLRTVLNF 381

>Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/379 (73%), Positives = 306/379 (80%)

Query: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128
           +++T GKPI C AAVAY A K L+VE+I VDPPKAHEVRIKIE+TAVCHTDAYTLSG DP
Sbjct: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61

Query: 129 EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRAT 188
           EG FP IL                 VK GDHVIALYTAECGKCKFC SGKTNLC +VRAT
Sbjct: 62  EGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRAT 121

Query: 189 QGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGV 248
           QGKGVMPDGT+RFHN KGE + HFMGCSTFS+YT           PKAPLD+  LLGCGV
Sbjct: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGV 181

Query: 249 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFG 308
           TTGYGAAIKTANVQ+GDTVAVFG GTVGLSV+QGAKSRGASKII VDINN K+Q+S +FG
Sbjct: 182 TTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFG 241

Query: 309 ATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXX 368
           ATDF+NPKEDL E +TIV+KLI+MTDGGL++TFDCTGN  +MRDALEACHKGW       
Sbjct: 242 ATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSIIIG 301

Query: 369 XXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFT 428
                    TRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DYQ+G LKV+EFITHRRPF 
Sbjct: 302 VAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFK 361

Query: 429 EINDAFEDLHHGDCLRTVL 447
           EIN AFEDLH+GDCLRTVL
Sbjct: 362 EINQAFEDLHNGDCLRTVL 380

>YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}
           SFA1Bifunctional enzyme containing both alcohol
           dehydrogenase and glutathione-dependent formaldehyde
           dehydrogenase activities, functions in formaldehyde
           detoxification and formation of long chain and complex
           alcohols, regulated by Hog1p-Sko1p
          Length = 386

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/378 (73%), Positives = 303/378 (80%)

Query: 70  SSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPE 129
           ++T GKPI C AAVAY A KPL+VE+I VD PKAHEVRIKIEYTAVCHTDAYTLSG DPE
Sbjct: 3   AATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62

Query: 130 GAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQ 189
           G FP +L                 VK GDHVIALYTAECGKCKFC SGKTNLCG+VRATQ
Sbjct: 63  GLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQ 122

Query: 190 GKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVT 249
           GKGVMPDGT+RFHN KGE + HFMGCSTFS+YT           PKAPLD+  LLGCGVT
Sbjct: 123 GKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVT 182

Query: 250 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGA 309
           TG+GAA+KTANVQKGDTVAVFG GTVGLSV+QGAK RGASKII +DINN KKQ+   FGA
Sbjct: 183 TGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQFGA 242

Query: 310 TDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXX 369
           TDFVNPKEDL + +TIV+KLIEMTDGGL++TFDCTGN K+MRDALEACHKGW        
Sbjct: 243 TDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGV 302

Query: 370 XXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTE 429
                   TRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DYQ G LKV+EFITHRRPF E
Sbjct: 303 AAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKE 362

Query: 430 INDAFEDLHHGDCLRTVL 447
           IN AFEDLH+GDCLRTVL
Sbjct: 363 INQAFEDLHNGDCLRTVL 380

>ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL168W
           (SFA1)
          Length = 381

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/381 (72%), Positives = 305/381 (80%)

Query: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128
           MS TQGKPI CTAAVAYAAG+PL +E++ VDPPKAHEVRIKI  +A+CHTDAYTLSG DP
Sbjct: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60

Query: 129 EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRAT 188
           EG FP IL               TNVK GDHV+ LYTAEC +CKFC SGKTNLCG+VRAT
Sbjct: 61  EGLFPCILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRAT 120

Query: 189 QGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGV 248
           QGKGVMPDGTSRF N KGE L HFMGCSTFS+YT            +APL+++ LLGCGV
Sbjct: 121 QGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVSVVAVDQQAPLETVCLLGCGV 180

Query: 249 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFG 308
           TTGYGAA+KTA+VQ+GDTVAVFGAGTVGLSVVQGAK+R AS+IIVVDIN+ K++W+  FG
Sbjct: 181 TTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240

Query: 309 ATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXX 368
           ATDF+NPK DLKEGETIV +LIEMTDGGL++TFDCTGN KVMRDALEACHKGW       
Sbjct: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 369 XXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFT 428
                    TRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY NG LKV EF+TH+RPF 
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFE 360

Query: 429 EINDAFEDLHHGDCLRTVLDL 449
           EIN  FEDLHHGDCLRTVL L
Sbjct: 361 EINSGFEDLHHGDCLRTVLSL 381

>Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W
           (REAL)
          Length = 386

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/378 (73%), Positives = 303/378 (80%)

Query: 70  SSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPE 129
           ++T GKPI C AAVAY A KP +VE+I VD PKAHEVRIKIEYTAVCHTDAYTLSG DPE
Sbjct: 3   AATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62

Query: 130 GAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQ 189
           G FP IL                 VK GDHVIALYTAECGKCKFC SGKTNLC +VRATQ
Sbjct: 63  GLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQ 122

Query: 190 GKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVT 249
           GKGVMPDGT+RFHN KG+ + HFMGCSTFS+YT           PKAPLD+  LLGCGVT
Sbjct: 123 GKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVT 182

Query: 250 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGA 309
           TGYGAA+KTANVQKGDTVAVFG GTVGLSV+QGAK RGASKII VDINN+KK++   FGA
Sbjct: 183 TGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGA 242

Query: 310 TDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXX 369
           TDF+NPKEDL + +TIV+KL+EMTDGGL++TFDCTGN K+MRDALEACHKGW        
Sbjct: 243 TDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGV 302

Query: 370 XXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTE 429
                   TRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DYQ+G LKV+EFITHRRPF E
Sbjct: 303 AAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKE 362

Query: 430 INDAFEDLHHGDCLRTVL 447
           IN AFEDLH+GDCLRTVL
Sbjct: 363 INHAFEDLHNGDCLRTVL 380

>CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168w SFA1 long-chain alcohol dehydrogenase
          Length = 381

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/380 (71%), Positives = 297/380 (78%)

Query: 72  TQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGA 131
           T+GKPI C AAVAY AGKP  VEQIVVDPPKAHEVRIKI  TAVCHTDAYTLSG DPEG 
Sbjct: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61

Query: 132 FPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQGK 191
           FP +L               TNVK GDHVIALYTAEC KCKFC SGKTNLCG+VRATQGK
Sbjct: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121

Query: 192 GVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTG 251
           GVMPDGTSRFHN+KGE L HFMGCSTFS+YT             APL+S+ LLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181

Query: 252 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATD 311
           YGAA+KTANVQKGDTVAVFG GTVGLSV+QGA  RGAS+II +D N+ KK +   FGATD
Sbjct: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241

Query: 312 FVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXXXX 371
           F+NP +DLKE ETIV KLIEMTDGGL++TFDCTGNV VMR ALEACHKGW          
Sbjct: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301

Query: 372 XXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEIN 431
                 TRPFQLVTGRVWKGSAFGG+KGRSEM GLIE Y+ G+LKVDEFITHRR F EIN
Sbjct: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361

Query: 432 DAFEDLHHGDCLRTVLDLAK 451
           +AF+DLH+G CLRTVL  +K
Sbjct: 362 EAFDDLHNGLCLRTVLSFSK 381

>KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/379 (69%), Positives = 295/379 (77%)

Query: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128
           MSSTQGK I C AAVAY A KPL V+ ++VD PKAHEVRIKI  TA+CHTDAYTLSG+DP
Sbjct: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60

Query: 129 EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRAT 188
           EG FP IL               T+VKVGDHVI LYTAEC KCKFCKSGKTNLCG+VR T
Sbjct: 61  EGLFPCILGHEGSGIVESIGEGVTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET 120

Query: 189 QGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGV 248
           QGKGVMPDGTSRFH  +G+ + HFMGCSTFS+YT            K  L+  SLLGCGV
Sbjct: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGV 180

Query: 249 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFG 308
           TTG+GAA+K ANVQKGDTVAVFGAGTVGLSVVQGA+ RG SK+IVVDIN++KKQ+S+DFG
Sbjct: 181 TTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG 240

Query: 309 ATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXX 368
           ATDFVNP  DLK+GETIV KLI MTDGGL+YTFDCTGNV VMR+ALEACHKGW       
Sbjct: 241 ATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIG 300

Query: 369 XXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFT 428
                    TRPFQLVTGRVW+G+AFG IKGR++M  L++DY+ G LK+DEFITHRR F 
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFD 360

Query: 429 EINDAFEDLHHGDCLRTVL 447
           EIND FEDLH G CLRTVL
Sbjct: 361 EINDGFEDLHMGTCLRTVL 379

>NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350
          Length = 422

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/388 (69%), Positives = 284/388 (73%), Gaps = 46/388 (11%)

Query: 64  QNHYNMSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTL 123
           Q    MS+TQGKPITCTAAVAY AGKPLTVE IVVDPPKAHEVRIKI+YTAVCHTDAYTL
Sbjct: 81  QTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTL 140

Query: 124 SGIDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCG 183
           SG+DPEGAFPSIL               TNVKVGDHVIALYTAECG+   CK  K+    
Sbjct: 141 SGVDPEGAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGE---CKFCKSGXXX 197

Query: 184 SVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISL 243
                  K                                            AP+DSI L
Sbjct: 198 XXXXAVDK-------------------------------------------NAPMDSICL 214

Query: 244 LGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQW 303
           LGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAK+RGASKIIVVD+N+ KKQW
Sbjct: 215 LGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQW 274

Query: 304 SFDFGATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXX 363
           S DFGATDF+NPK DLKEGETIV KLIEMTDGGLEYTFDCTGN KVMRDALEACHKGW  
Sbjct: 275 SMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWGE 334

Query: 364 XXXXXXXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITH 423
                         TRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DYQNG LKVDEFITH
Sbjct: 335 SIIIGVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITH 394

Query: 424 RRPFTEINDAFEDLHHGDCLRTVLDLAK 451
           RRPFTEIN+AFEDLHHGDCLRTVLDL+K
Sbjct: 395 RRPFTEINNAFEDLHHGDCLRTVLDLSK 422

>KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {ON}
           Anc_7.350 YDL168W
          Length = 382

 Score =  502 bits (1293), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 251/381 (65%), Positives = 289/381 (75%), Gaps = 1/381 (0%)

Query: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPK-AHEVRIKIEYTAVCHTDAYTLSGID 127
           M++T+G+ ITCTAAVAYAAGKPLTVEQI V+ P  A       ++  + H   +++    
Sbjct: 1   MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGS 60

Query: 128 PEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRA 187
                                   T+VKVGDHVIALYTAEC +CK CKSGKTNLC +VRA
Sbjct: 61  EVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRA 120

Query: 188 TQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCG 247
           TQGKGVMPDGTSRF N KGEPLLHFMGCSTF++YT             APL+ + LLGCG
Sbjct: 121 TQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCG 180

Query: 248 VTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDF 307
           VTTGYGAA+KTANVQKGDTVAVFGAGT+GLSVVQGAK+R ASKIIVVDIN+ KK+++FDF
Sbjct: 181 VTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDF 240

Query: 308 GATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXX 367
           GATDFVNPK DLK+G+TIV+KL+EMTDGGL++TFD TGNV+VMRDALEACHKGW      
Sbjct: 241 GATDFVNPKTDLKDGQTIVEKLVEMTDGGLDFTFDGTGNVQVMRDALEACHKGWGQSIII 300

Query: 368 XXXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPF 427
                     TRPFQLVTGRVWKGSAFGG+KGRSEMG LIEDY  G LK+DEFIT++RPF
Sbjct: 301 GVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPF 360

Query: 428 TEINDAFEDLHHGDCLRTVLD 448
            EIN+ FEDLHHGDCLRTVL+
Sbjct: 361 KEINEGFEDLHHGDCLRTVLN 381

>SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON}
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione- dependent formaldehyde dehydrogenase)
          Length = 388

 Score =  394 bits (1013), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 189/381 (49%), Positives = 253/381 (66%), Gaps = 3/381 (0%)

Query: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128
           M   +G+PI CTAAVAY+  KPL +EQI+VDPP+ HEVR+K+  TA+C TD +TL G++P
Sbjct: 1   MFYKEGEPIRCTAAVAYSINKPLVLEQIIVDPPQEHEVRVKVTNTALCRTDLFTLKGLNP 60

Query: 129 EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRAT 188
           EG FP +L                 VK GDHV+ LY  ECG C  CKS K+NLC  ++AT
Sbjct: 61  EGKFPCVLGHEGSGIVESCGSKVETVKKGDHVLLLYIPECGHCADCKSEKSNLCSVIKAT 120

Query: 189 QGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGV 248
           Q +GVMP G+SR HN + + L HFMGCS+FSQY              APLD I LLGCGV
Sbjct: 121 QAQGVMPQGSSRLHNLENKTLWHFMGCSSFSQYAVVSDISCVKIRDDAPLDKICLLGCGV 180

Query: 249 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFG 308
           TTG+GA I    V+ GD VAVFG+GTVGLSVVQ        ++IVVD+ ++K++W+  FG
Sbjct: 181 TTGFGAPI-AKGVKAGDRVAVFGSGTVGLSVVQSCSQLKCFQVIVVDVQDNKREWALGFG 239

Query: 309 ATDFVNPKEDLKEGETIVQKLIEMTDG-GLEYTFDCTGNVKVMRDALEACHKGWXXXXXX 367
           ATDF+NP++ + + ++++Q LI+ + G G ++TFDCTG+  VMR ALE+C KGW      
Sbjct: 240 ATDFINPQK-IPKNKSLLQTLIDKSGGDGFDFTFDCTGSTSVMRTALESCRKGWGTSVII 298

Query: 368 XXXXXXXXXXTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPF 427
                     T P+ L+ GR W+G AFGG+KGRSE+  L+E Y N ++K+DE+IT++RP 
Sbjct: 299 GLAGAGEEISTLPYNLIVGRSWEGCAFGGVKGRSELPTLVERYMNNEIKLDEYITNKRPL 358

Query: 428 TEINDAFEDLHHGDCLRTVLD 448
            EIN+A ++L  G  L+TVLD
Sbjct: 359 KEINEALKELEDGLVLKTVLD 379

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/290 (24%), Positives = 121/290 (41%), Gaps = 31/290 (10%)

Query: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128
           + ST   P +    + Y  G  L  + + V  PK +E+ I + Y+ VCHTD +   G  P
Sbjct: 21  LQSTLSIPQSQKGVIFYEHGGKLEYKDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWP 80

Query: 129 EGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVR 186
            GA  P +                TN ++GD+  I      C  C+FC+ G  + C    
Sbjct: 81  LGAKLPLVGGHEGAGVVVAKGSSVTNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKAD 140

Query: 187 ATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGC 246
            +   G   DG                   +F QY                L  ++ + C
Sbjct: 141 LS---GYTHDG-------------------SFQQYATADAIQAAQIPKGTDLAQVAPILC 178

Query: 247 GVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSF 305
              T Y  A+K ++V+ G  VA+ G AG +G   VQ AK+ G  +++ +D  ++K++   
Sbjct: 179 AGVTVY-KALKDSDVKPGQWVAISGAAGGLGSLAVQYAKAMGM-RVLGIDAGDEKRKLFE 236

Query: 306 DFGATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALE 355
             G   FV    D  + + +V ++ E+T+GG     + + + K +  ++E
Sbjct: 237 SLGGNHFV----DFTKTKDLVSEIQEITEGGPHGVINVSVSEKAIGQSVE 282

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/264 (26%), Positives = 109/264 (41%), Gaps = 31/264 (11%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGA-FPS 134
           P T  A V Y  G PL    I V  PK +E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 33  PTTQKAVVFYENGGPLKYTTIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL 92

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                 N ++GD+  I      C  C+ C+ G  + C     +   G 
Sbjct: 93  VGGHEGAGVVVAKGSEVKNFEIGDYAGIKWLNGSCMSCELCEKGFESNCEQADLS---GY 149

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
             DG                   +F QY                L  ++ + C   T Y 
Sbjct: 150 THDG-------------------SFQQYATADAVQAAHIPKNVDLAEVAPILCAGVTVY- 189

Query: 254 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+KTA+V+ G  VA+ GA G +G   VQ AK+ G  +++ +D  ++KK+     G   F
Sbjct: 190 KALKTADVKPGQWVAISGACGGLGSLAVQYAKAMGL-RVVGIDGGDEKKKLFHSLGGDIF 248

Query: 313 VNPKEDLKEGETIVQKLIEMTDGG 336
           V    D  +  +IV+ + ++T+GG
Sbjct: 249 V----DFTKTHSIVKDIQDVTNGG 268

>SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {ON}
           uniprot|Q6XQ74 Saccharomyces kluyveri ADH1 Alcohol
           dehydrogenase 1
          Length = 351

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 121/291 (41%), Gaps = 36/291 (12%)

Query: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128
           MS+ Q  P T  A + Y  G  L  + I V  PK++E+ I I+Y+ VCHTD +   G  P
Sbjct: 1   MSAPQ-IPETQKAVIFYENGGELQYKDIPVPKPKSNEILINIKYSGVCHTDLHAWKGDWP 59

Query: 129 -EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVR 186
                P +                   K+GD+  I      C  C++C+    + C    
Sbjct: 60  LPTKLPLVGGHEGAGIVVGMGENVKGWKIGDYAGIKWLNGSCMSCEYCELSNESNC---- 115

Query: 187 ATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGC 246
                   PD     +   G          +F QY            P   L  ++ + C
Sbjct: 116 --------PDADLSGYTHDG----------SFQQYATADAVQAARIAPGTDLAEVAPVLC 157

Query: 247 GVTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSF 305
              T Y  A+K+AN++ G+ VA+ GA G +G   +Q AK+ G  +++ +D  ++K     
Sbjct: 158 AGITVY-KALKSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGDEKAALFK 215

Query: 306 DFGATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           + G   F+    D  + + +V+ +++ T+GG         NV V   A+EA
Sbjct: 216 ELGGEVFI----DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEA 258

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 74.3 bits (181), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 115/289 (39%), Gaps = 35/289 (12%)

Query: 71  STQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-E 129
           S+Q  P +  A V Y     L  + I V  PKA+E+ + ++Y+ VCH+D +   G  P +
Sbjct: 2   SSQAIPESQKAIVFYETNGKLEYKDIAVPEPKANEILVHVKYSGVCHSDLHAWRGDWPFQ 61

Query: 130 GAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRAT 188
             FP I                   KVGD   I      C  C++C+ G  + C  +   
Sbjct: 62  LKFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL--- 118

Query: 189 QGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGV 248
                  DGT   H+             TF +Y                L  ++ + C  
Sbjct: 119 -------DGTGFTHD------------GTFQEYATADAVQAAHLPENVDLAEVAPILCAG 159

Query: 249 TTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDF 307
            T Y  A+K AN+  G  V + GA G +G   +Q A + G  ++I +D    KKQ     
Sbjct: 160 VTVY-KALKRANLIPGQWVTISGACGGLGSLAIQYATAMG-YRVIGIDEGETKKQLFEGL 217

Query: 308 GATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           G   F+    D  + + IV  +I+ TDGG         NV V   A+EA
Sbjct: 218 GGEVFI----DFTKEKDIVGAVIKATDGGSHGVI----NVSVSEAAIEA 258

>NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118
          Length = 351

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 118/287 (41%), Gaps = 35/287 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P T  A +    G  L  + I V  PK++E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFETNGGKLEYKDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   K+GD+  I      C  C++C+ G  + C           
Sbjct: 67  VGGHEGAGVVVAMGDAVKGWKIGDYAGIKWLNGSCMSCEYCELGNESNC----------- 115

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P      +   G          +F QY            P + L  ++ + C   T Y 
Sbjct: 116 -PHADLSGYTHDG----------SFQQYATADAVQAARIAPGSDLAEVAPVLCAGITVY- 163

Query: 254 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+AN++ G+ VA+ GA G +G   +Q AK+ G  +++ +D  ++K +   D G   F
Sbjct: 164 KALKSANLRAGEWVAISGACGGLGSLAIQFAKAMG-YRVVGIDGGDEKAKMFKDLGGEVF 222

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHK 359
           +    D  + + IV  +I+ T+GG         NV V   A++A  K
Sbjct: 223 I----DFTKTKDIVGDIIKATNGGAHGVI----NVSVSEQAIDASVK 261

>SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar to
           uniprot|P35497 Saccharomyces cerevisiae YJR159W SOR1
           Sorbitol dehydrogenase expression is induced in the
           presence of sorbitol
          Length = 354

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 103/379 (27%), Positives = 158/379 (41%), Gaps = 64/379 (16%)

Query: 91  LTVEQIVV----DPPKAHEVRIKIEYTAVCHTDA--YTLSGIDPEGAF----PSILXXXX 140
           +T E I V    DP   H V++ I+ T +C +D   Y    I   G F    P +L    
Sbjct: 16  ITFEDIPVPQIEDP---HYVKLAIKKTGICGSDVHYYKTGAI---GNFVVKDPMVLGHES 69

Query: 141 XXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTS- 199
                      T+VKVGD V           K  KSG  NLC S+       +  DGT  
Sbjct: 70  SGVVVEVGSKVTSVKVGDRVAIEPGVPSRYSKATKSGHYNLCPSMAFAATPPI--DGTLL 127

Query: 200 RFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTA 259
           +++    + L+      +F +                    +  L  GV      A K A
Sbjct: 128 KYYLSPEDFLVKLPDSVSFEEGA-----------------CVEPLSVGVH-----ANKLA 165

Query: 260 NVQKGDTVAVFGAGTVGLSVVQGAKSR--GASKIIVVDINNDKKQWSFDFGATDFVNPKE 317
           +V+ G  V VFGAG VGL  + GA SR  GA+ ++ VD+ + K + + +FGAT  VN  +
Sbjct: 166 DVRFGSKVVVFGAGPVGL--LAGAVSRAFGATDVVFVDVFDHKLERTNEFGATQTVNSSK 223

Query: 318 DLKEGETIVQKLIEMTDGGL-EYTFDCTGNVKVMRDALEACHKGWXXXXX----XXXXXX 372
             K  + +V+++  +  G   E  F+C+G    +R  ++AC  G                
Sbjct: 224 -FKSEDDLVKEIQRVLSGEQPEVVFECSGAEVCIRAGIKACKAGGRYVQVGMGKDNVNFP 282

Query: 373 XXXXXTRPFQLV-TGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEIN 431
                ++  Q++ T R   G     +K  SE          GK+ V   ITHR  F +  
Sbjct: 283 ISEVVSKELQVLGTFRYCFGDYNDSVKLISE----------GKVNVKPLITHRFKFQDAI 332

Query: 432 DAFE-DLHHG-DCLRTVLD 448
            A+E ++ HG D ++T++D
Sbjct: 333 KAYEFNIEHGEDVVKTIID 351

>AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL086C (ADH1) and
           YBR145W (ADH5)
          Length = 351

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 113/284 (39%), Gaps = 35/284 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P T  A + Y  G PL    I V  PKA E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 7   PRTQKAVIFYENGGPLQYTDIEVPKPKATELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   K+GD   I      C  C++C+    + C           
Sbjct: 67  VGGHEGAGVVVAMGENVRGWKIGDLAGIKWLNGSCMACEYCEKSNESNC----------- 115

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P+     +   G          +F QY                L  ++ + C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY- 163

Query: 254 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+AN++ GD VA+ GA G +G   +Q A + G  +++ +D   +K+Q     G   F
Sbjct: 164 KALKSANLRAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKEQLFRQLGGEVF 222

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           +    D ++ + IV  +++ T+GG         NV V   A+E+
Sbjct: 223 I----DFRKSKDIVADVVKATNGGAHGVI----NVSVSEAAIES 258

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 104/264 (39%), Gaps = 31/264 (11%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGA-FPS 134
           P      + Y  G  L  + + V  PK +E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 45  PSMQKGVIFYEHGGELHYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL 104

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                TN ++GD+  I      C  C+ C+ G    C     +   G 
Sbjct: 105 VGGHEGAGVVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNCEHADLS---GY 161

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
             DG                   +F QY                L  I+ + C   T Y 
Sbjct: 162 THDG-------------------SFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTVY- 201

Query: 254 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+KTA+V+ G  VA+ G AG +G   VQ AK+ G  +++ +D   DKK+   D G   F
Sbjct: 202 KALKTADVRPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGEDKKKLFHDLGGETF 260

Query: 313 VNPKEDLKEGETIVQKLIEMTDGG 336
           +    D +  + +V  + E T GG
Sbjct: 261 I----DFRTTKDMVGAIQEATQGG 280

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 114/288 (39%), Gaps = 35/288 (12%)

Query: 72  TQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EG 130
           +Q  P    A V Y     L  + + V  PK +E+ + ++Y+ VCH+D +   G  P + 
Sbjct: 3   SQVIPEKQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQL 62

Query: 131 AFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQ 189
            FP I                   KVGD   I      C  C++C+ G  + C  +    
Sbjct: 63  KFPLIGGHEGAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYL---- 118

Query: 190 GKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVT 249
                 DGT   H+             TF +Y            P   L  ++ + C   
Sbjct: 119 ------DGTGFTHD------------GTFQEYATADAVQAAHIPPNVNLAEVAPILCAGI 160

Query: 250 TGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFG 308
           T Y  A+K ANV  G  V + GA G +G   +Q A + G  ++I +D  N K++     G
Sbjct: 161 TVY-KALKRANVIPGQWVTISGACGGLGSLAIQYALAMG-YRVIGIDGGNAKRKLFEQLG 218

Query: 309 ATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
              F+    D  E + IV  +I+ T+GG         NV V   A+EA
Sbjct: 219 GEIFI----DFTEEKDIVGAIIKATNGGSHGVI----NVSVSEAAIEA 258

>KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]
           {ON} highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 351

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 114/284 (40%), Gaps = 35/284 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGA-FPS 134
           P T    + Y  G  L  + I V  PKA+E+ + ++Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKGVIFYETGGKLEYKDIDVPTPKANELLVNVKYSGVCHTDLHAYHGDWPLPVKLPL 66

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   KVGD   I      C  C+ C+ G  + C           
Sbjct: 67  VGGHEGAGVVVAMGENVKGWKVGDLAGIKWLNGSCMSCESCELGNESNC----------- 115

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P+     +   G          +F QY              A L  I+ + C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQQYATADAVQAAKIPAGADLAEIAPILCAGITVY- 163

Query: 254 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+AN+Q GD VA+ G AG +G   VQ AK+ G  +++ +D   +K+Q     G   F
Sbjct: 164 KALKSANLQAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEEKEQLFRQLGGEVF 222

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           +    D +  + I  ++I+ T+GG         NV V   A+E+
Sbjct: 223 I----DFRTCKDIEGEIIKATNGGAHGVI----NVSVSEAAIES 258

>Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar to
           Ashbya gossypii AER032W
          Length = 348

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 106/264 (40%), Gaps = 31/264 (11%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P T  A + Y  G  L    I V  PK  E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKAVIFYENGGELKYTDIPVPKPKPSELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   K+GD   I      C  C++C+    + C           
Sbjct: 64  VGGHEGAGVVVAMGENVRGWKIGDFAGIKWLNGSCMTCEYCEKSNESNC----------- 112

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            PD     +   G          +F QY                L  ++ + C   T Y 
Sbjct: 113 -PDADLSGYTHDG----------SFQQYATADAVHAAKIPQGTDLAQVAPVLCAGITVY- 160

Query: 254 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+A +Q G+ VA+ GA G +G   VQ AK+ G  +I+ +D   +KK+   + G   F
Sbjct: 161 KALKSARLQAGEWVAISGASGGLGSLAVQYAKAMG-YRILGIDSGEEKKKLFKELGGEYF 219

Query: 313 VNPKEDLKEGETIVQKLIEMTDGG 336
           +    D  E + +V ++I++T+GG
Sbjct: 220 I----DFAESKDVVAEVIKVTNGG 239

>Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 108/276 (39%), Gaps = 31/276 (11%)

Query: 64  QNHYNMSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTL 123
           +N   + ST   P T    + Y     L  + I V  PK +E+ I ++Y+ VCHTD +  
Sbjct: 19  RNILRLQSTAAIPKTQKGVIFYENNGKLHYKDIPVPQPKPNEILINVKYSGVCHTDLHAW 78

Query: 124 SGIDPEGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNL 181
            G  P     P +                   KVGD   I      C  C+FC+SG  + 
Sbjct: 79  HGDWPLAVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESN 138

Query: 182 CGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSI 241
           C            P+     +   G          +F Q+            P   L  +
Sbjct: 139 C------------PEADLSGYTHDG----------SFQQFATADAIQAAKIQPGTDLAEV 176

Query: 242 SLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDK 300
           + + C   T Y  A+K AN++ GD VA+ G AG +G   VQ A + G  +++ +D   +K
Sbjct: 177 APILCAGVTVY-KALKEANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEK 234

Query: 301 KQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTDGG 336
           ++     G   F+    D  + + +V  + E T GG
Sbjct: 235 EKLFKQLGGEVFI----DFTKTKDMVSDIQEATKGG 266

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 84/349 (24%), Positives = 136/349 (38%), Gaps = 52/349 (14%)

Query: 108 IKIEYTAVCHTDAYTLSGIDPE---------GAFP-SILXXXXXXXXXXXXXXXTNVKVG 157
           IK+ +T++C TD     G +PE         G+F   IL                N K G
Sbjct: 60  IKMTHTSICGTDLGIWKGKNPEIEQTAQTKEGSFNGRILGHEGIGIIDEVGDAVHNFKKG 119

Query: 158 DHVIALYTAECGKCKFCKSGKTNLCGSVRATQGKG----VMPDGTSRFHNQKGEPLLHFM 213
           D VI    + CG C+ C     + C     T G G     M DGT     Q       F 
Sbjct: 120 DRVIVSCISRCGTCENCAKSLYSHC-----TNGGGWILGYMIDGT-----QAEYVRTPFA 169

Query: 214 GCSTFSQYTXXXXXXXXXXXPKAPLDSIS-LLGCGVTTGYGAAIKTANVQKGDTVAVFGA 272
             S +S              P+   D  + +L   + T +   ++  NV+ GDTVA+ GA
Sbjct: 170 DTSLYS-------------VPENLSDEAAVMLSDALPTAHEIGVQMGNVKPGDTVAIVGA 216

Query: 273 GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIVQKLIEM 332
           G VG+  V  ++    S +IVVDI++++   + + G+T  +N  +     E  V K++E 
Sbjct: 217 GPVGMGCVLTSQLYSPSLLIVVDIDDNRLAMAKEMGSTHTINSAK-----EDAVSKILEY 271

Query: 333 TDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXXXXXXXXXXTRPFQLVTGRVW--K 390
           T+G      DC       +   + C +                   +P      ++W   
Sbjct: 272 TNG---RGVDCVMEAVGAQATWDICQR----VIKEGGHLANVGVHGKPVNFEIDKLWIKN 324

Query: 391 GSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEINDAFEDLHH 439
            +   G+   +  G L++   +GKLK +  +TH   F E++  +    H
Sbjct: 325 LTITSGLVNTNTTGMLMKSCCSGKLKSERLVTHHCNFGEMSGNYNIFKH 373

>KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON}
           uniprot|P20369 Kluyveromyces lactis KLLA0F21010g ADH1
           Alcohol dehydrogenase 1
          Length = 350

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 112/283 (39%), Gaps = 35/283 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P T    + Y  G  L  + I V  PKA+E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 6   PETQKGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 65

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   K+GD   I      C  C++C+    + C           
Sbjct: 66  VGGHEGAGVVVAMGENVKGWKIGDFAGIKWLNGSCMSCEYCELSNESNC----------- 114

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P+     +   G          +F QY                L  ++ + C   T Y 
Sbjct: 115 -PEADLSGYTHDG----------SFQQYATADAVQAAKIPVGTDLAEVAPVLCAGVTVY- 162

Query: 254 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+AN++ GD VA+ G AG +G   VQ AK+ G  +++ +D   +K +   D G   F
Sbjct: 163 KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDAGEEKAKLFKDLGGEYF 221

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALE 355
           +    D  + + I +++IE T GG         NV V   A+E
Sbjct: 222 I----DFTKSKNIPEEVIEATKGGAHGVI----NVSVSEFAIE 256

>CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
           uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2
          Length = 352

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 115/291 (39%), Gaps = 35/291 (12%)

Query: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128
           M++    P T    + Y     L  + I V  PKA+E+ I ++Y+ VCHTD +   G  P
Sbjct: 1   MATLHAVPETQKGVIFYENNGKLEYKDIPVPKPKANEILINVKYSGVCHTDLHAWHGDWP 60

Query: 129 EGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVR 186
                P +                   K+GD+  I      C  C++C+    + C    
Sbjct: 61  LATKLPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESNC---- 116

Query: 187 ATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGC 246
                   P+     +   G          +F QY                L  ++ + C
Sbjct: 117 --------PEADLSGYTHDG----------SFQQYATADYVQAARIPQGTDLAQVAPILC 158

Query: 247 GVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSF 305
              T Y  A+K+AN+  G+ VA+ G AG +G   VQ AK+ G  +I+ +D  ++KK    
Sbjct: 159 AGITVY-KALKSANLNAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGDEKKALFH 216

Query: 306 DFGATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           + G   FV    D  + + + Q ++  T+GG         NV V   A+E+
Sbjct: 217 ELGGEIFV----DFTKSKNVEQDILVATNGGAHGVI----NVSVSEAAIES 259

>TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 108/269 (40%), Gaps = 31/269 (11%)

Query: 71  STQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEG 130
           ST   P T    + Y    PL  + I V  PK++E+ I +EY+ VCHTD +   G  P  
Sbjct: 28  STYQIPKTQKGVIFYENNGPLEYKDIPVPKPKSNEILINVEYSGVCHTDLHAWKGDWPLP 87

Query: 131 A-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRAT 188
              P +                 N K+GD   I      C  C+ C++G    C     +
Sbjct: 88  VKLPLVGGHEGAGVVVGMGDNVKNWKIGDLAGIKWLNGSCMSCELCENGFEANCEHADLS 147

Query: 189 QGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGV 248
              G   DG                   +F QY                L +++ + C  
Sbjct: 148 ---GYTHDG-------------------SFQQYATADAVQAARIPAGTDLANVAPILCAG 185

Query: 249 TTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDF 307
            T Y  A+KTA+++ GD VA+ G AG +G   VQ A + G  ++I +D   DKK+     
Sbjct: 186 VTVY-KALKTADLKPGDWVAISGAAGGLGSLAVQYAAAMGL-RVIGIDGGEDKKKLFEKC 243

Query: 308 GATDFVNPKEDLKEGETIVQKLIEMTDGG 336
           G   F+    D  + + IV+ + E T GG
Sbjct: 244 GGEVFI----DFTKSKDIVKDIQEATHGG 268

>KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3.118
           YBR145W
          Length = 350

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 114/284 (40%), Gaps = 35/284 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGA-FPS 134
           P T    +  + G PL  ++I V  PKA+E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 6   PETQMGVIFESNGGPLEYKEIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPL 65

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                 N  +GD+  I      C  C+ C+    + C           
Sbjct: 66  VGGHEGAGIVVAMGDSVKNWNIGDYAGIKWLNGSCMNCESCELANESNC----------- 114

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P      +   G          +F QY                L  ++ + C   T Y 
Sbjct: 115 -PQADLSGYTHDG----------SFQQYATADAVQAAKIPHGTDLAEVAPILCAGVTVY- 162

Query: 254 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+AN++ GD VA+ GA G +G   +Q A + G  +++ +D   +K +     G   F
Sbjct: 163 KALKSANLKAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKAELFKKLGGEYF 221

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           +    D  + + ++ +++E+TDGG         NV V   A+EA
Sbjct: 222 I----DFTKCKDVIAEILEVTDGGAHGVI----NVSVSEAAIEA 257

>SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} similar
           to uniprot|P00331 Saccharomyces cerevisiae YMR303C ADH2
           Glucose-repressible alcohol dehydrogenase II
          Length = 351

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 120/291 (41%), Gaps = 36/291 (12%)

Query: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128
           MS++Q  P T  A + Y  G  L  + I V  PK++E+ I ++Y+ VCHTD +   G  P
Sbjct: 1   MSASQ-IPKTQKAVIFYENGGELQYKDIPVPKPKSNEILINVKYSGVCHTDLHAWKGDWP 59

Query: 129 -EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVR 186
                P +                   K+GD+  I      C  C++C+    + C    
Sbjct: 60  LPTKLPLVGGHEGAGVVVAIGENVKGWKIGDYAGIKWLNGSCMACEYCELSNESNC---- 115

Query: 187 ATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGC 246
                   P+     +   G          +F QY                L  ++ + C
Sbjct: 116 --------PEADLSGYTHDG----------SFQQYATADAVQAARIPAGTDLAEVAPVLC 157

Query: 247 GVTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSF 305
              T Y  A+K+AN++ G+ VA+ GA G +G   +Q AK+ G  +++ +D   +K     
Sbjct: 158 AGITVY-KALKSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGEEKAALFK 215

Query: 306 DFGATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           + G   F+    D  + + +V+ +++ T+GG         NV V   A+EA
Sbjct: 216 ELGGEVFI----DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEA 258

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 84/375 (22%), Positives = 144/375 (38%), Gaps = 51/375 (13%)

Query: 82  AVAYAAGKPLTVEQIVVDPPKAHEVR---IKIEYTAVCHTDAYTLSGIDPE--------- 129
           A+ Y     L  E   +  PK  + R   IK+  T++C TD     G  PE         
Sbjct: 33  AMVYYGANDLRFEDRAI--PKIIDQRDAIIKMTNTSICGTDVGIWKGKSPEIEEIAVKNE 90

Query: 130 GAFP-SILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRAT 188
           G+F   +L                N+K GD VI      CG C+ C  G    C      
Sbjct: 91  GSFNGRVLGHEGTGIVTEVGDAVRNIKKGDKVIISCITRCGTCENCARGMYAHC------ 144

Query: 189 QGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSIS-LLGCG 247
                M DG        G  L + +  +                 P+   D  + LL   
Sbjct: 145 -----MNDG--------GWALGYSIDGTQAEYVRTPFADTSLYALPEGLSDENAVLLSDA 191

Query: 248 VTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDF 307
           + T +   ++  NV+ GD+VA+ GAG VG+  V  ++    S +IVVD+++++ + + + 
Sbjct: 192 LPTAHEIGVQMGNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLLIVVDMDDNRLEMAKEM 251

Query: 308 GATDFVNP-KEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXX 366
           GAT  +N  KED       V K++E+T+G      DC       +   + C +       
Sbjct: 252 GATHTINSGKEDA------VAKILEITNG---RGVDCAMEAVGAQPTWDICQQ----IIK 298

Query: 367 XXXXXXXXXXXTRPFQLVTGRVW--KGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHR 424
                       +P      ++W    +   G+   +    L+++  +GKL+ D+ ++H 
Sbjct: 299 EGGHLANVGVHGKPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKNCCSGKLQSDKLVSHH 358

Query: 425 RPFTEINDAFEDLHH 439
             F ++ + +    H
Sbjct: 359 CNFKDMANNYNIFKH 373

>KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON}
           uniprot|P49385 Kluyveromyces lactis ADH4 Alcohol
           dehydrogenase IV, mitochondrial precursor
          Length = 375

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 115/278 (41%), Gaps = 31/278 (11%)

Query: 62  LHQNHYNMSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAY 121
           + ++   ++S+   P T    + Y  G  L  + + V  PKA+E+ I ++Y+ VCHTD +
Sbjct: 17  VSRSFLRLNSSFAIPETQKGVIFYENGGKLEYKDLPVPKPKANEILINVKYSGVCHTDLH 76

Query: 122 TLSGIDPEGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKT 179
              G  P     P +                 N ++GD+  I      C  C+ C+ G  
Sbjct: 77  AWKGDWPLPVKLPLVGGHEGAGIVVAKGENVKNFEIGDYAGIKWLNGSCMSCELCEQGYE 136

Query: 180 NLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLD 239
           + C          +  D +   H+             +F QY                L 
Sbjct: 137 SNC----------LQADLSGYTHD------------GSFQQYATADAVQAAQIPKGTDLA 174

Query: 240 SISLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINN 298
            I+ + C   T Y  A+KTA+++ G  VA+ G AG +G   VQ AK+ G  +++ +D  +
Sbjct: 175 EIAPILCAGVTVY-KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGD 232

Query: 299 DKKQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTDGG 336
            K++     G   F+    D ++ + +V  + E T+GG
Sbjct: 233 GKEELFKQCGGEVFI----DFRKSKDMVADIQEATNGG 266

>NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 118/287 (41%), Gaps = 35/287 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P T  A +  + G PL  + I V  PK++E+ + I+Y+ VCHTD +   G  P +   P 
Sbjct: 7   PKTQKAIIFESNGGPLEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPLDTKLPL 66

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   K+GD+  +      C  C++C+ G  + C           
Sbjct: 67  VGGHEGAGIVVAIGDNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNC----------- 115

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P+     +   G          +F QY                L  ++ + C   T Y 
Sbjct: 116 -PNADLSGYTHDG----------SFQQYATADAVQAARIPAGTNLSEVAPILCAGMTVY- 163

Query: 254 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+AN++ G+ VA+ GA G +G   +Q A + G  +++ +D  +DK +         F
Sbjct: 164 KALKSANLRAGEWVAISGACGGLGSLCIQYANAMG-YRVLGIDGGDDKAKLFKQLHGEVF 222

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHK 359
           +    D  + + ++ ++ ++T+GG         NV V   A+EA  K
Sbjct: 223 I----DFTKTKDVISEVNKVTNGGAHGVI----NVSVSEAAIEASTK 261

>KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {ON}
           Anc_3.118 YBR145W
          Length = 351

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 113/284 (39%), Gaps = 35/284 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P T    + Y  G  L  + I V  PKA+E+ I ++Y+ VCHTD +   G  P +   P 
Sbjct: 7   PKTQKGVIFYENGGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWKGDWPLDVKLPL 66

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   K+GD+  I      C  C++C+    + C           
Sbjct: 67  VGGHEGAGVVVAMGENVRGWKIGDYAGIKWLNGSCMSCEYCELSNESNC----------- 115

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P+     +   G          +F QY                L  ++ + C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY- 163

Query: 254 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+AN+  G+ VA+ GA G +G   +Q AK+ G  +I+ +D  ++K     + G   F
Sbjct: 164 KALKSANLSAGEWVAISGACGGLGSLAIQYAKAMG-YRILGIDGGDEKAALFKELGGEVF 222

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           +    D  + + I   +IE T+GG         NV V   A+E+
Sbjct: 223 I----DFTKTKDIEAAVIEATNGGAHGVI----NVSVSEAAIES 258

>ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W
          Length = 370

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/290 (22%), Positives = 114/290 (39%), Gaps = 31/290 (10%)

Query: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128
           +SST   P T    + Y +G  L  + + V  P+ +E+ + ++Y+ VCHTD +   G  P
Sbjct: 19  LSSTISIPSTQKGVIFYESGGKLHYKDLAVPKPRNNEILVNVKYSGVCHTDLHAWKGDWP 78

Query: 129 -EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVR 186
            +   P +                 N ++GD   I      C  C+ C+ G  + C    
Sbjct: 79  LDTKLPLVGGHEGAGVVVAKGENVKNFEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHAD 138

Query: 187 ATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGC 246
            +   G   DG                   TF QY                L  ++ + C
Sbjct: 139 LS---GYTHDG-------------------TFQQYATADAIQAAHIPKGTDLAGVAPILC 176

Query: 247 GVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSF 305
              T Y  A++++  + G+ VA+ G AG +G    Q A++ G  +++ +D   DK +   
Sbjct: 177 AGVTVY-KALRSSGARPGEWVAISGAAGGLGSLATQYARAMGL-RVVGIDGGEDKAKLFK 234

Query: 306 DFGATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALE 355
             G   F+    D  + + I   ++E T GG     + + + K M  ++E
Sbjct: 235 SLGGEIFI----DFTKEKDIPAAILEATQGGAHGVINVSVSEKAMSQSVE 280

>KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 115/291 (39%), Gaps = 32/291 (10%)

Query: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128
           + ST   P      + Y  G PLT + + V  PK +E+ I ++Y+ VCHTD +   G  P
Sbjct: 23  LQSTIAIPKMQKGVIFYENGGPLTYKDMPVPVPKPNEILINVKYSGVCHTDLHAWKGDWP 82

Query: 129 EGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVR 186
                P +                 N ++GD   I      C  C+ C+ G  + C    
Sbjct: 83  LPVKLPLVGGHEGAGIVVAKGSNVKNFEIGDLAGIKWLNGSCMACELCEKGYESNCEHAD 142

Query: 187 ATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGC 246
            +   G   DG                   +F QY                L  ++ + C
Sbjct: 143 LS---GYTHDG-------------------SFQQYATADATQAAQIPRGTDLAEVAPILC 180

Query: 247 GVTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSF 305
              T Y  A+KTA +Q G+ VA+ GA G +G   +Q AK+ G  +++ +D    K +   
Sbjct: 181 AGVTVY-KALKTAALQPGEWVAISGACGGLGSLAIQYAKAMGL-RVLGIDGGEAKAKMFK 238

Query: 306 DFGATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           + G   F++  +  K  E +++ + E T GG +       NV V   A+ A
Sbjct: 239 ELGGETFIDFTK-YKNNEAMIKDIQEATKGGPQGVI----NVSVSEAAISA 284

>ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|P00330 Saccharomyces cerevisiae
           YOL086C ADH1 Alcohol dehydrogenase involved in the
           production of certain carboxylate esters
          Length = 379

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 110/287 (38%), Gaps = 35/287 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P T    V   +  PL  ++I V  PK +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 35  PKTQKGVVFNESNGPLEYKEIPVPTPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPL 94

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                 N KVGD   I      C  C+ C+    + C           
Sbjct: 95  VGGHEGAGEVIALGSNVKNWKVGDLAGIKWLNGSCMSCESCEQSNESNC----------- 143

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            PD     +   G          +F QY            P   L  ++ + C   T Y 
Sbjct: 144 -PDADLSGYTHDG----------SFQQYATADAVQAAHIPPGTDLAEVAPVLCAGITVY- 191

Query: 254 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+AN++ G  VA+ G AG +G   VQ AK+ G  +++ +D    K++     G   F
Sbjct: 192 KALKSANLKAGQWVAISGAAGGLGSLAVQFAKAMGL-RVVGIDGGPGKEELFKTLGGEVF 250

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHK 359
           +    D ++   IV  ++  T+GG         NV V   A+ A  K
Sbjct: 251 I----DFQKESDIVGAVVNATNGGAHGVV----NVSVSEGAISASTK 289

>Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 107/276 (38%), Gaps = 31/276 (11%)

Query: 64  QNHYNMSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTL 123
           +N   + ST   P T    + Y     L  + I V  PK +E+ I ++Y+ VCHTD +  
Sbjct: 19  RNILRLQSTIAIPQTQKGVIFYENNGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAW 78

Query: 124 SGIDPEGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNL 181
            G  P     P +                   KVGD   I      C  C+FC+SG  + 
Sbjct: 79  HGDWPLPVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESN 138

Query: 182 CGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSI 241
           C            PD     +   G          +F Q+                L  +
Sbjct: 139 C------------PDADLSGYTHDG----------SFQQFATADAIQAAKIQQGTDLAEV 176

Query: 242 SLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDK 300
           + + C   T Y  A+K AN++ GD VA+ G AG +G   VQ A + G  +++ +D   +K
Sbjct: 177 APILCAGVTVY-KALKEANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGAEK 234

Query: 301 KQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTDGG 336
           ++     G   F+    D  + + +V  + E T GG
Sbjct: 235 EKLFKQLGGEVFI----DFTKTKDMVSDIQEATKGG 266

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 114/289 (39%), Gaps = 35/289 (12%)

Query: 71  STQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-E 129
           S+Q  P T  A V Y     L  + + V  PK +E+ + ++Y+ VCH+D +   G  P +
Sbjct: 2   SSQVVPKTQKAIVFYETDGKLEYKDVAVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQ 61

Query: 130 GAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRAT 188
             FP I                   KVGD   I      C  C++C+ G  + C  +   
Sbjct: 62  LKFPLIGGHEGAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQCPHL--- 118

Query: 189 QGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGV 248
                  DGT   H+             TF +Y                L  ++ + C  
Sbjct: 119 -------DGTGFTHD------------GTFQEYATADAVQAAHIPQNVDLAEVAPILCAG 159

Query: 249 TTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDF 307
            T Y  A+K AN+  G  V + GA G +G   VQ A + G  ++I +D    K++   + 
Sbjct: 160 ITVY-KALKRANLMPGQWVTISGACGGLGSLAVQYALAMG-YRVIGIDGGEAKQKLFEEL 217

Query: 308 GATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
               F+    D  + + +V  +I+ TDGG         NV V   A+EA
Sbjct: 218 HGEIFI----DFTKEKDVVGAVIKATDGGSHGVI----NVSVSEAAIEA 258

>SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON}
           uniprot|Q9P8S5 Saccharomyces kluyveri Alcohol
           dehydrogenase isozyme 3
          Length = 373

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 113/294 (38%), Gaps = 38/294 (12%)

Query: 46  SKAHLYCSPTFTQVKGLHQNHYNMSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHE 105
           ++A L   P F       Q  +   +T   P      + Y  G  L  E I V  PK +E
Sbjct: 6   TRASLTARPFF-------QGSFRTMATASIPEKQKGIIFYENGGELKYEDIPVPKPKPNE 58

Query: 106 VRIKIEYTAVCHTDAYTLSGIDP-EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IAL 163
           + I ++Y+ VCHTD +   G  P     P +                   K+GD   I  
Sbjct: 59  LLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMGENVKGWKIGDLAGIKW 118

Query: 164 YTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTX 223
               C  C++C+    + C     +   G   DG                   +F QY  
Sbjct: 119 LNGSCLSCEYCEKSNESNCPHADLS---GYTHDG-------------------SFQQYAT 156

Query: 224 XXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQG 282
                         L  +S + C   T Y  A+K+AN++ GD VA+ G AG +G   VQ 
Sbjct: 157 ADYVQAARIPEGTDLAEVSPILCAGVTVY-KALKSANLKAGDWVAISGAAGGLGSLAVQY 215

Query: 283 AKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTDGG 336
           AK+ G  +++ +D   +K +     G   F+    D  + + +V+ + E T+GG
Sbjct: 216 AKAMG-YRVLGIDGGAEKGELVKKLGGEVFI----DFTKHKNLVEAVQEATNGG 264

>KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]
           {ON} similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 89/366 (24%), Positives = 151/366 (41%), Gaps = 56/366 (15%)

Query: 97  VVDPPKAHEVRIKIEYTAVCHTDA-YTLSGIDPEGAF----PSILXXXXXXXXXXXXXXX 151
           + DP   H V+++I+ T +C +D  Y ++G    G F    P IL               
Sbjct: 26  ITDP---HYVKLQIKKTGICGSDVHYYVAG--AIGDFVVKKPMILGHESSGLVVEVGSEV 80

Query: 152 TNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGT-SRFHNQKGEPLL 210
           + V+VGD V              K+G+ NLC  ++      +  DGT  +++    + L+
Sbjct: 81  SRVRVGDRVAIEPGVPSRYSDETKAGRYNLCPHMQFAATPPI--DGTLVKYYLAPEDFLV 138

Query: 211 HFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTANVQKGDTVAVF 270
                 ++ +                    +  L  GV      A K A V     VAVF
Sbjct: 139 KLPDHVSYEEGAL-----------------VEPLSVGVH-----ANKLAGVAFNQRVAVF 176

Query: 271 GAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIVQKLI 330
           GAG VGL     A++ GAS+++ +D+   K   S +FG T FVN   ++K+ + +V++ I
Sbjct: 177 GAGPVGLLTGAVARAFGASEVVYIDVFEHKLSLSSNFGGTQFVN-SANIKDEDDLVKE-I 234

Query: 331 EMTDGGL--EYTFDCTGNVKVMRDALEACHKGWXXXXXXXXXXXXXXXXTRPFQLVTGRV 388
           E   GG   +  FDCTG    +R  ++ C+ G                   P   +  + 
Sbjct: 235 ERVLGGARPDVVFDCTGAEICIRTGIKVCNSGG----TYVQVGMGHDDVNFPIGAIGAKE 290

Query: 389 WK-----GSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEINDAFE-DLHHG-D 441
            K       AFG  +   ++        +G + V   +THR  F +   A+E ++ HG +
Sbjct: 291 LKVLGCFRYAFGDYRDAVQL------IASGDVNVKPLVTHRFKFEDAEAAYEFNIKHGSE 344

Query: 442 CLRTVL 447
            ++T++
Sbjct: 345 VIKTII 350

>NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480
          Length = 381

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 110/280 (39%), Gaps = 33/280 (11%)

Query: 62  LHQNHYNMSSTQGK--PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTD 119
           + +N   + ST     P T  A V Y  G PL  + I V  PKA+E+ I ++Y+ VCHTD
Sbjct: 21  IFKNFLRLQSTAAGSIPKTQKAVVFYENGGPLHYKDIPVPKPKANEILINVKYSGVCHTD 80

Query: 120 AYTLSGIDP-EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSG 177
            +   G  P     P +                   KVGD   I      C  C+ C++G
Sbjct: 81  LHAWKGDWPLPTKLPLVGGHEGSGVVMQVGENVKGWKVGDLAGIKWLNGSCMACELCETG 140

Query: 178 KTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAP 237
             + C     +   G   DG                   +F QY                
Sbjct: 141 NESNCEHADLS---GYTHDG-------------------SFQQYATADAVQAARIPEGTN 178

Query: 238 LDSISLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDI 296
           L  ++ + C   T Y  A+K A+++ G  V + G AG +G   VQ AK+ G  ++I +D 
Sbjct: 179 LAEVAPILCAGITVY-KALKEADLKAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDG 236

Query: 297 NNDKKQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTDGG 336
              K++     G   F+    D  + + +V+ + E T GG
Sbjct: 237 GKAKEELFKSMGGEVFI----DFTKSKDMVKDIQEATKGG 272

>KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {ON}
           uniprot|P49384 Kluyveromyces lactis KLLA0B09064g ADH3
           Alcohol dehydrogenase III mitochondrial precursor
          Length = 374

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 114/287 (39%), Gaps = 41/287 (14%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGAFPSI 135
           P T    + Y  G  L  + I V  PK +E+ I ++Y+ VCHTD +   G  P    P+ 
Sbjct: 30  PETQKGVIFYENGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWP---LPTK 86

Query: 136 LXXXXX-XXXXXXXXXXTNVK---VGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQG 190
           L                 NVK   +GD   I      C  C++C+    + C        
Sbjct: 87  LPLVGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC-------- 138

Query: 191 KGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTT 250
               PD     +   G          +F QY                L  ++ + C   T
Sbjct: 139 ----PDADLSGYTHDG----------SFQQYATADAVQAARIPKGTDLAEVAPILCAGVT 184

Query: 251 GYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGA 309
            Y  A+K+AN++ GD VA+ G AG +G   VQ AK+ G  +++ +D   +K +     G 
Sbjct: 185 VY-KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKGKLVKQLGG 242

Query: 310 TDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
             FV    D  + + +V ++ E+T+GG         NV V   A+ A
Sbjct: 243 EAFV----DFTKTKDMVAEIQEITNGGPHGVI----NVSVSEAAMNA 281

>YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}
           ADH3Mitochondrial alcohol dehydrogenase isozyme III;
           involved in the shuttling of mitochondrial NADH to the
           cytosol under anaerobic conditions and ethanol
           production
          Length = 375

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 107/276 (38%), Gaps = 31/276 (11%)

Query: 64  QNHYNMSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTL 123
           +N   + ST   P T    + Y     L  + I V  PK +E+ I ++Y+ VCHTD +  
Sbjct: 19  RNILRLQSTAAIPKTQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAW 78

Query: 124 SGIDPEGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNL 181
            G  P     P +                   KVGD   I      C  C+FC+SG  + 
Sbjct: 79  HGDWPLPVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESN 138

Query: 182 CGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSI 241
           C            PD     +   G          +F Q+                L  +
Sbjct: 139 C------------PDADLSGYTHDG----------SFQQFATADAIQAAKIQQGTDLAEV 176

Query: 242 SLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDK 300
           + + C   T Y  A+K A+++ GD VA+ G AG +G   VQ A + G  +++ +D   +K
Sbjct: 177 APILCAGVTVY-KALKEADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEK 234

Query: 301 KQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTDGG 336
           ++     G   F+    D  + + +V  + E T GG
Sbjct: 235 EKLFKKLGGEVFI----DFTKTKNMVSDIQEATKGG 266

>NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON}
           Anc_2.480
          Length = 373

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 109/282 (38%), Gaps = 31/282 (10%)

Query: 58  QVKGLHQNHYNMSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCH 117
           Q   L ++   + ST   P      + Y  G PL  + I V  PKA+E+ I ++Y+ VCH
Sbjct: 11  QQTSLMKSFLRLQSTVTIPKMQKGVIFYETGGPLHYKDIPVPKPKANEILINVKYSGVCH 70

Query: 118 TDAYTLSGIDPEGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCK 175
           TD +   G  P     P +                   K+GD   I      C  C+ C+
Sbjct: 71  TDLHAWKGDWPLATKLPLVGGHEGSGEVVAMGENVKGWKIGDLAGIKWLNGSCMSCELCE 130

Query: 176 SGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPK 235
           SG  + C     +   G   DG                   +F QY              
Sbjct: 131 SGHESNCEHADLS---GYTHDG-------------------SFQQYATADAVQAARIPKG 168

Query: 236 APLDSISLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVV 294
             +  ++ + C   T Y  A+K A+++ G  V + G AG +G   VQ AK+ G  ++I +
Sbjct: 169 TNMAEVAPILCAGITVY-KALKEADMRAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGI 226

Query: 295 DINNDKKQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTDGG 336
           D    K++     G   FV    D  + + IV ++ E T GG
Sbjct: 227 DGGPGKEELFKSLGGEIFV----DFTKTKDIVAEIQEATRGG 264

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 112/289 (38%), Gaps = 35/289 (12%)

Query: 71  STQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-E 129
           S+Q  P T  A V Y     L  + + V  PK +E+ + ++Y+ VCH+D +   G  P +
Sbjct: 2   SSQAIPKTQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQ 61

Query: 130 GAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRAT 188
             FP I                   KVGD   I      C  C++C+ G  + C  +   
Sbjct: 62  LKFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL--- 118

Query: 189 QGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGV 248
                  DGT   H+             TF +Y                L  ++ + C  
Sbjct: 119 -------DGTGFTHD------------GTFQEYATADAVQAAHIPQNVNLAEVAPILCAG 159

Query: 249 TTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDF 307
            T Y  A+K AN+  G  V + GA G +G   +Q A + G  ++I +D    K++     
Sbjct: 160 ITVY-KALKRANLMPGQWVTISGACGGLGSLAIQYALAMG-FRVIGIDGGEAKRKLFEKL 217

Query: 308 GATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           G   F+    D  +   +   +I+ T+GG         NV V   A+EA
Sbjct: 218 GGEIFI----DFTKERDVAGAVIKATNGGSHGII----NVSVSEAAIEA 258

>Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 114/287 (39%), Gaps = 41/287 (14%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGAFPSI 135
           P T    + Y +   L  + I V  PKA+E+ I ++Y+ VCHTD +   G  P    P+ 
Sbjct: 4   PKTQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWP---LPTK 60

Query: 136 L-XXXXXXXXXXXXXXXTNVK---VGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQG 190
           L                 NVK   +GD   I      C  C++C+ G  + C        
Sbjct: 61  LPLVGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNC-------- 112

Query: 191 KGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTT 250
               P      +   G          +F QY            P   L  ++ + C   T
Sbjct: 113 ----PHADLSGYTHDG----------SFQQYATADAVQAAHVAPGTDLAEVAPVLCAGIT 158

Query: 251 GYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGA 309
            Y  A+K+AN+  G  VA+ G AG +G   VQ AK+ G  ++I +D    K++     G 
Sbjct: 159 VY-KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGEGKEELFRSIGG 216

Query: 310 TDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
             FV    D  + + IV  +++ T+GG         NV V   A+EA
Sbjct: 217 EVFV----DFTKEKDIVGAVLKATNGGAHGVI----NVSVSEAAIEA 255

>Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ABL033C
          Length = 375

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 67/270 (24%), Positives = 108/270 (40%), Gaps = 31/270 (11%)

Query: 70  SSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPE 129
           S++ G P+T  A + Y  G  L  + I V  PK +E+ + ++Y+ VCHTD +   G  P 
Sbjct: 25  STSSGIPLTQKAVIFYEHGDKLHYKDIPVPKPKPNEILVNVKYSGVCHTDIHAWKGDWPL 84

Query: 130 GA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRA 187
               P +                TN ++GD+  +      C  C++C++G  + C     
Sbjct: 85  ATKLPLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKWLNKSCMSCEYCETGHESNCAEADL 144

Query: 188 TQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCG 247
           +   G   DG                   +F QY                L  ++ + C 
Sbjct: 145 S---GYTRDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCA 182

Query: 248 VTTGYGAAIKTANVQKGDTVAV-FGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFD 306
             T Y  A+KTAN+  G  VA+    G +G   VQ AK+ G  +++ +D    K      
Sbjct: 183 GVTVY-KALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGL-RVVGIDGGAAKDALFKK 240

Query: 307 FGATDFVNPKEDLKEGETIVQKLIEMTDGG 336
            G   F+    D  + + IV  + E T+GG
Sbjct: 241 LGGEVFI----DFTKSKDIVADIQEATNGG 266

>SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON}
           uniprot|Q6XQ71 Saccharomyces kluyveri ADH4 Alcohol
           dehydrogenase 4
          Length = 377

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 107/274 (39%), Gaps = 31/274 (11%)

Query: 66  HYNMSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSG 125
            +N +     P T    + Y +G  L  + I V  PK +E+ I ++Y+ VCHTD +   G
Sbjct: 23  RFNSTVAPAIPTTQKGVIFYESGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKG 82

Query: 126 IDP-EGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCG 183
             P     P +                 N ++GD   I      C  C+ C+ G  + C 
Sbjct: 83  DWPLPTKLPLVGGHEGAGVVVAKGENVMNFEIGDLAGIKWLNGSCMACELCEQGHESNC- 141

Query: 184 SVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISL 243
                    +  D +   H+             +F QY                L  ++ 
Sbjct: 142 ---------LHADLSGYTHD------------GSFQQYATADAVQAAQIPKGTDLAEVAP 180

Query: 244 LGCGVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQ 302
           + C   T Y  A+KTA+++ G  VA+ G AG +G   VQ AK+ G  +I+ +D    K++
Sbjct: 181 ILCAGVTVY-KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RILGIDGGPGKEE 238

Query: 303 WSFDFGATDFVNPKEDLKEGETIVQKLIEMTDGG 336
                G   F+    D  + + IV  + E T GG
Sbjct: 239 LFKSLGGEVFI----DFTKTKDIVSAIQEATKGG 268

>Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 108/278 (38%), Gaps = 31/278 (11%)

Query: 62  LHQNHYNMSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAY 121
           + +N   + ST   P T    + Y     L  + I V  PK +E+ I ++Y+ VCHTD +
Sbjct: 17  ISRNILRLQSTAAIPETQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLH 76

Query: 122 TLSGIDPEGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKT 179
              G  P     P +                   K+GD   I      C  C+FC+SG  
Sbjct: 77  AWHGDWPLPVKLPLVGGHEGAGVVVKLGSNVKGWKIGDLAGIKWLNGSCMTCEFCESGHE 136

Query: 180 NLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLD 239
           + C            PD     +   G          +F Q+                L 
Sbjct: 137 SNC------------PDADLSGYTHDG----------SFQQFATADAIQAAKIQQGTDLA 174

Query: 240 SISLLGCGVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINN 298
            ++ + C   T Y  A+K A+++ GD VA+ G AG +G   VQ A + G  +++ +D   
Sbjct: 175 EVAPILCAGVTVY-KALKEADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGE 232

Query: 299 DKKQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTDGG 336
           +K++     G   F+    D  + + +V  + E T GG
Sbjct: 233 EKEKLFKKLGGEVFI----DFTKTKDMVSDIQEATKGG 266

>NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON}
           Anc_3.118
          Length = 351

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 114/286 (39%), Gaps = 31/286 (10%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGA-FPS 134
           P T  A +    G  L  + I V  PK+ E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFETNGGKLEYKDIPVPVPKSTEILINVKYSGVCHTDLHAWKGDWPLATKLPL 66

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   KVGD   I      C  C++C+ G  + C           
Sbjct: 67  VGGHEGAGIVVQVGENVQGWKVGDLAGIKWLNGSCMACEYCELGNESNC----------- 115

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P+     +   G          +F QY                L  ++ + C   T Y 
Sbjct: 116 -PNADLSGYTHDG----------SFQQYATADAVQAARIPQGTDLAEVAPVLCAGITVY- 163

Query: 254 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+AN++ G+ VA+ G AG +G   VQ AK+ G  +I+ +D   +K++   + G   F
Sbjct: 164 KALKSANLRAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGEEKEKLFRELGGEIF 222

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACH 358
           +    D  + + IV  +I+ T+GG     + + +   +  + E C 
Sbjct: 223 I----DFTKTKDIVGDIIKATNGGAHGVINVSVSEAAIGASTEYCR 264

>KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]
           {ON} uniprot|P49383 Kluyveromyces lactis KLLA0F18260g
           ADH2 Alcohol dehydrogenase 2
          Length = 348

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 116/286 (40%), Gaps = 41/286 (14%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGAFPSI 135
           P T    + Y  G  L  + I V  PKA+E+ I ++Y+ VCHTD +   G  P    P+ 
Sbjct: 4   PETQKGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWP---LPTK 60

Query: 136 L-XXXXXXXXXXXXXXXTNVK---VGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQG 190
           L                 NVK   +GD   I      C  C++C+    + C        
Sbjct: 61  LPLVGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC-------- 112

Query: 191 KGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTT 250
               PD     +   G          +F QY                L  ++ + C   T
Sbjct: 113 ----PDADLSGYTHDG----------SFQQYATADAVQAARIPKGTDLAEVAPILCAGVT 158

Query: 251 GYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGA 309
            Y  A+K+A+++ GD VA+ GA G +G   +Q AK+ G  +++ +D   +K +   + G 
Sbjct: 159 VY-KALKSADLKAGDWVAISGACGGLGSLAIQYAKAMG-YRVLGIDTGAEKAKLFKELGG 216

Query: 310 TDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALE 355
             FV    D    + +++++++ T+GG         NV V   A+E
Sbjct: 217 EYFV----DYAVSKDLIKEIVDATNGGAHGVI----NVSVSEFAIE 254

>KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 348

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 113/284 (39%), Gaps = 35/284 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGA-FPS 134
           P T  A V    G  L  + I V  P A+E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKAVVFETNGGELEYKDIPVPKPAANEILINVKYSGVCHTDLHAWKGDWPLATKLPL 63

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   K+GD   I      C  C+ C+    + C           
Sbjct: 64  VGGHEGAGVVVGIGENVKGWKLGDLAGIKWLNGSCMACESCELSNESNC----------- 112

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P      +   G          +F QY                L  ++ + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY- 160

Query: 254 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+AN++ G+ VA+ G AG +G   VQ AK+ G  ++I +D  ++K+Q     G   F
Sbjct: 161 KALKSANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGDEKEQLFKKLGGEYF 219

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           V    D ++ + +V +++E+T GG         NV V   A+E+
Sbjct: 220 V----DFRKSKDVVAEILEVTGGGAHGVV----NVSVSEAAIES 255

>TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 115/284 (40%), Gaps = 35/284 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P T  A + Y +G  L  + + V  PK +E+ I I+Y+ VCHTD +   G  P +   P 
Sbjct: 7   PKTQKAVIFYESGGALEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPL 66

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           I                   K+GD+  +      C  C+ C+    + C           
Sbjct: 67  IGGHEGAGVVVGMGANVRGWKIGDYAGVKWLNGSCMSCEECELSNESNC----------- 115

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P+     +   G          +F +Y              A L  ++ + C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQEYCTADAVQAARIPQGADLAEVAPILCAGVTVY- 163

Query: 254 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+A++  G+ VA+ GA G +G   VQ AK+ G  +++ +D   +KK+   + G   F
Sbjct: 164 KALKSADLAAGEWVAISGACGGLGSLAVQFAKAMGL-RVLGIDGGEEKKKMFHEMGGEVF 222

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           +    D +  + +   +I+ T+GG         NV V   A+EA
Sbjct: 223 L----DFRLEKDMEAAVIKATNGGAHGVI----NVSVSEAAIEA 258

>YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON}
           ADH1Alcohol dehydrogenase, fermentative isozyme active
           as homo- or heterotetramers; required for the reduction
           of acetaldehyde to ethanol, the last step in the
           glycolytic pathway
          Length = 348

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 111/284 (39%), Gaps = 35/284 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGA-FPS 134
           P T    + Y +   L  + I V  PKA+E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPL 63

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   K+GD+  I      C  C++C+ G  + C           
Sbjct: 64  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNC----------- 112

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P      +   G          +F QY                L  ++ + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVY- 160

Query: 254 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+AN+  G  VA+ G AG +G   VQ AK+ G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVF 219

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           +    D  + + IV  +++ TDGG         NV V   A+EA
Sbjct: 220 I----DFTKEKDIVGAVLKATDGGAHGVI----NVSVSEAAIEA 255

>TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 113/284 (39%), Gaps = 35/284 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P T  A + Y  G PL  + + V  PK +E+ I I+Y+ VCHTD +   G  P +   P 
Sbjct: 7   PQTQKAVIFYKNGGPLEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPL 66

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           I                   K+GD+  +      C  C+ C+    + C           
Sbjct: 67  IGGHEGAGVVVGMGSNVKGWKIGDYAGVKWLNGSCMSCEECELSNESNC----------- 115

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P+     +   G          +F +Y                L  ++ L C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQEYCTADAVQAARIPQGTDLAQVAPLLCAGVTVY- 163

Query: 254 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+A++  G  VA+ GA G +G   +Q AK+ G  +++ +D   +KK+   + G   F
Sbjct: 164 KALKSADLAAGQWVAISGACGGLGSLAIQFAKAMGL-RVLGIDGGEEKKKMFHELGGEVF 222

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           +    D +  + +   +I+ T+GG         NV V   A+E+
Sbjct: 223 L----DFRLEKDMEAAIIKATNGGAHGVI----NVSVSEAAIES 258

>Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 111/284 (39%), Gaps = 35/284 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGA-FPS 134
           P T    + Y +   L  + I V  PK +E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESNGKLEHKDIPVPTPKPNELLINVKYSGVCHTDLHAWHGDWPLATKLPL 63

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   KVGD   I    + C  C++C+ G  + C           
Sbjct: 64  VGGHEGAGVVVAMGENVRGWKVGDLAGIKWLNSSCMACEYCELGNESNC----------- 112

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P      +   G          +F QY                L  ++ + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAAHIPEGTDLAEVAPILCAGITVY- 160

Query: 254 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+AN++ G  VA+ G AG +G   VQ AK+ G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGPGKEELFTSLGGEVF 219

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           +    D  + + IV  +I+ TDGG         NV V   A+EA
Sbjct: 220 I----DFTKEKDIVGAVIKATDGGAHGIV----NVSVSEAAIEA 255

>Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {ON}
           YLR070C (REAL)
          Length = 356

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 97/200 (48%), Gaps = 15/200 (7%)

Query: 255 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVN 314
           A + A ++ G    VFGAG VGL   + A   GA+ ++ VD++  K + +  FGAT  VN
Sbjct: 163 ANRLAKMRFGARCVVFGAGPVGLLTGKVASVFGATDVVFVDLSETKLERAKQFGATHMVN 222

Query: 315 PKEDLKEG---ETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXXXX 371
              DL +G   ET+++K I     G +  F+C+G    +R  +E C  G           
Sbjct: 223 -SGDLPQGVSAETVIRKAI--GKKGADVVFECSGAQPCIRTGIEVCKAGGTYVQVGMGQE 279

Query: 372 XXXXXXTR-PFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEI 430
                 ++ P + +T   ++GS F   +G  +    IE   +GKL +   IT R  F E 
Sbjct: 280 EIQFPISKIPAKEIT---FQGS-FRYCQG--DYSDSIELVSSGKLSLKPLITRRYQFKEA 333

Query: 431 NDAFEDL--HHGDCLRTVLD 448
            +AF++   H  D ++T+++
Sbjct: 334 IEAFDENRDHPLDNVKTIIE 353

>Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 114/287 (39%), Gaps = 41/287 (14%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGAFPSI 135
           P T    + Y +   L  + I V  PKA+E+ I ++Y+ VCHTD +   G  P    P+ 
Sbjct: 4   PETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWP---LPTK 60

Query: 136 L-XXXXXXXXXXXXXXXTNVK---VGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQG 190
           L                 NVK   +GD+  I      C  C++C+ G  + C        
Sbjct: 61  LPLVGGHEGAGVVVAMGENVKGWNIGDYAGIKWLNGSCMACEYCELGNESNC-------- 112

Query: 191 KGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTT 250
               P      +   G          +F QY                L  ++ + C   T
Sbjct: 113 ----PHADLSGYTHDG----------SFQQYATADAVQAAHIPQGTDLAEVAPVLCAGIT 158

Query: 251 GYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGA 309
            Y  A+K+AN+  G  VA+ G AG +G   VQ AK+ G  +++ +D    K++     G 
Sbjct: 159 VY-KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGG 216

Query: 310 TDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
             F+    D  + + IV  +++ TDGG         NV V   A+EA
Sbjct: 217 EVFI----DFTKEKDIVNAVLKATDGGAHGVI----NVSVSEAAIEA 255

>AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR303C (ADH2)
          Length = 385

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 114/289 (39%), Gaps = 35/289 (12%)

Query: 71  STQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-E 129
           S+   P T  A V    G PL   +I V  PK  E+ I ++Y+ VCHTD +   G  P  
Sbjct: 36  SSPSIPKTQHAIVFDKNGGPLEYREIEVPEPKPTELLINVKYSGVCHTDLHAWKGDWPLP 95

Query: 130 GAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRAT 188
              P +                   +VGD   I      C  C+ C+ G  + C      
Sbjct: 96  TKLPLVGGHEGAGVVVAMGENVRGWQVGDLAGIKWLNGSCMSCEACEQGHESNC------ 149

Query: 189 QGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGV 248
                 P+     +   G          +F QY                L  ++ + C  
Sbjct: 150 ------PEADLSGYTHDG----------SFQQYATADAVQAAHIPAGTDLAQVAPILCAG 193

Query: 249 TTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDF 307
            T Y  A+K+AN++ G+ VA+ GA G +G   +Q A++ G  +++ +D  ++K+      
Sbjct: 194 ITVY-KALKSANLRAGNWVAISGACGGLGSLAIQYARAMG-YRVLEIDGGDEKEALFRKL 251

Query: 308 GATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           G   FV    D ++ + +V  +++ T GG         NV V   A+E+
Sbjct: 252 GGEVFV----DFRKSKDVVADVVKATGGGAHGVI----NVSVSEAAIES 292

>Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 113/287 (39%), Gaps = 35/287 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P T    + Y +   L  + I V  PK +E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYESNGKLEHKNIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   KVGD   +    + C  C++C+ G  + C           
Sbjct: 64  VGGHEGAGVVVAIGDNVRGWKVGDLAGVKWLNSSCMACEYCELGNESNC----------- 112

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P      +   G          +F QY                L  ++ + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY- 160

Query: 254 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+AN++ G+ VA+ G AG +G   VQ AK+ G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKQELFTSLGGEVF 219

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHK 359
           +    D  + + I+  +++ TDGG         NV V   A+EA  K
Sbjct: 220 I----DFTKEKDIIGAVVKATDGGAHGII----NVSVSEAAIEASTK 258

>Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 111/284 (39%), Gaps = 35/284 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P T    + Y +   L  + I V  PK +E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   KVGD   I    + C  C++C+ G  + C           
Sbjct: 64  VGGHEGAGVVVAIGDNVRGWKVGDLAGIKWLNSSCMACEYCELGNESNC----------- 112

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P      +   G          +F QY                L  ++ + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAARIPEGTDLAQVAPILCAGITVY- 160

Query: 254 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+AN++ G  VA+ G AG +G   VQ AK+ G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFTSLGGEVF 219

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           +    D  + + IV  +++ TDGG         NV V   A+EA
Sbjct: 220 I----DFTKEKDIVSAVVKATDGGAHGIV----NVSVSEAAIEA 255

>KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar to
           uniprot|P39713 Saccharomyces cerevisiae YAL061W putative
           polyol dehydrogenase
          Length = 382

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 71/311 (22%), Positives = 114/311 (36%), Gaps = 73/311 (23%)

Query: 82  AVAYAAGKPLTVEQIVVDPPKAHE--VRIKIEYTAVCHTD----------------AYTL 123
           A+AY   K +     +  P  +HE  V I + +  VC +D                 + +
Sbjct: 3   ALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHEYLDGPIFFPANGKTHAM 62

Query: 124 SGIDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAEC--------------G 169
           SG       P  +               + VKVGDHV+      C              G
Sbjct: 63  SG----QGLPQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCEDRARWPDVKHEREG 118

Query: 170 KCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHF--MGCST--FSQYTXXX 225
            C  CK+G  N C                           L F  +GC +  F++     
Sbjct: 119 LCIACKTGNPNCCTD-------------------------LGFCGLGCQSGGFAEKIVLS 153

Query: 226 XXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKS 285
                      PLD  +L+     + +  A++ + +Q G T  V GAG +GL+ V   +S
Sbjct: 154 ERNVVKIPNSLPLDVAALVEPISVSWH--AVRISKLQPGQTALVLGAGPIGLAAVLALQS 211

Query: 286 RGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTDG--GLEYTFDC 343
            GA  IIV +  + ++Q +   GA  F NP E    G+ +++ L ++  G  G  +++DC
Sbjct: 212 HGAGTIIVSEPADTRRQKAEALGAQTF-NPTE---HGDNVIEALRKLAPGGEGFNFSYDC 267

Query: 344 TGNVKVMRDAL 354
            G  +     L
Sbjct: 268 CGTSETFSAGL 278

>ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR070C
           (XYL2)
          Length = 353

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 85/349 (24%), Positives = 125/349 (35%), Gaps = 47/349 (13%)

Query: 96  IVVDPPKAHEVRIKIEYTAVCHTDA-YTLSGIDPEGAF----PSILXXXXXXXXXXXXXX 150
           ++ DP   H V++KIE T +C +D  Y L G    G F    P +L              
Sbjct: 26  VIEDP---HYVKVKIEKTGICGSDVHYYLHG--SIGPFVVRSPMVLGHESSGTVVEVGSD 80

Query: 151 XTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLL 210
            T V++GD V           +  KSG  NLC  +R         DGT   +    E  L
Sbjct: 81  VTRVRIGDRVAIEPGVPSRYSEETKSGHYNLCREMRFAATPPY--DGTLVKYYISPEDFL 138

Query: 211 HFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAI---KTANVQKGDTV 267
                                   K P DS+SL    +      A+   + A  Q    V
Sbjct: 139 -----------------------VKLP-DSVSLEEGALCEPLAVAVHANRLAGTQFPSRV 174

Query: 268 AVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIVQ 327
            VFGAG VGL     AK+ GA+ + +VDI+  K   +   G T  V+   D    E +  
Sbjct: 175 VVFGAGPVGLLTASVAKAFGATTVAIVDISKHKLCVAPALGVTHPVD-SSDCSSPEALAN 233

Query: 328 KLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXXXXXXXXXXTRPFQLVTGR 387
           KL       ++  FDC+G    +  A+  C  G                    F L    
Sbjct: 234 KLRAELRSDVDIAFDCSGAEICIAAAVLICRPGGTHVQVGSSRDYVS------FPLAEAT 287

Query: 388 VWKGSAFGGIK-GRSEMGGLIEDYQNGKLKVDEFITHRRPFTEINDAFE 435
           V +    G  +    +    +E   + ++     +THR PF    +A++
Sbjct: 288 VKQLRILGSFRYAAGDYATAVELLASKRVDAARLVTHRFPFDRAVEAYK 336

>YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON}
           XYL2Xylitol dehydrogenase, converts xylitol to
           D-xylulose; expression induced by xylose, even though
           this pentose sugar is not well utilized by S.
           cerevisiae; null mutant has cell wall defect
          Length = 356

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 84/188 (44%), Gaps = 11/188 (5%)

Query: 255 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVN 314
           A K A ++ G    VFGAG +GL   + A   GA+ ++ VD+  +K + +  FGAT  VN
Sbjct: 163 ANKLAKIKFGARCVVFGAGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGATHIVN 222

Query: 315 PKEDLKEGETIVQKLIEMTDG--GLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXXXXX 372
              DL  G T V  +I+   G  G +  F+C+G    +R  +E C  G            
Sbjct: 223 -SGDLPHGVT-VDSVIKKAIGKKGADVVFECSGAEPCVRAGIEVCKAGGTIVQVGMGQEE 280

Query: 373 XXXXXTRPFQLV-TGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEIN 431
                  P  ++ T  +     F   +G  +    IE   + KL +  FITHR  F +  
Sbjct: 281 IQF----PISIIPTKELTFQGCFRYCQG--DYSDSIELVSSRKLSLKPFITHRYSFKDAV 334

Query: 432 DAFEDLHH 439
           +AFE+  H
Sbjct: 335 EAFEETSH 342

>Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {ON}
           YMR083W (ADH3) - 1:1 [contig 55] FULL
          Length = 387

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 66/264 (25%), Positives = 103/264 (39%), Gaps = 31/264 (11%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P T    + Y  G  L  + + V  PK +E+ I ++Y+ VCHTD +   G  P +   P 
Sbjct: 43  PTTQKGVIFYEHGGELQYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLDVKLPL 102

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                TN ++GD   I      C  C+ C+ G    C     +   G 
Sbjct: 103 VGGHEGAGVVVAKGENVTNFEIGDLAGIKWLNGSCMSCELCEQGHEPNCEHADLS---GY 159

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
             DG                   +F QY                L  ++ + C   T Y 
Sbjct: 160 THDG-------------------SFQQYATADAVQAAQLPKGINLAEVAPILCAGVTVY- 199

Query: 254 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+KTA++  G  VA+ G AG +G   VQ AK+ G  +++ +D  ++KK+     G   F
Sbjct: 200 KALKTADLIPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDEKKELFHKLGGEIF 258

Query: 313 VNPKEDLKEGETIVQKLIEMTDGG 336
           +    D    + +V  + E T GG
Sbjct: 259 I----DYTTTKDMVGAIQEATQGG 278

>TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {ON}
           Anc_2.480 YMR083W
          Length = 373

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 66/271 (24%), Positives = 107/271 (39%), Gaps = 31/271 (11%)

Query: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128
           ++S+   P T    + Y  G  L  + I V  PK +E+ I I+Y+ VCHTD +   G  P
Sbjct: 22  LNSSFTIPATQKGVIFYENGGELHYKDIAVPKPKPNEILINIKYSGVCHTDLHAWKGDWP 81

Query: 129 EGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVR 186
                P +                TN ++GD   +    + C  C++C+ G  + C    
Sbjct: 82  LPVKLPLVGGHEGAGVVVAKGKDVTNFEIGDLAGVKWLNSSCMACEYCELGHESNCAKAD 141

Query: 187 ATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGC 246
            +   G   DG                   +F QY                L  ++ + C
Sbjct: 142 LS---GYTHDG-------------------SFQQYATADAIQAAPIPKDTDLAEVAPILC 179

Query: 247 GVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSF 305
              T Y  A+KT+  + G  VA+ G AG +G   VQ A + G  +++ +D    K++   
Sbjct: 180 AGVTVY-KALKTSGAKPGQWVAISGAAGGLGSLAVQYATAMGL-RVLGIDGGEGKEELFK 237

Query: 306 DFGATDFVNPKEDLKEGETIVQKLIEMTDGG 336
             G   FV    D  + + +V  + E T+GG
Sbjct: 238 SLGGEVFV----DFTKTKDMVSAIQEATNGG 264

>ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR083W
           (ADH3)
          Length = 373

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 107/271 (39%), Gaps = 35/271 (12%)

Query: 71  STQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSG---ID 127
           S+   P T  A V Y  G  L    I V  PK +E+ + I+Y+ VCHTD +   G   I 
Sbjct: 24  SSTAIPTTQKAVVFYEHGGELKYTDIPVPKPKPNEILVNIKYSGVCHTDLHAWKGDWAIK 83

Query: 128 PEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVR 186
           P+   P +                TN ++GD+  +      C +C+FC+ G    C +  
Sbjct: 84  PK--LPLVGGHEGAGVVVAKGANVTNFEIGDYAGVKWLGKTCMECEFCQKGFEPNCET-- 139

Query: 187 ATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGC 246
                   P  +   H+             TF QY            P   L  ++ + C
Sbjct: 140 --------PTLSGYTHD------------GTFQQYATADAIHAAHIPPGTDLAKVAPILC 179

Query: 247 GVTTGYGAAIKTANVQKGDTVAV-FGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSF 305
              T Y  A+KTA +  G  VA+    G +G   VQ A + G  +++ +D  N+K+    
Sbjct: 180 AGITVY-KALKTAALIPGQWVAISGAGGGLGSLAVQYAVAMG-YRVVGIDGGNEKEALFR 237

Query: 306 DFGATDFVNPKEDLKEGETIVQKLIEMTDGG 336
             G   FV    D  + + IV  + E T GG
Sbjct: 238 SLGGETFV----DFHKNKDIVSAVREATGGG 264

>YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}
           BDH1NAD-dependent (R,R)-butanediol dehydrogenase,
           catalyzes oxidation of (R,R)-2,3-butanediol to
           (3R)-acetoin, oxidation of meso-butanediol to
           (3S)-acetoin, and reduction of acetoin; enhances use of
           2,3-butanediol as an aerobic carbon source
          Length = 382

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 89/219 (40%), Gaps = 39/219 (17%)

Query: 152 TNVKVGDHVIALYTAECGK--------------CKFCKSGKTNLCGSVRATQGKGVMPDG 197
           T VKVGDHV+    + C                C  C+ G  NLC       G GV+  G
Sbjct: 87  TKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQRGSENLCTHA-GFVGLGVISGG 145

Query: 198 TSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIK 257
                               F++              + PLD  +L+     T +  A+K
Sbjct: 146 --------------------FAEQVVVSQHHIIPVPKEIPLDVAALVEPLSVTWH--AVK 183

Query: 258 TANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKE 317
            +  +KG +  V GAG +GL  +   K  GASKI+V +I   + + +   G   F NP +
Sbjct: 184 ISGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVF-NPSK 242

Query: 318 DLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
              +   I++ L +  D G +Y++DC+G       +L+A
Sbjct: 243 HGHKSIEILRGLTKSHD-GFDYSYDCSGIQVTFETSLKA 280

>TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {ON}
           Anc_3.118 YBR145W
          Length = 350

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 111/284 (39%), Gaps = 35/284 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGA-FPS 134
           P T    + Y    PL  + I V  P  +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 6   PKTQKGVIFYENNGPLEYKDIPVPTPLPNELLIHVLYSGVCHTDLHAWHGDWPLPVKLPL 65

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   KVGD+  I      C  C+ C+    + C           
Sbjct: 66  VGGHEGAGVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNC----------- 114

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P+     +   G          +F QY              A L +I+ + C   T Y 
Sbjct: 115 -PEADLSGYTHDG----------SFQQYATADAVQAAKIPAGADLKNIAPILCAGVTVY- 162

Query: 254 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            AIK+AN++ GD +A+ GA G +G   +Q  K+ G  +I+ +D   +K++     G   F
Sbjct: 163 KAIKSANLKAGDWLAISGACGGLGSLAIQYGKAMG-FRILGIDGGAEKEELFKKLGGEYF 221

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           +    D  + + I+ ++ + T+GG         NV V   A+EA
Sbjct: 222 I----DFTQCKDIIAEVKKATNGGAHGVI----NVSVSEAAIEA 257

>Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 92/219 (42%), Gaps = 39/219 (17%)

Query: 152 TNVKVGDHVIALYTAECGK--------------CKFCKSGKTNLCGSVRATQGKGVMPDG 197
           T VKVGDHV+    + C                C+ CK G  NLC +     G GV+  G
Sbjct: 87  TKVKVGDHVVVDAASSCADLHCWPQSKHYSSKPCEACKKGSENLC-THGGFIGLGVISGG 145

Query: 198 TSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIK 257
                               F++              + PLD  +L+     T +  A+K
Sbjct: 146 --------------------FAEQVAVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVK 183

Query: 258 TANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKE 317
            +  +KG +  V GAG +GL  +   K  GA KI+V ++   + + + + G   F NP +
Sbjct: 184 ISGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVAERRIEMAKNLGVEVF-NPSK 242

Query: 318 DLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
             ++   +++ L +  D G +Y++DC+G       +L+A
Sbjct: 243 HGQKSIEVLRGLTKSHD-GFDYSYDCSGIQVTFETSLKA 280

>Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086C
           (ADH1) - Alcohol dehydrogenase [contig 183] FULL
          Length = 351

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 109/284 (38%), Gaps = 35/284 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P T  A + Y  G PL  + I V  P A E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFYENGGPLEYKDIPVPKPSATELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   K+GD+  I      C  C+ C+    + C           
Sbjct: 67  VGGHEGAGVVVAMGENVKGWKIGDYAGIKWLNGSCMSCESCELSNESNC----------- 115

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P+     +   G          +F QY                L  ++ + C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQQYATADAVQAAKIPQGTDLAEVAPVLCAGITVY- 163

Query: 254 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+AN+  GD VA+ GA G +G   +Q A + G  +++ +D   +K +     G   F
Sbjct: 164 KALKSANLSAGDWVAISGACGGLGSLCIQYATAMG-YRVLGIDGGAEKAELFKQLGGEVF 222

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           +    D    + +  ++I+ T+GG         NV V   A+E+
Sbjct: 223 I----DFTTCKDVEGEIIKATNGGAHGVI----NVSVSEAAIES 258

>YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON}
           ADH2Glucose-repressible alcohol dehydrogenase II,
           catalyzes the conversion of ethanol to acetaldehyde;
           involved in the production of certain carboxylate
           esters; regulated by ADR1
          Length = 348

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 111/284 (39%), Gaps = 35/284 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P T  A + Y +   L  + I V  PK +E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKAIIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   K+GD+  I      C  C++C+ G  + C           
Sbjct: 64  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNC----------- 112

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P      +   G          +F +Y                L  ++ + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQEYATADAVQAAHIPQGTDLAEVAPILCAGITVY- 160

Query: 254 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+AN++ G   A+ G AG +G   VQ AK+ G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLRAGHWAAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKEELFTSLGGEVF 219

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           +    D  + + IV  +++ T+GG         NV V   A+EA
Sbjct: 220 I----DFTKEKDIVSAVVKATNGGAHGII----NVSVSEAAIEA 255

>ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 348

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 108/287 (37%), Gaps = 35/287 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P T  A +      PL  + I V  PK +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKAVIFSENNGPLEYKDIPVPKPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                 N K+GD   I      C  C+ C+    + C           
Sbjct: 64  VGGHEGAGEVVALGSDVKNWKIGDLAGIKWLNGSCMSCEACEQSHESNC----------- 112

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            PD     +   G          +F QY                L  ++ + C   T Y 
Sbjct: 113 -PDADLSGYTHDG----------SFQQYATADAVQAAHIPAGTNLAEVAPVLCAGITVY- 160

Query: 254 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+AN++ G  VA+ G AG +G   VQ A++ G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLKAGQWVAISGAAGGLGSLAVQYARAMGL-RVLGIDGGPGKEELFKTLGGECF 219

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHK 359
           +    D  +   I + +I+ T+GG         NV V   A+ A  K
Sbjct: 220 I----DFTKEHDIAEAVIKATNGGAHGVI----NVSVSEGAISASTK 258

>Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 107/284 (37%), Gaps = 35/284 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGA-FPS 134
           P T    + Y +   L  + I V  PKA+E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESHGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPL 63

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                    +GD   I      C  C++C+ G  + C           
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNC----------- 112

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P      +   G          +F QY                L   + + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADSVQAAHIPKGTDLAECAPVLCAGITVY- 160

Query: 254 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+AN+  G  VA+ G AG +G   VQ AK+ G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLSAGQWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEGKEELFRSIGGEVF 219

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           +    D    + IV  +I+ TDGG         NV V   A+EA
Sbjct: 220 I----DFTTEKDIVGAVIKATDGGAHGII----NVSVSEAAIEA 255

>KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON}
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 356

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 105/261 (40%), Gaps = 31/261 (11%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P+T  A +       L ++ I V  PKA+E+ I ++++ VCH+D +   G  P +   P 
Sbjct: 10  PLTQRAVIFKKHSGKLELKSIEVQSPKANELLINVKFSGVCHSDLHAWKGDWPTKTKLPL 69

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   K+GD+  I    + C  C+ C+      C     +   G 
Sbjct: 70  VGGHEGAGIVVAMGASVRGWKIGDYAGIKWLNSCCMSCEQCELSNEPNCAYADIS---GF 126

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
             DG                   +F QY            P   L  +S + C   T + 
Sbjct: 127 TRDG-------------------SFQQYATADAVQAARIPPGTNLAEVSPVLCAGITVF- 166

Query: 254 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+KTAN+  G+ VA+ GA G +G   +Q AK+ G S ++ +D   +K+    D G   F
Sbjct: 167 KALKTANLTAGNWVAISGACGGLGSMAIQYAKAMGYS-VVGIDSGAEKEHLFNDLGGDVF 225

Query: 313 VNPKEDLKEGETIVQKLIEMT 333
           +    D  + E +V +++  T
Sbjct: 226 L----DFSKSENLVPEVVSAT 242

>TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 111/284 (39%), Gaps = 35/284 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGA-FPS 134
           P T    + Y     L  + I V  P  +E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 7   PETQKGVIFYENNGTLEYKDIPVPKPAPNELLINVKYSGVCHTDLHAWKGDWPLPVKLPL 66

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                 N KVGD+  I      C  C+ C+ G  + C           
Sbjct: 67  VGGHEGAGVVVALGSNVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNC----------- 115

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P      +   G          +F QY            P   L  ++ + C   T Y 
Sbjct: 116 -PQADLSGYTHDG----------SFQQYATTDAVQAAKISPGTDLAEVAPVLCAGLTVY- 163

Query: 254 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+A ++ G  VA+ GA G +G   VQ AK+ G  +++ +D  ++K +   + G   F
Sbjct: 164 KALKSAELEAGQWVAISGACGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKMFKELGGEYF 222

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           +    D  + + I+ ++++ T+GG         NV V   A+ A
Sbjct: 223 I----DFTKCKDIIGEVVKATNGGAHGVI----NVSVSEAAISA 258

>Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 88/219 (40%), Gaps = 39/219 (17%)

Query: 152 TNVKVGDHVIALYTAECGK--------------CKFCKSGKTNLCGSVRATQGKGVMPDG 197
           T VKVGDHV+    + C                C+ CK G  NLC       G GV+  G
Sbjct: 87  TKVKVGDHVVVDAGSSCADLHCWPHSKYYNSKPCEACKKGSENLCAH-SGFVGLGVISGG 145

Query: 198 TSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIK 257
                               F++              + PLD  +L+     T +  A+K
Sbjct: 146 --------------------FAEQVVVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVK 183

Query: 258 TANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKE 317
            +  +KG +  V GAG +GL  +   K  GA KI+V ++   + + +       F NP +
Sbjct: 184 LSGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVAERRLKMAKSLDVEVF-NPAQ 242

Query: 318 DLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
              +   +++ L E  D G +Y++DC+G       +L+A
Sbjct: 243 HGHKSVELLRGLTESHD-GFDYSYDCSGIQATFETSLKA 280

>Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON}
           YJR159W (SOR1) - sorbitol-induced sorbitol dehydrogenase
           [contig 159] FULL
          Length = 356

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 94/210 (44%), Gaps = 39/210 (18%)

Query: 257 KTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVN-- 314
           K A V+ G TV VFGAG VGL     AK+ GAS ++ VD+ + K + + +FGAT  +N  
Sbjct: 163 KLAKVRFGQTVVVFGAGPVGLLTGAVAKAFGASDVVFVDVFDQKLERAKNFGATHVINST 222

Query: 315 --PKEDLKEGETIVQKLIEMTDGGL-EYTFDCTGNVKVMRDALEACHKGWXXXXXXXXXX 371
             PK D +     V+KL+    G L +  F+C+G    +   ++A   G           
Sbjct: 223 KLPKNDPQALADEVEKLL---GGALADVVFECSGAESCIDAGVKATKNGGTM-------- 271

Query: 372 XXXXXXTRPFQLVTGRVWKGSAFGGIKGRS-EMGGLIE----DYQN-------GKLKVDE 419
                     Q+  G+ +       + G+   + G       DY++       G++ V +
Sbjct: 272 ---------VQIGMGKNYVNFPIAEVSGKEMTLVGCFRYSYGDYKDAVNLVSTGRVDVKK 322

Query: 420 FITHRRPFTEINDA--FEDLHHGDCLRTVL 447
            ITHR  F +   A  F   H G+ ++T++
Sbjct: 323 LITHRFSFEDAAKAYDFNIAHGGEVVKTII 352

>KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 107/266 (40%), Gaps = 35/266 (13%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGAFPSI 135
           P T  A +    G  L  + I V  PK++E+ I + Y+ VCH+D +   G         +
Sbjct: 7   PKTQKAIIFSEVGGKLEYKDIPVPVPKSNELLINVLYSGVCHSDLHIWQG--DLPLPLKL 64

Query: 136 LXXXXXXXXXXXXXXXTNV---KVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGK 191
                           +NV   K+GD+  I      C  C+FC+      C     T   
Sbjct: 65  PLVGGHEGAGVVVGMGSNVKGWKLGDYAGIKFLNGTCNACEFCEQSFEISCPHADFT--- 121

Query: 192 GVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTG 251
           G + DG                   +F QY                L +I+ L C   T 
Sbjct: 122 GTVHDG-------------------SFQQYATADAVQAARIPQGTDLAAIAPLLCAGLTA 162

Query: 252 YGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGAT 310
           Y  A+K+AN++ G  VA+ GA G +G   +Q A + G  +++ +D   +K ++    G  
Sbjct: 163 Y-KALKSANMRPGQWVAISGACGGLGTYAIQYATAMG-YRVLGIDSGEEKAKYFKTLGGE 220

Query: 311 DFVNPKEDLKEGETIVQKLIEMTDGG 336
            F+    D K+ + +V  +I+ TDGG
Sbjct: 221 VFI----DYKKSKDVVADVIKATDGG 242

>Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON}
           (41165..42226) [1062 nt, 354 aa]
          Length = 353

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 57/106 (53%), Gaps = 1/106 (0%)

Query: 255 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVN 314
           A+K A V+ GD V VFGAG VGL V    K+ GA++++ +D+ + K   S + G+T  +N
Sbjct: 162 AVKLAGVKFGDKVVVFGAGPVGLLVGSVCKAFGATEVVSIDVVDKKLDKSLEMGSTIAIN 221

Query: 315 PKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKG 360
            K D+ E    ++   ++         DCTG    +R ++ AC  G
Sbjct: 222 SK-DMAEEALALEIQNDLNGQHPNKVIDCTGAEPCLRSSILACKPG 266

>TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16
           YLR070C
          Length = 353

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 107/268 (39%), Gaps = 42/268 (15%)

Query: 104 HEVRIKIEYTAVCHTDA--YTLSGIDPEGAF----PSILXXXXXXXXXXXXXXXTNVKVG 157
           H+V+I+I+ T +C +D   +T   I   G F    P +L               ++VKVG
Sbjct: 29  HDVKIQIKATGICGSDVHYFTQGSI---GDFVVKSPLVLGHESAGVVVEVGDAVSSVKVG 85

Query: 158 DHVIALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCST 217
           D V           K   SG  NLC  +          DGT   +    E  ++ +    
Sbjct: 86  DRVAVEPGVPSRYSKETMSGHYNLCPHMAFAATPPY--DGTLVKYYLSPEDFVYKLA--- 140

Query: 218 FSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAI---KTANVQKGDTVAVFGAGT 274
                                D IS     V      A+   + AN   G  V V GAG 
Sbjct: 141 ---------------------DHISFEEGAVVEPLSVAVHANRLANTAFGQAVLVLGAGP 179

Query: 275 VGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTD 334
           VGL     AK+ GA+ ++ VDI   K + +  FGAT  V  K D  E + +   L+  + 
Sbjct: 180 VGLLAGAVAKAFGATDVVFVDIFESKLEKAKQFGATRTVLFKPDSDENDLV--SLVTKSL 237

Query: 335 GGL--EYTFDCTGNVKVMRDALEACHKG 360
           GGL  +  F+C+G  K +R A+++  +G
Sbjct: 238 GGLHPDVVFECSGAEKCIRAAVKSVKRG 265

>TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 351

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 115/291 (39%), Gaps = 42/291 (14%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGAFPSI 135
           P T  A V    G  L  + I V  P+ +E+ I ++Y+ VCHTD +   G  P    P+ 
Sbjct: 6   PKTQKAVVFDTNGGELQYKDIPVPEPQPNELLINVKYSGVCHTDLHAWKGDWP---LPTK 62

Query: 136 LXXXXXXXXXXXXXXXTNV-----KVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQ 189
           L                ++     ++GD   I      C  C++C+    + C       
Sbjct: 63  LPLVGGHEGAGIVVAKGSMVXXGWEIGDLAGIKWLNGSCMSCEYCEKANESNC------- 115

Query: 190 GKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVT 249
                P      +   G          +F QY                L  ++ + C   
Sbjct: 116 -----PQADLSGYTHDG----------SFQQYATADAVQAARVPKGTDLAEVAPILCAGI 160

Query: 250 TGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFG 308
           T Y  A+K+AN++ G+ VA+ GA G +G   VQ AK+ G  +++ +D  ++K +     G
Sbjct: 161 TVY-KALKSANLRAGEWVAISGASGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKLFKQLG 218

Query: 309 ATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHK 359
              F+    D  + + ++ ++I+ TDGG         NV V   A+ A  +
Sbjct: 219 GEYFI----DFTKSKDVIAEVIKATDGGAHGVI----NVSVSEGAISASTR 261

>Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 90/221 (40%), Gaps = 43/221 (19%)

Query: 152 TNVKVGDHVIALYTAECGK--------------CKFCKSGKTNLCGSVRATQGKGVMPDG 197
           T VKVGDHV+    + C                C  CK G  NLC +     G GV+  G
Sbjct: 87  TKVKVGDHVVVQAGSSCADLHCWPHSKHYNSKPCDACKKGCENLC-THAGFIGLGVISGG 145

Query: 198 TSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIK 257
                               F++              + PLD  +L+     T +  A++
Sbjct: 146 --------------------FAEQVVVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVR 183

Query: 258 TANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKE 317
            +  +KG +  V GAG +GL  +   K  GA +I+V ++   + + +   G   F +P+ 
Sbjct: 184 LSGFKKGSSALVLGAGPIGLCTILVLKGMGAGQIVVSEVAERRMELARRLGVEIF-DPR- 241

Query: 318 DLKEGETIVQKLIEMTDG--GLEYTFDCTGNVKVMRDALEA 356
             K GE  V+ L  +T    G +Y++DC+G       +L+A
Sbjct: 242 --KHGEKSVESLRALTKSHDGFDYSYDCSGIQATFDASLKA 280

>KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON}
           similar to uniprot|P39714 Saccharomyces cerevisiae
           YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
           dehydrogenase
          Length = 385

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 85/208 (40%), Gaps = 39/208 (18%)

Query: 152 TNVKVGDHVIALYTAEC--------------GKCKFCKSGKTNLCGSVRATQGKGVMPDG 197
           TN+K GDHV+   T  C               +C  C+ G  N C  +    G GV   G
Sbjct: 87  TNIKAGDHVVVEATGTCLDHYTWPNAAHAKDAECAACQRGFYNCCAHL-GFMGLGVHSGG 145

Query: 198 TSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIK 257
                               F++                PLD  +L+     + +  A++
Sbjct: 146 --------------------FAEKVVVSEKHVVKIPNTLPLDVAALVEPISVSWH--AVR 183

Query: 258 TANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKE 317
            + +QKG +  V GAG +GL+ +   +  GASKI+V +    ++  +   G   F +P E
Sbjct: 184 ISKLQKGQSALVLGAGPIGLATILALQGHGASKIVVSEPAEIRRNQAAKLGVETF-DPSE 242

Query: 318 DLKEGETIVQKLIEMTDGGLEYTFDCTG 345
             ++   I++KL    + G ++ +DC+G
Sbjct: 243 HKEDAVNILKKLAPGGE-GFDFAYDCSG 269

>Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON}
           (21043..22185) [1143 nt, 381 aa]
          Length = 380

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 98/249 (39%), Gaps = 31/249 (12%)

Query: 91  LTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGA-FPSILXXXXXXXXXXXXX 149
           L    I V  PK++E+ I ++Y+ VCHTD +   G  P     P +              
Sbjct: 51  LKYTDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGAGVVVGIGE 110

Query: 150 XXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEP 208
                K+GD   I      C  C+ C++G    C     +   G   DG           
Sbjct: 111 NVKGWKLGDLAGIKWLNGSCMSCELCETGHEANCEHADLS---GYTHDG----------- 156

Query: 209 LLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTANVQKGDTVA 268
                   +F QY              + L  I+ + C   T Y  A+KTAN++ G+ VA
Sbjct: 157 --------SFQQYATADAVQAARIPEGSDLAQIAPILCAGITVY-KALKTANLKPGEWVA 207

Query: 269 VFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIVQ 327
           + G AG +G   VQ AK+ G  +++ +D   +K++     G   FV    D  + + IV 
Sbjct: 208 ISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKEKLFRSLGGEVFV----DFTKSKDIVA 262

Query: 328 KLIEMTDGG 336
            +   T GG
Sbjct: 263 DIQNATKGG 271

>TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {ON}
           Anc_7.2 YAL061W
          Length = 382

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 101/279 (36%), Gaps = 56/279 (20%)

Query: 104 HEVRIKIEYTAVCHTDAYTLS----------GIDPEGA--FPSILXXXXXXXXXXXXXXX 151
            EV I++ +  +C TD +  S          G  P      P  +               
Sbjct: 27  EEVLIEVSWAGICGTDLHEYSDGPIFMPQDGGSHPLSGKKLPQPMGHEMSGIVSKIGSKV 86

Query: 152 TNVKVGDHVIALYTAEC-------------GK-CKFCKSGKTNLCGSVRATQGKGVMPDG 197
           T VKVGDHV+      C             GK C  C+ G  N+C     T G G    G
Sbjct: 87  TKVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTCSACEKGLVNICAHACFT-GLGTSGGG 145

Query: 198 TSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIK 257
                               F++                PLD  +L+     T + A  K
Sbjct: 146 --------------------FAERLTVSQDHCIPIPKDLPLDVAALVEPLSVTWHAA--K 183

Query: 258 TANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKE 317
            A  QKG T  V GAG +GL+ +   K  GASKI+V ++   ++  +   G   F NP E
Sbjct: 184 VAGFQKGQTACVLGAGPIGLATILTLKGLGASKIVVSELAQIRRDMAASMGVEVF-NPAE 242

Query: 318 DLKEGETIVQKLIEMTDG--GLEYTFDCTGNVKVMRDAL 354
                +  + +L ++ +G  G +  FDC+G       AL
Sbjct: 243 H----KDAIAELRKIPEGATGFDAAFDCSGVKATFNTAL 277

>ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3
          Length = 373

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 86/369 (23%), Positives = 137/369 (37%), Gaps = 39/369 (10%)

Query: 88  GKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPSILXXXXXXXXXX 146
           G  L  E + V  P ++EV I ++Y+ VCHTD +T  G  P +   P +           
Sbjct: 39  GPLLYREDLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVVA 98

Query: 147 XXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQK 205
                   ++GD   +    + C  C+ C+ G    C      +  G   DG        
Sbjct: 99  KGKDVKTFEIGDLAGVKQLVSSCMGCESCEIGHEFGC---EQAEMSGSSHDG-------- 147

Query: 206 GEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTANVQKGD 265
                      TF QY                L +++ + C   + Y  A+K  N+Q   
Sbjct: 148 -----------TFQQYVAIDALQAPPLPANVDLAAVAPIFCAGVSVY-KALKNGNLQTNQ 195

Query: 266 TVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGET 324
            VA+FGA G +G   VQ AK+ G   + +     ++KQ     G   F+    D  + + 
Sbjct: 196 WVAIFGATGGLGSIAVQYAKAMGYRVLGIDGPGEERKQLFHSLGGEVFL----DYTQVDN 251

Query: 325 IVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXXXXXXXXXXTRPFQLV 384
           I   + + T GG     + T ++      ++ C +                  T  F +V
Sbjct: 252 IPAAVKQATQGGAHCVLNVTASLAAYDQTIK-CVRPLGTVVPVGVPPDSGLLKTDIFTIV 310

Query: 385 T-GRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEINDAFEDLHHGDCL 443
             G   KGSA G    R++    ++ +  G +K    I      +E+  AFE L  G   
Sbjct: 311 QHGFSIKGSASG---SRADTREAVDFFTRGLIKSPIKILG---LSELPKAFELLESGQTT 364

Query: 444 -RTVLDLAK 451
            R VLD +K
Sbjct: 365 GRLVLDTSK 373

>Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 91/377 (24%), Positives = 139/377 (36%), Gaps = 87/377 (23%)

Query: 104 HEVRIKIEYTAVCHTDA--YTLSGIDPEGAF----PSILXXXXXXXXXXXXXXXTNVKVG 157
           H V++ I+ T +C +D   Y   GI   G +    P +L               T VKVG
Sbjct: 31  HYVKLAIKATGICGSDVHYYRSGGI---GKYILKAPMVLGHESSGEVVEVGNAVTRVKVG 87

Query: 158 DHVIALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGC-- 215
           D V              K G+ NLC                         P + F     
Sbjct: 88  DRVAIEPGVPSRYSDETKEGRYNLC-------------------------PHMAFAATPP 122

Query: 216 --STFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAI----------KTANVQK 263
              T  +Y              +P D +  L  GV+   GA +          K A V+ 
Sbjct: 123 IDGTLVKYYL------------SPEDFLVKLPEGVSYEEGACVEPLSVGVHSNKLAGVRF 170

Query: 264 GDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVN----PKEDL 319
              V VFGAG VGL     A++ GAS ++ VD+ ++K Q + DFGAT+  N    P +  
Sbjct: 171 STRVVVFGAGPVGLLTGAVARAFGASDVVFVDVFDNKLQRAKDFGATNTFNSSKIPTDKA 230

Query: 320 KEGETIVQKLIEMTDGG--LEYTFDCTGNVKVMRDALEACHKGWXXXXXXXXXXXXXXXX 377
           +E  + V+KL+    GG   +  F+C+G    +   ++    G                 
Sbjct: 231 QELASEVEKLL----GGNHADVVFECSGADVCIDAGVKVTKVGGTMVQVGMGKNYTNF-- 284

Query: 378 TRPFQLVTGRVWK-----GSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEIND 432
             P   V+G+  K       +FG  +    +         GK+ V   ITHR  F +   
Sbjct: 285 --PIAEVSGKEMKLIGCFRYSFGDYRDAVNL------VATGKVNVKPLITHRFKFEDAAK 336

Query: 433 AFED--LHHGDCLRTVL 447
           A++    H GD ++T++
Sbjct: 337 AYDYNISHGGDVVKTII 353

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 92/219 (42%), Gaps = 42/219 (19%)

Query: 155 KVGDHVIALYTAEC--------------GKCKFCKSGKTNLCGSVRATQGKGVMPDGTSR 200
           K+GDHV+   TA C                C+ C++G  N+C  +  T G GV   G + 
Sbjct: 90  KIGDHVVVEPTATCIDRYRWPNAPNRDTPMCEACRNGMPNICKYLGLT-GAGVEGGGFAE 148

Query: 201 FHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTAN 260
                 + +++   C     +               PLD  SL+       +  A+K ++
Sbjct: 149 ------KMVINEHHCHKIPHHM--------------PLDVASLIQPISVCWH--AVKVSH 186

Query: 261 VQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLK 320
            ++G +V + G G +GL  +   K  G   I+V +    +++ +   GA  F      L 
Sbjct: 187 YKQGGSVLIVGGGPIGLGTILALKGFGCEDIVVSEPALIRRELAEKMGARVFDPSNMSL- 245

Query: 321 EGETIVQKLIEMTDG--GLEYTFDCTGNVKVMRDALEAC 357
             +  ++ L EM  G  G +YTFDC+G    ++ A+E C
Sbjct: 246 --DNSIKTLTEMAPGSQGFDYTFDCSGIPATLKVAIECC 282

>Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 97/393 (24%), Positives = 147/393 (37%), Gaps = 92/393 (23%)

Query: 91  LTVEQ----IVVDPPKAHEVRIKIEYTAVCHTDA--YTLSGIDPEGAF----PSILXXXX 140
           + VEQ    I+ DP   H V+I I+ T +C +D   Y   GI   G +    P +L    
Sbjct: 17  IVVEQRPVPIIEDP---HYVKIAIKATGICGSDIHYYRSGGI---GKYILKAPMVLGHES 70

Query: 141 XXXXXXXXXXXTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSR 200
                      T VKVGD V              K G+ NLC                  
Sbjct: 71  SGQVVEVGSAVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLC------------------ 112

Query: 201 FHNQKGEPLLHFMGC----STFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAI 256
                  P + F        T  +Y              +P D +  L  GV+   GA +
Sbjct: 113 -------PHMAFAATPPIDGTLVKYYL------------SPEDFLVKLPEGVSYEEGACV 153

Query: 257 ----------KTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFD 306
                     K A V+ G  V VFGAG VGL     A++ GAS ++ +D+ ++K   + +
Sbjct: 154 EPLSVGVHSNKLAGVRFGSRVVVFGAGPVGLLTGAVARAFGASDVVFIDVFDNKLDRAKE 213

Query: 307 FGATDFVN----PKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDA-LEACHKGW 361
           FGAT   N    P +  +E    V+KL  ++    +  F+C+G      DA ++A  K  
Sbjct: 214 FGATHTFNSSKFPADKTQELADEVEKL--LSGHHADIVFECSGA-----DACIDAGVKIT 266

Query: 362 XXXXXXXXXXXXXXXXTRPFQLVTGRVWK-----GSAFGGIKGRSEMGGLIEDYQNGKLK 416
                             P   V+G+  K       +FG  +   ++        +GK+ 
Sbjct: 267 KVGGTMVQIGMGKNYTNFPIAEVSGKEMKLIGCFRYSFGDYRDAVKL------VASGKVN 320

Query: 417 VDEFITHRRPFTEINDA--FEDLHHGDCLRTVL 447
           V   ITHR  F +   A  F   H G+ ++T++
Sbjct: 321 VKAMITHRFKFEDAAKAYDFNIAHGGEVVKTII 353

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 85/217 (39%), Gaps = 41/217 (18%)

Query: 155 KVGDHVIALYTAECGK--------------CKFCKSGKTNLCGSVRATQGKGVMPDGTSR 200
           KVGDHV+   T  C                C  CK G  N+C  +    G GV   G   
Sbjct: 90  KVGDHVVVEPTGTCKDRYRWKNSPSKNDDMCNACKKGYYNICSKL-GLCGAGVQSGG--- 145

Query: 201 FHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTAN 260
                            F++                PLD  +L+       +  A++  N
Sbjct: 146 -----------------FAERVVMNESHCHKVPDDLPLDIAALIQPIAVCWH--ALRICN 186

Query: 261 VQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLK 320
            +KG +  V G+G +GL ++      G + I+V +    ++ ++ + GAT F +P   L 
Sbjct: 187 FKKGSSALVVGSGPIGLGIILALHGHGCTDIVVSEPAKIRRDFAKELGATVF-DPSS-LP 244

Query: 321 EGETIVQKLIEMTDG--GLEYTFDCTGNVKVMRDALE 355
             E  ++ L  +  G  G +YTFDC+GN      ++E
Sbjct: 245 THEESIKYLRSIAPGGDGFDYTFDCSGNQYTFNASIE 281

>Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON}
           (51276..52337) [1062 nt, 354 aa]
          Length = 353

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 110/284 (38%), Gaps = 35/284 (12%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P T    + Y     L  + + V  PK  E+ I + Y+ VCHTD +   G  P +   P 
Sbjct: 9   PKTQKGVIFYENNGELQYKDLPVPQPKPTELLIHVLYSGVCHTDLHAWKGDWPLDTKLPL 68

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   K+GD   I      C  C+ C+    + C           
Sbjct: 69  VGGHEGAGVVVGMGSSVKGWKMGDLAGIKWLNGSCMNCEECELSNESNC----------- 117

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
            P+     +   G          +F QY              A +  ++ + C   T Y 
Sbjct: 118 -PEADLSGYTHDG----------SFQQYATADAVQAAHIPQGADMAEVAPILCAGVTVY- 165

Query: 254 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            A+K+A ++ GD VA+ G AG +G   VQ AK+ G  +++ +D  ++K+++    G   F
Sbjct: 166 KALKSAELKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGDEKEKFFKSMGGEVF 224

Query: 313 VNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           V    D    + IV  + E T+GG      C  NV V   A+EA
Sbjct: 225 V----DFMTCKDIVGAVKEATNGG---AHGCI-NVSVSEKAIEA 260

>YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbitol
           dehydrogenase; expression is induced in the presence of
           sorbitol or xylose
          Length = 357

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 93/380 (24%), Positives = 141/380 (37%), Gaps = 93/380 (24%)

Query: 104 HEVRIKIEYTAVCHTDA--YTLSGIDPEGAF----PSILXXXXXXXXXXXXXXXTNVKVG 157
           H V++ I+ T +C +D   Y   GI   G +    P +L               T VKVG
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAVTRVKVG 87

Query: 158 DHVIALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGC-- 215
           D V              K G+ NLC                         P + F     
Sbjct: 88  DRVAIEPGVPSRYSDETKEGRYNLC-------------------------PHMAFAATPP 122

Query: 216 --STFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAI----------KTANVQK 263
              T  +Y              +P D +  L  GV+   GA +          K A V+ 
Sbjct: 123 IDGTLVKYYL------------SPEDFLVKLPEGVSYEEGACVEPLSVGVHSNKLAGVRF 170

Query: 264 GDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPK------- 316
           G  V VFGAG VGL     A++ GA+ +I VD+ ++K Q + DFGAT+  N         
Sbjct: 171 GTKVVVFGAGPVGLLTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKA 230

Query: 317 EDLKEGETIVQKLIEMTDGG--LEYTFDCTGNVKVMRDALEACHKGWXXXXXXXXXXXXX 374
           +DL +G   VQKL+    GG   +  F+C+G    +  A++    G              
Sbjct: 231 QDLADG---VQKLL----GGNHADVVFECSGADVCIDAAVKTTKVGG----TMVQVGMGK 279

Query: 375 XXXTRPFQLVTGRVWK-----GSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTE 429
                P   V+G+  K       +FG  +    +         GK+ V   ITH+  F +
Sbjct: 280 NYTNFPIAEVSGKEMKLIGCFRYSFGDYRDAVNL------VATGKVNVKPLITHKFKFED 333

Query: 430 INDAFED--LHHGDCLRTVL 447
              A++    H G+ ++T++
Sbjct: 334 AAKAYDYNIAHGGEVVKTII 353

>YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}
           SOR2Protein of unknown function; protein sequence is 99%
           identical to the Sor1p sorbitol dehydrogenase;
           computational analysis of large-scale protein-protein
           interaction data also suggests a role in fructose or
           mannose metabolism
          Length = 357

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 103/238 (43%), Gaps = 43/238 (18%)

Query: 236 APLDSISLLGCGVTTGYGAAI----------KTANVQKGDTVAVFGAGTVGLSVVQGAKS 285
           +P D +  L  GV+   GA +          K A V+ G  V VFGAG VGL     A++
Sbjct: 133 SPEDFLVKLPEGVSYEEGACVEPLSVGVHSNKLAGVRFGTKVVVFGAGPVGLLTGAVARA 192

Query: 286 RGASKIIVVDINNDKKQWSFDFGATDFVNPK-------EDLKEGETIVQKLIEMTDGG-- 336
            GA+ +I VD+ ++K Q + DFGAT+  N         +DL +G   VQKL+    GG  
Sbjct: 193 FGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADG---VQKLL----GGNH 245

Query: 337 LEYTFDCTGNVKVMRDALEACHKGWXXXXXXXXXXXXXXXXTRPFQLVTGRVWK-----G 391
            +  F+C+G    +  A++    G                   P   V+G+  K      
Sbjct: 246 ADVVFECSGADVCIDAAVKTTKVGG----TMVQVGMGKNYTNFPIAEVSGKEMKLIGCFR 301

Query: 392 SAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEINDAFED--LHHGDCLRTVL 447
            +FG  +    +         GK+ V   ITH+  F +   A++    H G+ ++T++
Sbjct: 302 YSFGDYRDAVNL------VATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTII 353

>KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {ON}
           Anc_2.480 YMR083W
          Length = 374

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 64/271 (23%), Positives = 103/271 (38%), Gaps = 28/271 (10%)

Query: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128
           + ST   P T    + Y  G  L  + I V  PK +E+ + ++Y+ VCHTD +   G  P
Sbjct: 20  LQSTVSIPQTQKGVIFYEHGGDLHYKDIPVPKPKPNEILVNVKYSGVCHTDLHAWKGDWP 79

Query: 129 EGA-FPSILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVR 186
                P +                 N ++GD   I      C  C+ C+SG  + C    
Sbjct: 80  LSVKLPLVGGHEGAGVVVAKGSNVNNFEIGDLAGIKWLNGSCMSCELCESGHESNCEHAD 139

Query: 187 ATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGC 246
            +   G   DG                   +F QY                L  ++ + C
Sbjct: 140 LS---GYTHDG-------------------SFQQYATADAVQAAKIPEGTNLAEVAPVLC 177

Query: 247 GVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSF 305
              T Y  A+K A++  G  V + G AG +G   VQ  K+ G  ++I +D    K++   
Sbjct: 178 AGITVY-KALKEASLSPGQWVCISGAAGGLGSLAVQYGKAMGL-RVIGIDGGPGKEELFK 235

Query: 306 DFGATDFVNPKEDLKEGETIVQKLIEMTDGG 336
             G   F++  +  K    +V  + + T+GG
Sbjct: 236 SLGGEVFIDFTKQ-KTDSDMVAAIQKATNGG 265

>KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2
           YAL061W
          Length = 385

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 118/304 (38%), Gaps = 56/304 (18%)

Query: 82  AVAYAAGKPLTVEQIVVDP--PKAHEVRIKIEYTAVCHTDAYTLSGID-----PE----- 129
           A+AY A   +   + +V+P      E+ ++I Y  +C TD +    ID     PE     
Sbjct: 3   ALAYFAKGDIHFTKDLVEPKISTPDELILEINYCGICGTDLHEY--IDGPIFFPEDGETN 60

Query: 130 ----GAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGK--------------C 171
                  P  +               T  KVGDHV+      C                C
Sbjct: 61  ELSGSGLPQAMGHEIAGTVVKIGPKVTKFKVGDHVVVQPNGTCKDRYRWPHSPHVNKPWC 120

Query: 172 KFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXX 231
             CK G  N+C ++      G++ +G      Q G       GC+   +           
Sbjct: 121 SACKKGHYNVCSNL------GLIGNGV-----QSG-------GCA---ERMCINESHCFK 159

Query: 232 XXPKAPLDSISLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKI 291
                P+D  +L+     + +  AIK A  ++G +V V G G +GL  +   +  G S I
Sbjct: 160 VPKDMPMDIAALIQPIAVSWH--AIKVARFKRGGSVLVIGGGPIGLCTLLALQGHGCSDI 217

Query: 292 IVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMR 351
           +V +    +++ +   GAT +   + + ++    ++K+I   D G +Y FD +G  + + 
Sbjct: 218 VVSEPAKVRRELAERMGATTYDPSQHNTEKNIQNLRKMILGGD-GFDYVFDNSGTPETLE 276

Query: 352 DALE 355
            A+E
Sbjct: 277 TAIE 280

>CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar to
           uniprot|P39714 Saccharomyces cerevisiae YAL060w FUN49 or
           uniprot|P39713 Saccharomyces cerevisiae YAL061w FUN50
          Length = 383

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 113/299 (37%), Gaps = 66/299 (22%)

Query: 98  VDPPKA---HEVRIKIEYTAVCHTD----------------AYTLSGIDPEGAFPSILXX 138
           +D PK    HE+ I + +  +C TD                 + LSG+D     P  +  
Sbjct: 18  IDTPKINNDHELMIDVAWCGICGTDLHEFLEGPIFMPKDGDTHYLSGLD----LPLPMGH 73

Query: 139 XXXXXXXXXXXXXTNVKVGDHVIALYTAECGK--------------CKFCKSGKTNLCGS 184
                        T  K GD V+   T  CG               C  C+ G  N C +
Sbjct: 74  EMSGIVKEVGKGVTRFKPGDRVVIEATTSCGDTHRWPKSKVAKGELCPACEMGLPNCC-T 132

Query: 185 VRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLL 244
             + QG G +  G                    F++              K PLD  +L+
Sbjct: 133 HGSFQGLGSVGGG--------------------FAEQVVVGEKHVVKIPDKLPLDVAALV 172

Query: 245 GCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWS 304
              ++  + AA + A  ++G    V G+G +GL+++   K   A KI+V +    +++ +
Sbjct: 173 E-PLSVAWHAA-RLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPAKLRRELA 230

Query: 305 FDFGATDFVNPKEDLKEGETIVQKLIEMT--DGGLEYTFDCTGNVKVMRDALE-ACHKG 360
                  F NP       +  ++KL E++  D G +YTFDC+G       A++ AC +G
Sbjct: 231 EKLNVVVF-NPTH--TRAQNAIEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKAACIQG 286

>Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W
           (SOR1) - sorbitol-induced sorbitol dehydrogenase [contig
           381] FULL
          Length = 356

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 103/253 (40%), Gaps = 34/253 (13%)

Query: 101 PKAHEVRIKIEYTAVCHTDA-YTLSGIDPEGAF----PSILXXXXXXXXXXXXXXXTNVK 155
           P  H V++ I+ T +C +D  Y  SG    G +    P +L                ++K
Sbjct: 27  PNEHYVKVAIKATGICGSDIHYYKSG--SIGKYVVNQPMVLGHESSGEVVEVGSAVRSIK 84

Query: 156 VGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGT-SRFHNQKGEPLLHFMG 214
           VGD V              K G+ NLC  +       +  DGT  +++    + L+    
Sbjct: 85  VGDRVAIEPGVPDRYSDETKQGRYNLCPDMAFAATPPI--DGTLVKYYVSPADFLVKLPD 142

Query: 215 CSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGT 274
             +F +                    I  L  GV      A K A V  G  V VFGAG 
Sbjct: 143 HVSFEEGA-----------------CIEPLSVGVH-----ANKLAKVHFGSVVVVFGAGP 180

Query: 275 VGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLK-EGETIVQKLIEMT 333
           VGL     AK+ GAS++I VD+ ++K + +  FGAT  +N K   + EG+ +   +    
Sbjct: 181 VGLLTGAVAKAFGASEVIYVDVFDNKLERAKGFGATHTINSKSLPRGEGDAVSAAVSNYL 240

Query: 334 DGGL-EYTFDCTG 345
            G L +  F+C+G
Sbjct: 241 GGALADVVFECSG 253

>Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {ON}
           YOL086C (ADH1) - Alcohol dehydrogenase [contig 146] FULL
          Length = 216

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 91/230 (39%), Gaps = 27/230 (11%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P T  A V  + G  L  + I V  P + E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKAIVFASNGGELEYKDIPVPKPSSTEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                   KVGD   I      C  C++C+ G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVALGENVKGWKVGDLAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
             DG                   +F QY                L  ++ + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY- 160

Query: 254 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQ 302
            A+K+A+++ G  VA+ GA G +G   VQ A++ G  +++ +D  +DK++
Sbjct: 161 KALKSADLKAGQWVAISGACGGLGSLAVQYARAMG-YRVLGIDGGDDKRK 209

>Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)
          Length = 357

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 85/366 (23%), Positives = 143/366 (39%), Gaps = 55/366 (15%)

Query: 98  VDPPKAHEVRIKIEYTAVCHTDA--YTLSGIDPEGAF----PSILXXXXXXXXXXXXXXX 151
           +D P  H V++ I+ T +C +D   Y   GI   G +    P +L               
Sbjct: 27  IDDP--HYVKLAIKATGICGSDVHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAV 81

Query: 152 TNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGT-SRFHNQKGEPLL 210
           T VK+GD V              K G+ NLC  +       +  DGT  R++    + L+
Sbjct: 82  TRVKIGDRVAIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTLVRYYLSPEDFLV 139

Query: 211 HFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTANVQKGDTVAVF 270
                 ++ +                    +  L  GV +      K A V+ G  V VF
Sbjct: 140 KLPDGVSYEEGA-----------------CVEPLSVGVHSN-----KLAGVRFGTRVVVF 177

Query: 271 GAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGAT-DFVNPKEDLKEGETIVQKL 329
           GAG VGL     A + GAS +I VD+ +++ Q + DFGA+  F + K  + E + +  ++
Sbjct: 178 GAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEV 237

Query: 330 IEMTDG-GLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXXXXXXXXXXTRPFQLVTGRV 388
            ++  G   +  F+C+G        ++A  K                    P   V+G+ 
Sbjct: 238 EKLLGGHHADVVFECSG----ADVCIDAGVKTTKVGGTMVQVGMGKNYTNFPIAEVSGKE 293

Query: 389 WK-----GSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEINDAFED--LHHGD 441
            +       +FG  +    +        +GK+ V   ITHR  F +   A++    H GD
Sbjct: 294 MRLIGCFRYSFGDYRDAVNL------VASGKVNVKPLITHRFKFEDAAKAYDYNIAHGGD 347

Query: 442 CLRTVL 447
            ++T++
Sbjct: 348 VVKTII 353

>Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 85/366 (23%), Positives = 143/366 (39%), Gaps = 55/366 (15%)

Query: 98  VDPPKAHEVRIKIEYTAVCHTDA--YTLSGIDPEGAF----PSILXXXXXXXXXXXXXXX 151
           +D P  H V++ I+ T +C +D   Y   GI   G +    P +L               
Sbjct: 27  IDDP--HYVKLAIKATGICGSDVHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAV 81

Query: 152 TNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGT-SRFHNQKGEPLL 210
           T VK+GD V              K G+ NLC  +       +  DGT  R++    + L+
Sbjct: 82  TRVKIGDRVAIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTLVRYYLSPEDFLV 139

Query: 211 HFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTANVQKGDTVAVF 270
                 ++ +                    +  L  GV +      K A V+ G  V VF
Sbjct: 140 KLPDGVSYEEGA-----------------CVEPLSVGVHSN-----KLAGVRFGTRVVVF 177

Query: 271 GAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGAT-DFVNPKEDLKEGETIVQKL 329
           GAG VGL     A + GAS +I VD+ +++ Q + DFGA+  F + K  + E + +  ++
Sbjct: 178 GAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEV 237

Query: 330 IEMTDG-GLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXXXXXXXXXXTRPFQLVTGRV 388
            ++  G   +  F+C+G        ++A  K                    P   V+G+ 
Sbjct: 238 EKLLGGHHADVVFECSG----ADVCIDAGVKTTKVGGTMVQVGMGKNYTNFPIAEVSGKE 293

Query: 389 WK-----GSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEINDAFED--LHHGD 441
            +       +FG  +    +        +GK+ V   ITHR  F +   A++    H GD
Sbjct: 294 MRLIGCFRYSFGDYRDAVNL------VASGKVNVKPLITHRFKFEDAAKAYDYNIAHGGD 347

Query: 442 CLRTVL 447
            ++T++
Sbjct: 348 VVKTII 353

>SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]
           {ON} highly similar to gnl|GLV|KLLA0F00506g
           Kluyveromyces lactis KLLA0F00506g and similar to YAL060W
           uniprot|P39714 Saccharomyces cerevisiae YAL060W BDH1
           NAD- dependent (2R 3R)-2 3-butanediol dehydrogenase a
           zinc- containing medium-chain alcohol dehydrogenase
           produces 2 3- butanediol from acetoin during
           fermentation and allows using 2 3-butanediol as a carbon
           source during aerobic growth
          Length = 383

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 87/220 (39%), Gaps = 43/220 (19%)

Query: 153 NVKVGDHVIALYTAEC--------------GKCKFCKSGKTNLCGSVRATQGKGVMPDGT 198
           + KVGDHV+   T  C                C  CK G  N C  +    G G    G 
Sbjct: 89  DYKVGDHVVVEATCTCLDRYRWPKIESSKLPPCSACKRGIYNCCTHL-GFCGLGAHGGG- 146

Query: 199 SRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKT 258
                              FS+              + PLD  +L+     + +  A+K 
Sbjct: 147 -------------------FSEKVVISEQHVIKIPKEIPLDIAALVEPISVSWH--AVKI 185

Query: 259 ANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKED 318
           +N++ G +  V GAG +GL+ +   +  GA KI+V +    +++ +   G   F NP E 
Sbjct: 186 SNLKPGQSALVLGAGPIGLATILALQGHGAGKIVVSEPAQIRREQAAKLGVETF-NPFE- 243

Query: 319 LKEGETIVQKLIEMTDG--GLEYTFDCTGNVKVMRDALEA 356
              GE  V++L ++  G  G +++FDC+G        L A
Sbjct: 244 --HGEKAVEELRKIPPGGDGFDFSFDCSGMKATFDTGLHA 281

>KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 99/264 (37%), Gaps = 31/264 (11%)

Query: 76  PITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP-EGAFPS 134
           P T  A V    G  L    I V   KA+E+ I ++Y+ VCH+D Y      P     P 
Sbjct: 17  PKTQKAMVFSEYGGDLEYRDIPVPTKKANEILINVKYSGVCHSDLYVWKNRTPMTSKLPL 76

Query: 135 ILXXXXXXXXXXXXXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGV 193
           +                 N K+GD   +    + C  C+ C+ G    C     ++  G 
Sbjct: 77  VGGHEGAGVVVGMGSNVKNWKIGDKAGVKWLNSTCMTCEHCELGNEPSC---LKSEYNGF 133

Query: 194 MPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYG 253
             +G                   +F QY                L  ++   C   T Y 
Sbjct: 134 TRNG-------------------SFQQYVAVDAIHAPRLPDNCDLAELAPASCAGVTVY- 173

Query: 254 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
            AIK+AN++ G  +A+ GA G +G   +Q  K+ G  +++ +D    K     + G   F
Sbjct: 174 KAIKSANIRAGQWMAITGACGGLGSVAIQYCKAMG-YRVVGIDAGEAKANLFKELGGEVF 232

Query: 313 VNPKEDLKEGETIVQKLIEMTDGG 336
           +    D  + + +V  ++  T+GG
Sbjct: 233 I----DFTKSKDLVADVVSATNGG 252

>NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 55/104 (52%), Gaps = 6/104 (5%)

Query: 255 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVN 314
           A++ +  +KG +  + GAG +GL+ +   K+ GASKI+V ++   ++  +   G   F +
Sbjct: 184 AVRVSKFEKGKSALILGAGPIGLAAILALKAHGASKIVVSELAERRRILASKMGVEVF-D 242

Query: 315 PKEDLKEGETIVQKLIEMTDG--GLEYTFDCTGNVKVMRDALEA 356
           P    K G+  V +L  +  G  G +Y FDC+G       AL+A
Sbjct: 243 PS---KHGDNAVTELRNIPRGQHGFDYAFDCSGVKATFNTALKA 283

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 83/218 (38%), Gaps = 38/218 (17%)

Query: 152 TNVKVGDHVIALYTAEC--------------GKCKFCKSGKTNLCGSVRATQGKGVMPDG 197
           T  KVGDHV    T  C               KC  CK G  N+C  +    G GV   G
Sbjct: 87  TQFKVGDHVSVEPTGTCRDRYRWPEAPGVNKEKCAACKRGMYNVCSHL-GLIGNGVQSGG 145

Query: 198 TSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIK 257
                               F++                P++ ++L+     + +  A++
Sbjct: 146 --------------------FAERVVINESHCYKLPNHIPMEVVALVQPIAVSWH--AVR 183

Query: 258 TANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKE 317
            +  + G +V + G G +GLS +      G ++I+V +    ++  +   GA  +   + 
Sbjct: 184 VSKFKPGSSVLILGGGPIGLSTILALNGHGCTEIVVSEPAKIRRDLAEKMGAVVYDPMQH 243

Query: 318 DLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALE 355
             +E    ++ L    D G +Y FDC+G    +R ++E
Sbjct: 244 SYEENIKYLRALAPDKD-GFDYCFDCSGTPATLRSSIE 280

>Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W
           (BDH1) - (2R,3R)-2,3-butanediol dehydrogenase [contig
           44] FULL
          Length = 382

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 60/289 (20%), Positives = 113/289 (39%), Gaps = 47/289 (16%)

Query: 82  AVAYAAGKPLTVEQIVVDP--PKAHEVRIKIEYTAVCHTD----------------AYTL 123
           A+AY   K +     + +P    + +V+I I +  VC +D                 + +
Sbjct: 3   ALAYFGQKDIRFTNDLPEPTIQASDDVQIAISWCGVCGSDLHEYLDGPIFFPKDGEKHAM 62

Query: 124 SGIDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECG---KCKFCKSGKTN 180
           SG+      P  +                N+KVGDHV+   T  C    +    K     
Sbjct: 63  SGV----GLPQAMGHEMSGVVAKIGPGVKNIKVGDHVVVETTGTCKDRYRWPDVKHASDE 118

Query: 181 LCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCST--FSQYTXXXXXXXXXXXPKAPL 238
            C + +              F+N   E     +GC +  F++                PL
Sbjct: 119 ECAACK------------KDFYNCCSELGFCGLGCHSGGFAEKVVISEKHVVKVPKDIPL 166

Query: 239 DSISLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINN 298
           D  +L+     + +  A++ + ++ G +  + GAG +GL+ V   +  GA  I+V + + 
Sbjct: 167 DVAALVEPLAVSWH--AVRISQLKAGQSALILGAGPIGLATVLALQGHGAGTIVVSEPSA 224

Query: 299 DKKQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTDG--GLEYTFDCTG 345
            +++ +   GA  F NP      G+  V +L ++  G  G ++++DC+G
Sbjct: 225 SRRKQAEALGALTF-NP---FDHGDKAVDELRKIPPGSDGFDFSYDCSG 269

>SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]
           {ON} similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 385

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 86/216 (39%), Gaps = 38/216 (17%)

Query: 155 KVGDHVIALYTAEC--------------GKCKFCKSGKTNLCGSVRATQGKGVMPDGTSR 200
           +VGDHV+   T+ C                C  CK G  N+C  +    G GV   G   
Sbjct: 90  EVGDHVVVEPTSTCLDRYRFPNSKHSGEEPCAACKRGLYNICSHL-GLCGVGVQSGG--- 145

Query: 201 FHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTAN 260
                            FS+                PLD  +L+     + +  AI+ + 
Sbjct: 146 -----------------FSERVVMNQKHVIKIPKHIPLDVAALVQPLAVSWH--AIRISG 186

Query: 261 VQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLK 320
           +  G +  V G G +GL  +   ++ GASKI+V +   ++++ +   GA  F   + +  
Sbjct: 187 LTAGKSALVVGGGPIGLGTILALQAYGASKIVVSEPAKNRRELAKLMGAEVFDPTEWEEH 246

Query: 321 EGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
           E    ++K+    D G +Y+FDC+G     R ++ A
Sbjct: 247 EAVEYLRKVAPGGD-GFDYSFDCSGLPVTFRASVHA 281

>NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa]
           {ON} 
          Length = 439

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 84/218 (38%), Gaps = 38/218 (17%)

Query: 152 TNVKVGDHVIALYTAECGK--------------CKFCKSGKTNLCGSVRATQGKGVMPDG 197
           T  KVGD V+   T  C                C  CK G  N+C ++    G GV   G
Sbjct: 126 TKFKVGDRVVVEPTGTCKDRYRWPNSPNVDKEPCAACKKGLYNICSNL-GLVGAGVQSGG 184

Query: 198 TSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIK 257
                               F++                 +D  +L+     + +  A++
Sbjct: 185 --------------------FAERLVMNERQCYKVPDHMSMDVAALIQPIAVSWH--AVR 222

Query: 258 TANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKE 317
            +  +KG +V + GAG +GL  +      G S+++V +    ++ ++   GA  +    +
Sbjct: 223 VSKFKKGASVLIVGAGPIGLGTILALNGHGVSEVVVSEPAKIRRDFAEKMGAIVYDPSAK 282

Query: 318 DLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALE 355
           D  E    ++ +    D G +Y FDC+GN   ++ A+E
Sbjct: 283 DHDESIKYLRSIAPGGD-GFDYAFDCSGNPATLKAAIE 319

>ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q07786 Saccharomyces cerevisiae YDL246C SOR2
           Protein of unknown function computational analysis of
           large-scale protein-protein interaction data suggests a
           possible role in fructose or mannose metabolism
          Length = 351

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 100/268 (37%), Gaps = 44/268 (16%)

Query: 104 HEVRIKIEYTAVCHTDA--YTLSGIDPEGAF----PSILXXXXXXXXXXXXXXXTNVKVG 157
           H V++ I+ T +C +D   YT   I   G F    P +L               TNVKVG
Sbjct: 29  HYVKLHIKATGICGSDVHYYTQGAI---GQFVVKSPMVLGHESSGIVAEVGSAVTNVKVG 85

Query: 158 DHVIALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCST 217
           D V               SG  NLC                         P + F     
Sbjct: 86  DRVAIEPGIPSRYSDETMSGNYNLC-------------------------PHMVFAATPP 120

Query: 218 FSQYTXXXXXXXXXXXPKAPLDSISL----LGCGVTTGYGAAIKTANVQKGDTVAVFGAG 273
           +                K P D +S     L   ++ G  A  K A  + G  V V GAG
Sbjct: 121 YDGTLTKYYLAPEDFVYKMP-DHLSFEEGALAEPMSVGVHAN-KLAGTRFGSKVLVSGAG 178

Query: 274 TVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIVQKLIEMT 333
            VGL     A++ GA++++ VDI  +K + S  FGAT  V+   D    E  V ++ ++ 
Sbjct: 179 PVGLLAGAVARAFGATEVVFVDIAEEKLERSKQFGATHTVSSSSD---EERFVSEVSKVL 235

Query: 334 DGGL-EYTFDCTGNVKVMRDALEACHKG 360
            G L     +C+G    +R  ++AC  G
Sbjct: 236 GGDLPNIVLECSGAQPAIRCGVKACKAG 263

>NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa]
           {ON} 
          Length = 386

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 55/105 (52%), Gaps = 4/105 (3%)

Query: 255 AIKTANVQKGD--TVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDF 312
           A+K A  +KG      V GAG +GL+ +   K+ GASKI+V ++   +++ +   G   F
Sbjct: 181 AVKVAGFEKGSGKNALVLGAGPIGLATILALKAHGASKIVVSELAAIRRELALKMGVEVF 240

Query: 313 VNPKE-DLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
              K  D K+G   ++++ E  D G ++ FDC+G       AL +
Sbjct: 241 DPSKHGDEKQGIKKLREIPEDHD-GFDFAFDCSGVETTFNTALHS 284

>TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.253
           YBR046C
          Length = 335

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 66/140 (47%), Gaps = 12/140 (8%)

Query: 212 FMGCSTFSQYTXXXXXXXXXXXPKAPLD-SISLLGCGVTTGYGAAI---KTANVQKGDTV 267
           +M  STF+QYT           P    D  + +    +  G  A     +   V++GD +
Sbjct: 94  YMSSSTFAQYTKYSSSGLISKLPSETTDDQLKVYAAALIQGLTALTFLDEAYKVKEGDYI 153

Query: 268 AVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIV 326
            ++ A G VGL + Q  K RGA  I VV    +K++ +  FGA   +N  +     E I+
Sbjct: 154 LLYAAAGGVGLLMDQLLKERGAHAIAVVS-TEEKEELAKKFGAEYVINSSK-----EDIL 207

Query: 327 QKLIEMT-DGGLEYTFDCTG 345
           ++ +E+T D G++  FD  G
Sbjct: 208 KRALEITNDKGVDAVFDSVG 227

>YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative
           medium-chain alcohol dehydrogenase with similarity to
           BDH1; transcription induced by constitutively active
           PDR1 and PDR3
          Length = 417

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 60/269 (22%), Positives = 91/269 (33%), Gaps = 54/269 (20%)

Query: 105 EVRIKIEYTAVCHTDAYTLSG---IDPE---------GAFPSILXXXXXXXXXXXXXXXT 152
           E+ I IE+  +C TD +  +      PE            P  +                
Sbjct: 28  ELVIDIEWCGICGTDLHEYTDGPIFFPEDGHTHEISHNPLPQAMGHEMAGTVLEVGPGVK 87

Query: 153 NVKVGDHVIALYTAECGK--------------CKFCKSGKTNLCGSVRATQGKGVMPDGT 198
           N+KVGD V+   T  C                C  CK G  N+C S     G GV   G 
Sbjct: 88  NLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWCAACKKGYYNIC-SYLGLCGAGVQSGG- 145

Query: 199 SRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKT 258
                              F++                PLD  +L+       +  AI+ 
Sbjct: 146 -------------------FAERVVMNESHCYKVPDFVPLDVAALIQPLAVCWH--AIRV 184

Query: 259 ANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKED 318
              + G T  + GAG +GL  +    + G   I+V +    +++ +   GA  +      
Sbjct: 185 CEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPAKVRRELAEKMGARVYDPTAHA 244

Query: 319 LKEGETIVQKLIEMTDG--GLEYTFDCTG 345
            KE    +  L  + DG  G +YTFDC+G
Sbjct: 245 AKES---IDYLRSIADGGDGFDYTFDCSG 270

>NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16
          Length = 357

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 66/276 (23%), Positives = 100/276 (36%), Gaps = 56/276 (20%)

Query: 104 HEVRIKIEYTAVCHTDA--YTLSGI-DPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV 160
           H V+++I+ T +C +D   Y    I D     P +L                 +KVGD V
Sbjct: 31  HWVKVQIKATGICGSDVHFYKYGSIGDFVVKSPMVLGHESSGIIAEVGSAVKTLKVGDRV 90

Query: 161 IALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGC----S 216
                      +   SG  NLC                         P +HF        
Sbjct: 91  ALEPGYPSRYTEATMSGHYNLC-------------------------PFMHFAATPPCDG 125

Query: 217 TFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAI----------KTANVQKGDT 266
           T ++Y               P D +  L   V+   GA +          K A  + GD 
Sbjct: 126 TLTKYYL------------TPFDFVYKLPDNVSYEEGALLEPLSVGVHANKQAGTRFGDK 173

Query: 267 VAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIV 326
           V VFGAG VGL     AK  GA +++ +D+ ++K + +  FGAT  +N  +     E  +
Sbjct: 174 VVVFGAGPVGLLNGAVAKVFGALQVVFIDVVDEKLERAKHFGATAVINSSKLRINDEFEL 233

Query: 327 QKLIEMTDGGL--EYTFDCTGNVKVMRDALEACHKG 360
              I+   GG+  +   +CTG    +R  + A   G
Sbjct: 234 AVAIKEKLGGVDPDIVLECTGAEPCIRAGIRALKTG 269

>KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {ON}
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 86/358 (24%), Positives = 130/358 (36%), Gaps = 47/358 (13%)

Query: 103 AHEVRIKIEYTAVCHTDA--YTLSGIDPEGAF----PSILXXXXXXXXXXXXXXXTNVKV 156
           +H V+I ++ T +C +D   YT   I   G F    P +L               T V+V
Sbjct: 29  SHYVKIHVKKTGICGSDIHYYTHGSI---GEFVVKKPMVLGHESSGVVVEVGKDVTLVQV 85

Query: 157 GDHVIALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCS 216
           GD V              KSG  NLC                         P + F    
Sbjct: 86  GDRVAIEPGVPSRYSDETKSGHYNLC-------------------------PHMAFAATP 120

Query: 217 TFSQYTXXXXXXXXXXXPKAPLDSISLL--GCGVTTGYGA-AIKTANVQKGDTVAVFGAG 273
            +                K P D +S     C      G  A + A    G  V VFGAG
Sbjct: 121 PYDGTLVKYYLAPEDFLVKLP-DHVSFEEGACAEPLAVGVHANRLAETSFGKNVVVFGAG 179

Query: 274 TVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIVQKLIEMT 333
            VGL     A + GAS ++ VD+  +K + S DFGAT+ +N  +   E E       E+ 
Sbjct: 180 PVGLVTGAVAAAFGASAVVYVDVFENKLERSKDFGATNTINSTKYKSEDELTEVIKSELK 239

Query: 334 DGGLEYTFDCTGNVKVMRDALEACHKGWXXXXXXXXXXXXXXXXTRPFQLVTGRVWKGSA 393
               E   DC+G    +R A++    G                   P  ++  +  +   
Sbjct: 240 GEQPEIAIDCSGAEICIRTAIKVLKAGG----SYVQVGMGKDNINFPIAMIGAKELR--V 293

Query: 394 FGGIKGR-SEMGGLIEDYQNGKLKVDEFITHRRPFTEINDAFE-DLHHG-DCLRTVLD 448
            G  +   ++    ++    GK+ V + ITH   F E  DA+  +L HG + ++T++D
Sbjct: 294 LGSFRYYFNDYKIAVKLISEGKVNVKKMITHTFKFEEAIDAYNFNLEHGSEVVKTMID 351

>KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 353

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 68/142 (47%), Gaps = 12/142 (8%)

Query: 210 LHFMGCSTFSQYTXXXXXXXXXXXPK-APLDSISLLGCGVTTGYGAAI---KTANVQKGD 265
           + ++  STF+Q+T           PK    +   ++   +  G        +  NVQKGD
Sbjct: 110 VAYLSASTFAQFTKYPQNGHLIKLPKDISAEKEKIIAGSLVQGLTPLTFIDEAYNVQKGD 169

Query: 266 TVAVF-GAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGET 324
            + V+  AG VGL   Q  K+RGA + I V   ++K Q + ++GA   +N  +D      
Sbjct: 170 FILVYAAAGGVGLIFDQLLKARGA-RTIAVASTDEKLQLAKEYGAEFLINSTKD-----D 223

Query: 325 IVQKLIEMTDG-GLEYTFDCTG 345
           IV+K+ E T+G G+   FD  G
Sbjct: 224 IVEKVKEFTNGEGVAAAFDSIG 245

>KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3
           YAL060W
          Length = 381

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 4/120 (3%)

Query: 237 PLDSISLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDI 296
           PLD  +L+     T + A  K     KG T  + G+G +GL+++   K+ GASKI+V ++
Sbjct: 165 PLDVAALVEPLSVTWHAA--KVGKFVKGSTALILGSGPIGLAMILVLKALGASKIVVSEV 222

Query: 297 NNDKKQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEA 356
              +++ +       F +P    K     ++ L E  D G ++ FDC+G    M  A+ A
Sbjct: 223 AQVRRKLAEKMKVEVF-DPSVHGKNTSNELRLLTENKD-GFDFAFDCSGLEVTMNTAIHA 280

>YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}
           ZTA1NADPH-dependent quinone reductase, GFP-tagged
           protein localizes to the cytoplasm and nucleus; has
           similarity to E. coli quinone oxidoreductase and to
           human zeta-crystallin
          Length = 334

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 70/140 (50%), Gaps = 12/140 (8%)

Query: 212 FMGCSTFSQYTXXXXXXXXXXXPKAPLDS-ISLLGCG---VTTGYGAAIKTANVQKGDTV 267
           ++  STF+QY+           PK   D  + L   G   V T      +  +V+KGD V
Sbjct: 93  YISNSTFAQYSKISSQGPVMKLPKGTSDEELKLYAAGLLQVLTALSFTNEAYHVKKGDYV 152

Query: 268 AVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIV 326
            +F A G VGL + Q  K +GA  I V    ++K + + ++GA   +N  +     E I+
Sbjct: 153 LLFAAAGGVGLILNQLLKMKGAHTIAVAS-TDEKLKIAKEYGAEYLINASK-----EDIL 206

Query: 327 QKLIEMTDG-GLEYTFDCTG 345
           +++++ T+G G++ +FD  G
Sbjct: 207 RQVLKFTNGKGVDASFDSVG 226

>Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 75/208 (36%), Gaps = 38/208 (18%)

Query: 152 TNVKVGDHVIALYTAECGK--------------CKFCKSGKTNLCGSVRATQGKGVMPDG 197
            ++KVGD V+   T  C                C  CK G  N+C S     G GV   G
Sbjct: 87  AHLKVGDKVVVEPTGTCRDRYRWPNSPNVSKEWCAACKKGYYNIC-SYLGLCGAGVQSGG 145

Query: 198 TSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIK 257
                               F++                PLD  +L+       +  AI 
Sbjct: 146 --------------------FAERVVMNESHCYKVPDFVPLDVAALIQPLAVCWH--AIS 183

Query: 258 TANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKE 317
               + G T  + GAG +GL  +    + G   I+V +    +++ +   GA  +   + 
Sbjct: 184 VCEFKAGSTALIIGAGPIGLGTILALDAAGCKDIVVSEPAKLRRELAEKMGARVYDPTEH 243

Query: 318 DLKEGETIVQKLIEMTDGGLEYTFDCTG 345
             KE    ++ + E  D G +YTFDC+G
Sbjct: 244 AAKESIDYLRSIAEGGD-GFDYTFDCSG 270

>KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.253
           YBR046C
          Length = 334

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 67/142 (47%), Gaps = 12/142 (8%)

Query: 210 LHFMGCSTFSQYTXXXXXXXXXXXPKA-PLDSISLLGCGVTTGYGAAI---KTANVQKGD 265
           + ++  +TF+Q+T           P     + + L   G+  G  A     +  +V+KGD
Sbjct: 91  VSYIAGATFAQFTKVPNSTHVFKLPDTTSTEQLKLYAAGMIQGLTALTFVNEAYDVKKGD 150

Query: 266 TVAVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGET 324
            V ++ A G VGL   Q  + RGA  I V    N+K   + + GA   +N KED      
Sbjct: 151 YVLLYAAAGGVGLIFNQLLRMRGAHTIAVAS-TNEKLSLAKENGAEFLINSKED-----N 204

Query: 325 IVQKLIEMTDG-GLEYTFDCTG 345
           I++K+ ++T G G++  FD  G
Sbjct: 205 ILEKVQQITKGNGVDVAFDSVG 226

>Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 75/208 (36%), Gaps = 38/208 (18%)

Query: 152 TNVKVGDHVIALYTAECGK--------------CKFCKSGKTNLCGSVRATQGKGVMPDG 197
            ++KVGD V+   T  C                C  CK G  N+C S     G GV   G
Sbjct: 87  AHLKVGDKVVVEPTGTCRDRYRWPESPNVDKEWCAACKKGYYNIC-SYLGLCGAGVQSGG 145

Query: 198 TSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIK 257
                               F++                PLD  +L+       +  AI 
Sbjct: 146 --------------------FAERVVMNESHCYKVPDFVPLDVAALIQPLAVCWH--AIS 183

Query: 258 TANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKE 317
               + G T  + GAG +GL  +    + G   I+V +    +++ +   GA  +   + 
Sbjct: 184 VCEFKAGSTALIIGAGPIGLGTILALNAAGCRDIVVSEPAKLRRELAEKMGARVYDPTEH 243

Query: 318 DLKEGETIVQKLIEMTDGGLEYTFDCTG 345
             +E    ++ + E  D G +YTFDC+G
Sbjct: 244 AARESIDYLRSVAEGGD-GFDYTFDCSG 270

>Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 77/208 (37%), Gaps = 38/208 (18%)

Query: 152 TNVKVGDHVIALYTAECGK--------------CKFCKSGKTNLCGSVRATQGKGVMPDG 197
           T  KVGD V+   T  C                C  CK G  N+C S     G GV   G
Sbjct: 87  TQFKVGDKVVVEPTGTCRDRYRWPTSPNVDKEWCAACKRGLYNIC-SYLGLCGAGVQSGG 145

Query: 198 TSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIK 257
            +         +++   C    ++               PLD  +L+       +  AI 
Sbjct: 146 FAE------RVVINESHCYKVPEFV--------------PLDVAALIQPLAVCWH--AIS 183

Query: 258 TANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKE 317
             + + G T  + GAG +GL  +    + G S I V +    +++ +   GA  F     
Sbjct: 184 VCDFKAGSTALIIGAGPIGLGTILALNAAGCSDIAVSEPAKVRRELAEKMGARVFDPTAH 243

Query: 318 DLKEGETIVQKLIEMTDGGLEYTFDCTG 345
             K+    ++ +    D G +YTFDC+G
Sbjct: 244 AAKDSIDYLRSVAPGGD-GYDYTFDCSG 270

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 64/136 (47%), Gaps = 9/136 (6%)

Query: 213 MGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTANV----QKGDTVA 268
           +  STF +YT            +  LD  S +G  + T   A     NV    ++  ++ 
Sbjct: 142 LRTSTFQEYTVFDSRLVWRVPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEEKKSIV 201

Query: 269 VFGAGT-VGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIVQ 327
           ++G  T VG+ VVQ AKS G +KII +  +   +Q+    GAT  ++ +E   + E IV 
Sbjct: 202 IWGGSTGVGIFVVQLAKSLGFTKIITIT-SKKHEQYLLSLGATHIIHREE---KTEDIVN 257

Query: 328 KLIEMTDGGLEYTFDC 343
           ++ ++   G+ +  D 
Sbjct: 258 EIKKICPNGVSHGVDL 273

>KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 237 PLDSISLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDI 296
           P+D  +L+   ++  + AA + +    G +  V GAG +GL+++   K++GASKIIV + 
Sbjct: 165 PMDVAALIE-PLSVAWHAA-RVSKFPPGKSALVLGAGPIGLAMILVLKAQGASKIIVSEP 222

Query: 297 NNDKKQWSFDFGATDFVNPKEDLKEGETIVQKLIEMT-DG-GLEYTFDCTGNVKVMRDAL 354
              +++ + D    +  +P      G+  V  L   T DG G ++ FDC+G        L
Sbjct: 223 ATMRRELA-DRMHVETFDPS---THGDKSVAMLRSKTFDGKGFDFAFDCSGVPATFNTGL 278

Query: 355 EACH 358
           +A H
Sbjct: 279 QAAH 282

>KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 83/216 (38%), Gaps = 19/216 (8%)

Query: 105 EVRIKIEYTAVCHTDAYTLSGIDPEGAFPSILXXXXXXXXXXXXXXXTN-VKVGDHV-IA 162
           ++ +KIE   VC +D +  SG   + A P I+               T+ VKVGD V + 
Sbjct: 35  DIDVKIECCGVCGSDVHCASGHWGDIAKPLIVGHEIVGHVVKVGPNCTSGVKVGDRVGLG 94

Query: 163 LYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYT 222
                C KCK C +G  + C            P+    +     +  +   G   ++ Y 
Sbjct: 95  AQALSCMKCKRCLNGNESYC------------PNAIQTYSTPYEDGYVSKGG---YADYV 139

Query: 223 XXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQG 282
                         P    + L CG  T +   ++      G  VA+ G G +G   V  
Sbjct: 140 RVHEQFTVPIPENIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVAILGIGGIGHMGVLL 198

Query: 283 AKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKED 318
           AK+ GA ++  +   + KK+ +   GA  F+  KE+
Sbjct: 199 AKAMGA-EVYAISRTSSKKEDAMKLGADHFIATKEE 233

>ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C ZTA1 Zeta-crystallin homolog
          Length = 349

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 66/141 (46%), Gaps = 14/141 (9%)

Query: 212 FMGCSTFSQYTXXXXXXXXXXXPK-APLDSISLLGCGVTTGYGAAI---KTANVQKGDTV 267
           ++  S F+QYT           PK A  +++ L   G+     A     +  NV+KGD +
Sbjct: 109 YLSGSAFAQYTKVDAAGKVVKLPKDANDETLKLYAAGLLQSLTALTFIDEAYNVKKGDFI 168

Query: 268 AVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGAT-DFVNPKEDLKEGETI 325
             + A G VGL + Q  K RGA  I VV    +K + +   GA    ++ KED      I
Sbjct: 169 LNYAAAGGVGLILDQLLKERGAHTIAVVS-TEEKLELAKKHGAEYGIISSKED------I 221

Query: 326 VQKLIEMTDG-GLEYTFDCTG 345
           V ++ E+T+  G++  FD  G
Sbjct: 222 VTRVKEITNNQGVDAAFDSIG 242

>Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON}
           YJR159W (REAL)
          Length = 68

 Score = 34.3 bits (77), Expect = 0.058,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 255 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFV 313
           A++   V+ GD V V     +GL V    +  G  K++++   + KKQ S  FG T F+
Sbjct: 11  AVRLPQVKYGDCVVVISVRAIGLLVDAVFREFGVDKVVLMSTQDSKKQ-SEQFGGTGFI 68

>Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318C
           (ADH6) - NADPH-dependent alcohol dehydrogenase [contig
           207] FULL
          Length = 373

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 49/227 (21%), Positives = 85/227 (37%), Gaps = 30/227 (13%)

Query: 101 PKA---HEVRIKIEYTAVCHTDAYTLS---GIDPEGAFPS-------ILXXXXXXXXXXX 147
           PKA   H+V I++E   +C ++ + L    G  P     S       ++           
Sbjct: 28  PKAFGPHDVDIEVECCGICASELFALKNEWGHAPLACLSSKYGPKTQVVGHEVVGKVVAV 87

Query: 148 XXXXTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKG 206
               +   VGD V +    + C +C  C SG    C +  +T  K   PDG   + +Q G
Sbjct: 88  GPQVSLCNVGDRVGLGAQASACMQCSRCNSGNEQYCPNAISTYCK-PYPDG---YVSQGG 143

Query: 207 EPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTANVQKGDT 266
                      ++ +            P+ P + ++ L CG  T +    +    +    
Sbjct: 144 -----------YASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFSPIKRNLQGKHDPK 192

Query: 267 VAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFV 313
           VAV G G +G   +  A++ GA ++      + K+  +   GA  FV
Sbjct: 193 VAVIGIGGLGHMAIMIARALGA-EVYAFSRGHSKRDDALKMGAHHFV 238

>CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {ON}
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046c ZTA1
          Length = 333

 Score = 36.6 bits (83), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 64/140 (45%), Gaps = 12/140 (8%)

Query: 212 FMGCSTFSQYTXXXXXXXXXXXPKA-PLDSISLLGCGVT---TGYGAAIKTANVQKGDTV 267
           ++G STF+QYT            ++ P + + L G  +    T      +   V +GD +
Sbjct: 92  YLGGSTFAQYTKKSTENHIMNLGQSCPDEDLKLYGSSLVQCLTAISFIDEAYKVMEGDYI 151

Query: 268 AVFGA-GTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIV 326
            V+ A G VG  + Q    R A  +I V  + +K   + + GA   +N  ED      I+
Sbjct: 152 LVYAASGGVGSILCQLISQRKA-HVIAVASSAEKLAMAKENGAEFLINYAED-----DIL 205

Query: 327 QKLIEMTDG-GLEYTFDCTG 345
           +K+++ T+G G+   FD  G
Sbjct: 206 EKVMQYTNGKGVHAAFDSIG 225

>NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 82/216 (37%), Gaps = 18/216 (8%)

Query: 104 HEVRIKIEYTAVCHTDAYTLSGIDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDHV-IA 162
           ++V +KIE   VC +D +T SG   E   P ++                 +KVGD V I 
Sbjct: 38  YDVEVKIECCGVCGSDIHTASGHWGETKKPLVVGHEIIGTVTQIGSQCNELKVGDRVGIG 97

Query: 163 LYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYT 222
                C +C  CKS     C     T  K    D T  ++++ G           ++ Y 
Sbjct: 98  AQVFSCLECDRCKSDNEPYCPKTVNTYRK----DYTDGYNSKGG-----------YADYI 142

Query: 223 XXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQG 282
                         P    + L CG  T +   ++      G  V + G G +G   +  
Sbjct: 143 RLHEHFAVPIPENIPSHLAAPLMCGGVTAFSPLLRNG-CGPGKKVGIMGIGGIGHMGLIF 201

Query: 283 AKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKED 318
           AK+ GA +   +  ++ KK+ +   GA  F+  KE+
Sbjct: 202 AKAMGA-ETFAISRSSAKKEDAIKMGADHFIATKEE 236

>TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {ON}
           Anc_7.3 YAL060W
          Length = 392

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 64/281 (22%), Positives = 99/281 (35%), Gaps = 54/281 (19%)

Query: 105 EVRIKIEYTAVCHTD--AYTLSGI--DPEGA--------FPSILXXXXXXXXXXXXXXXT 152
           E+ I + Y  +C TD   YT   I   P+G          P  +                
Sbjct: 28  ELIIAVSYCGICGTDLKEYTEGAIFFPPDGGHNEISGNGLPQAMGHEISGVVEKVGKGCK 87

Query: 153 NVKVGDHVIALYTAECGK--------------CKFCKSGKTNLCGSVRATQGKGVMPDGT 198
             KVGDHV+   T  C                C  C  G TN+C  + A  G G+   G 
Sbjct: 88  TFKVGDHVVVEPTGTCKDRYRWPESQNANKPMCSACSIGMTNICAHL-ALCGAGLESGG- 145

Query: 199 SRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKT 258
                              F++                PLD  +L+       +  A+K 
Sbjct: 146 -------------------FAERLVINEAHVHKIPDHMPLDIGALIQPISVCWH--AVKV 184

Query: 259 ANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKED 318
           A+ +KG +  + G G +GL  +   K  G   I++ +    +++++   GA  +      
Sbjct: 185 AHYKKGGSALIIGGGPIGLGTILALKGFGCEYIVLSEPATIRREYAGKMGAKVYDPTGVP 244

Query: 319 LKEGETIVQKLIEM--TDGGLEYTFDCTGNVKVMRDALEAC 357
             E    V+ L EM     G +YTFDC+G    +  A+E C
Sbjct: 245 FDES---VKTLREMGPNGDGFDYTFDCSGLPITLNAAIECC 282

>KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} similar
           to uniprot|P25377 Saccharomyces cerevisiae YCR105W ADH7
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis
          Length = 374

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 74/202 (36%), Gaps = 30/202 (14%)

Query: 155 KVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFM 213
           KVGD V +    + C +C  C+S     C     T      PDG   + +Q G       
Sbjct: 95  KVGDRVGLGAQASACMQCSRCQSSNEQYCAQSIGTYCN-PYPDG---YVSQGG------- 143

Query: 214 GCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTANVQKGDTVAVFGAG 273
               ++ +            P+ P + ++ L CG  T +    +    +K   VA+ G G
Sbjct: 144 ----YASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFSPIKRNIQGKKNPRVAIIGIG 199

Query: 274 TVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIVQKLIEMT 333
            +G   +  +K+ GA ++  V     K+  +   GA  F+   E                
Sbjct: 200 GLGHMAIMISKALGA-EVSAVSRGYSKRDDALKMGADHFIATSE-------------PNW 245

Query: 334 DGGLEYTFDCTGNVKVMRDALE 355
           + GL+ TFD   N      +L+
Sbjct: 246 NAGLDDTFDLILNCASSTSSLD 267

>NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 41/96 (42%), Gaps = 3/96 (3%)

Query: 104 HEVRIKIEYTAVCHTDAYTLSGIDPEGAFPSILXXXXXXXXXXXXXXXTN-VKVGDHV-I 161
           H+++IK+E   VC +D +  SG       P ++                N +KVGD V +
Sbjct: 34  HDIQIKVECCGVCGSDIHAASGHWGNIPTPLVVGHEIVGRVVKVGDRCDNGLKVGDRVGV 93

Query: 162 ALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDG 197
                 C +C  CK+   + C    AT G G  PDG
Sbjct: 94  GAQVFSCLECNRCKTDNESYCPKWVATYG-GEYPDG 128

>KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa]
           {ON} 
          Length = 360

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 88/228 (38%), Gaps = 19/228 (8%)

Query: 104 HEVRIKIEYTAVCHTDAYTLSGIDPEGAFPSILXXXXXXXXXXXXXXXTN-VKVGDHV-I 161
           +++ IKIE   VC +D +  SG   +   P ++               T+ +KVGD V +
Sbjct: 34  NDIDIKIEACGVCGSDVHMASGNWGDVKKPLVVGHEIVGTVVKVGSKCTSGMKVGDRVGV 93

Query: 162 ALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQY 221
                 C  C  C +     C +V  T G    PDG    +N KG           ++ Y
Sbjct: 94  GAQVHSCLTCDRCNNDNEQYCPNVVFTYGFD-YPDG----YNGKG----------GYANY 138

Query: 222 TXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQ 281
                          P    + L CG  T Y   ++      G  V + G G +G   + 
Sbjct: 139 IRVHEHFAVPIPENIPTHLAAPLLCGGITVYSPLLRNG-CGPGKKVGILGIGGIGHMGII 197

Query: 282 GAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIVQKL 329
            AKS GA ++  +  ++ KK+ +F  GA  F+  K++   G+     L
Sbjct: 198 FAKSMGA-EVYAISRSDAKKEDAFKLGADHFIATKDEPDWGKKYFDTL 244

>SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 52/265 (19%), Positives = 90/265 (33%), Gaps = 40/265 (15%)

Query: 102 KAHEVRIKIEYTAVCHTDAYTLSGI---DPEGAFPS-------ILXXXXXXXXXXXXXXX 151
           +AH+V I++E   +C ++ ++L      +P     S       ++               
Sbjct: 34  EAHDVDIEVECCGICASELFSLKNEWKHEPLACLSSSYGPKSQVVGHEVVGKVVAVGSNV 93

Query: 152 TNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLL 210
           T   +GD V +      C KC  C SG    C     T          SR+ +       
Sbjct: 94  TLCNIGDRVGLGAQAFSCMKCSRCNSGNEQYCPQAVGTY--------CSRYADG------ 139

Query: 211 HFMGCSTFSQYTXXXXXXXXXXXPKAPLDSISLLGCGVTTGYGAAIKTANVQKGDTVAVF 270
            ++    ++ +               P + ++ L CG  T Y    +     K   VA+ 
Sbjct: 140 -YISQGGYASHVRAHEQFCFPIPDDIPSELVAPLQCGGLTVYSPIKRNIEGVKDPKVAII 198

Query: 271 GAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIVQKLI 330
           G G +G   +  +K+ GA ++        KK+ +   GA  F+   E             
Sbjct: 199 GIGGLGHMAIMISKALGA-EVTAFSRGYSKKEDALKMGAHHFIATGE------------- 244

Query: 331 EMTDGGLEYTFDCTGNVKVMRDALE 355
           E  + GL  TFD   N      +L+
Sbjct: 245 EGWESGLNDTFDLILNCASSTTSLD 269

>Suva_7.5 Chr7 (12884..13522) [639 bp, 212 aa] {ON} YLR460C (REAL)
          Length = 212

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 47/100 (47%), Gaps = 13/100 (13%)

Query: 262 QKGDTVAVFGAGT-VGLSVVQGAKS-RGASKIIVVDINNDKKQWSFDFGATDFVNPKEDL 319
           Q+   V ++G  T VG  V+Q AK   G +KIIVV     +KQ   ++GA +      D 
Sbjct: 9   QRDHPVLIWGGATAVGQHVIQLAKKLNGFTKIIVVASQKHEKQLK-EYGADELF----DY 63

Query: 320 KEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHK 359
            + + + Q  I+     + Y  DC  NV    D L+  +K
Sbjct: 64  HDADVVEQ--IKKKYKNIPYLVDCVANV----DTLQQVYK 97

>Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)
          Length = 125

 Score = 31.6 bits (70), Expect = 1.6,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 34/83 (40%), Gaps = 8/83 (9%)

Query: 105 EVRIKIEYTAVCHTDAYTLSG-----IDPEGAFPSILXXXXXXXXXXXXXXXTNVKVGDH 159
           +V IK+E   VC +D +  +G      DP  A   I+                +++VG  
Sbjct: 35  DVEIKVEACGVCGSDIHCAAGHWGPRNDPLVAGHEIVGRIVRMGSRCSSQLKVDMRVGMG 94

Query: 160 VIALYTAECGKCKFCKSGKTNLC 182
            I   T  C KC  CK G+ N C
Sbjct: 95  AI---TFSCLKCSGCKKGEENYC 114

>Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159W
           (REAL)
          Length = 89

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 289 SKIIVVDINNDKKQWSFDFGAT-DFVNPKEDLKEGETIVQKLIEMTDG-GLEYTFDCTG 345
           S +I VD+ ++K Q + DFGAT  F + K  + E + +  +L ++  G   +  F+C+G
Sbjct: 1   SDVIFVDVFDNKLQRAKDFGATGTFNSSKFSVDEAQQLADELEKLLGGHQADVVFECSG 59

>NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 46/110 (41%), Gaps = 5/110 (4%)

Query: 94  EQIVVDPPKA--HEVRIKIEYTAVCHTDAYTLSGIDPEGAFPSILXXXXXXXXXXXXXX- 150
           +++  DP K   H++ IK+E   VC +D +  SG   +   P ++               
Sbjct: 24  KKVQFDPRKLYDHDIEIKVECCGVCGSDIHAASGNWGDLTKPLVVGHEIIGTVVRLGENC 83

Query: 151 XTNVKVGDHV-IALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTS 199
            + +K+GD V +      C  C+ CK+     C     T G+   PDG S
Sbjct: 84  NSGLKLGDRVGVGAQVFSCLDCERCKNDNEPYCEGFVTTYGQD-YPDGYS 132

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 49/101 (48%), Gaps = 1/101 (0%)

Query: 255 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATDFVN 314
           A++ +  + G +V + G G +GL  +      G ++++V +    ++  +   GA  +  
Sbjct: 181 AVRVSKFKPGSSVLIIGGGPIGLGTILALNGHGVTEVVVSEPAKIRRDLAEKMGAVVYDP 240

Query: 315 PKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALE 355
              D  E    ++ +    D G +YTFDC+GN   ++ A+E
Sbjct: 241 MTRDHDESIKYLRSIAPGGD-GFDYTFDCSGNPATLKAAIE 280

>KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON}
           similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 381

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 62/292 (21%), Positives = 105/292 (35%), Gaps = 55/292 (18%)

Query: 82  AVAYAAGKPLTVEQIVVDP--PKAHEVRIKIEYTAVCHTDAYTLSGIDPEGAFP------ 133
           A+AY   + +     + +P   K  +V I I +  +C TD + L  +D    FP      
Sbjct: 3   ALAYFGTRDIRFTTDLPEPVIEKPDDVLIDIVWCGICGTDLHEL--LDGPNFFPKDGETH 60

Query: 134 --------SILXXXXXXXXXXXXXXXTNVKVGDHVIALYTAECGK----------CKFCK 175
                     +               T  + GDHV+   T  C            CK CK
Sbjct: 61  EISGRGLPQAMGHEMAGVVSQVGSSVTKFQPGDHVVVEPTGTCQDRERYNTKGETCKACK 120

Query: 176 SGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTXXXXXXXXXXXPK 235
            G  N+C  +    G GV   G                    F++               
Sbjct: 121 RGMHNVCVHL-GLCGCGVQSGG--------------------FAEKVVIGEKHCFKVPSW 159

Query: 236 APLDSISLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVD 295
            PLD  +L+       +  A+K   V++G +  + G G +GL ++   +  G + I+V +
Sbjct: 160 IPLDVAALIQPLAVCWH--AVKLGAVKEGQSALILGGGPIGLGIIMALQHFGCTDIVVSE 217

Query: 296 INNDKKQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTDGG--LEYTFDCTG 345
               ++  +   GA   V+   D K  E  ++ L  ++  G   ++TFDC+G
Sbjct: 218 PAKIRRDLAEKMGA--IVSNPMDFKTNEENIKNLCSLSPNGEGYDFTFDCSG 267

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,781,027
Number of extensions: 1666403
Number of successful extensions: 4060
Number of sequences better than 10.0: 172
Number of HSP's gapped: 4016
Number of HSP's successfully gapped: 178
Length of query: 451
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 338
Effective length of database: 40,524,141
Effective search space: 13697159658
Effective search space used: 13697159658
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)