Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0A141407.348ON2241899321e-128
Kpol_530.337.348ON1951837771e-105
NDAI0A019107.348ON2141867771e-105
TPHA0F029507.348ON2161847721e-104
SAKL0F11330g7.348ON2081837521e-101
TDEL0C020007.348ON2131877511e-101
KAFR0B008607.348ON2281817511e-101
KLLA0D12386g7.348ON2111817287e-98
Smik_4.727.348ON1971837086e-95
TBLA0E005207.348ON2091827062e-94
YDL166C (FAP7)7.348ON1971837025e-94
KNAG0C037707.348ON2231886994e-93
Ecym_47257.348ON2341826988e-93
ZYRO0F11660g7.348ON1981856912e-92
CAGL0I03366g7.348ON2121866923e-92
Suva_4.807.348ON2061836862e-91
ACL150W7.348ON2191806839e-91
KLTH0H01298g7.348ON2141816802e-90
Kwal_56.246357.348ON2261816794e-90
Skud_4.917.348ON1941796764e-90
YML065W (ORC1)4.327ON91452750.39
KNAG0G018808.236ON22537730.44
TBLA0C004808.101ON36035720.97
Suva_13.924.327ON92352701.7
Smik_13.794.327ON93952692.1
Kwal_56.236388.295ON492220692.7
Ecym_35158.239ON63627664.6
YOR342C7.48ON31993655.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0A14140
         (224 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7....   363   e-128
Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON} ...   303   e-105
NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON...   303   e-105
TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.34...   301   e-104
SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar...   294   e-101
TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON...   293   e-101
KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.34...   293   e-101
KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa] ...   285   7e-98
Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON} ...   277   6e-95
TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348 ...   276   2e-94
YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}  F...   275   5e-94
KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.34...   273   4e-93
Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON...   273   8e-93
ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar...   270   2e-92
CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {O...   271   3e-92
Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON} ...   268   2e-91
ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homol...   267   9e-91
KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {O...   266   2e-90
Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL16...   266   4e-90
Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON} ...   265   4e-90
YML065W Chr13 (142210..144954) [2745 bp, 914 aa] {ON}  ORC1Large...    33   0.39 
KNAG0G01880 Chr7 (420542..421219) [678 bp, 225 aa] {ON} Anc_8.23...    33   0.44 
TBLA0C00480 Chr3 (88992..90074) [1083 bp, 360 aa] {ON} Anc_8.101...    32   0.97 
Suva_13.92 Chr13 (144893..147664) [2772 bp, 923 aa] {ON} YML065W...    32   1.7  
Smik_13.79 Chr13 (139688..142507) [2820 bp, 939 aa] {ON} YML065W...    31   2.1  
Kwal_56.23638 s56 (632586..647354) [14769 bp, 4922 aa] {ON} YLR1...    31   2.7  
Ecym_3515 Chr3 complement(963673..965583) [1911 bp, 636 aa] {ON}...    30   4.6  
YOR342C Chr15 complement(966666..967625) [960 bp, 319 aa] {ON} P...    30   5.5  

>NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7.348
           YDL166C
          Length = 224

 Score =  363 bits (932), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 176/189 (93%)

Query: 1   MSKSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSH 60
           MSKSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSH
Sbjct: 1   MSKSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSH 60

Query: 61  IVXXXXXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDT 120
           IV             RQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDT
Sbjct: 61  IVDEDKLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDT 120

Query: 121 KIEENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGV 180
           KIEENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGV
Sbjct: 121 KIEENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGV 180

Query: 181 TNELEDKQR 189
           TNELEDKQR
Sbjct: 181 TNELEDKQR 189

>Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON}
           complement(81184..81771) [588 nt, 196 aa]
          Length = 195

 Score =  303 bits (777), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 161/183 (87%)

Query: 4   SRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIVX 63
           SRR +PNLLITGTPGCGKST+CELLQRRL +YKYYNISDFAKEHDCY+GYD+ RKSHIV 
Sbjct: 3   SRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHIVD 62

Query: 64  XXXXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIE 123
                       R+G SI+DWHVNDVFPERLIDLV VLRCDNS+LYDRLH RKYHD+KI+
Sbjct: 63  EDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSKIQ 122

Query: 124 ENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTNE 183
           EN+DAEIMGVVLQDA ESYA+EIVVELQSDTTEQM+ANVDRIVDW ++WL+QH+ GVTNE
Sbjct: 123 ENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVTNE 182

Query: 184 LED 186
           LE+
Sbjct: 183 LEE 185

>NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON}
           Anc_7.348 YDL166C
          Length = 214

 Score =  303 bits (777), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 141/186 (75%), Positives = 163/186 (87%)

Query: 4   SRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIVX 63
           SRRY+PNLLITGTPG GKSTTCELLQRRLPEY YYNISDFAKE+DCY+GYDKGRKSHIV 
Sbjct: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVD 65

Query: 64  XXXXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIE 123
                       R+GKSI+DWHVND+FPERLIDLV VLRCDNS+LYDRL+ R YHD+KI+
Sbjct: 66  EDKLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125

Query: 124 ENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTNE 183
           EN+DAEIMGVVLQDA+ESY +EIVVELQSD TEQM+ANV+RIV+W KMW++QH++GVTNE
Sbjct: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185

Query: 184 LEDKQR 189
           L+ K +
Sbjct: 186 LQGKNK 191

>TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.348
           YDL166C
          Length = 216

 Score =  301 bits (772), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 143/184 (77%), Positives = 159/184 (86%)

Query: 4   SRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIVX 63
           SRRYQPNLLITGTPGCGKSTTCELLQRRL +Y YYNISDFAKEH+CYDG+D+GRKSHIV 
Sbjct: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVD 61

Query: 64  XXXXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIE 123
                       R+GK I+DWHVNDVFPERLIDLV VLRCDNSVLYDRL  R YHD+KI+
Sbjct: 62  EDKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121

Query: 124 ENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTNE 183
           ENMDAEIMGVVLQDA ESYA+EIVVELQSDTTEQMD NVD+IVDW ++W++QH++GVTNE
Sbjct: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTNE 181

Query: 184 LEDK 187
           L  K
Sbjct: 182 LSKK 185

>SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 208

 Score =  294 bits (752), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 137/183 (74%), Positives = 156/183 (85%)

Query: 3   KSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIV 62
           +++R +PN+L+TGTPGCGKSTTCELL RRL +Y YYNISDFA+EH CYDGYD+ RKSHIV
Sbjct: 2   ETKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHIV 61

Query: 63  XXXXXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKI 122
                        R+GKSI+DWHVNDVFPERLIDLV VLRCDNS+LYDRLH R YHD+KI
Sbjct: 62  DEDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSKI 121

Query: 123 EENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTN 182
           EEN+DAEIMGVV+QDA ESYA+EIVVELQSDT E MDANVDRIV+WQ+MWL QH +GVTN
Sbjct: 122 EENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVTN 181

Query: 183 ELE 185
           ELE
Sbjct: 182 ELE 184

>TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON}
           Anc_7.348 YDL166C
          Length = 213

 Score =  293 bits (751), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 160/187 (85%)

Query: 3   KSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIV 62
           + RR++PNLLITGTPGCGKSTTCELLQRRLP+YKYYNISDFAKEHDC+DGYD+ RKS+IV
Sbjct: 2   EPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYIV 61

Query: 63  XXXXXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKI 122
                        R+G +I+DWHVNDVFPERLIDLV VLRCDN++LYDRL  R YHD KI
Sbjct: 62  DEDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAKI 121

Query: 123 EENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTN 182
           +EN+DAEIMGVVLQDA +SY +EIVVELQSD+TEQM+ANVDRIV W+K+WL+QH+DG TN
Sbjct: 122 QENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQTN 181

Query: 183 ELEDKQR 189
           EL ++ +
Sbjct: 182 ELLERTK 188

>KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.348
           YDL166C
          Length = 228

 Score =  293 bits (751), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 158/181 (87%)

Query: 3   KSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIV 62
           +SRRY PNLL+TGTPGCGKSTTCELL RRLP+Y Y+NIS+FA++H CYDGYD+ RKSHIV
Sbjct: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66

Query: 63  XXXXXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKI 122
                        R+GKSIIDWHVNDVFPERLIDLV VLRCDNS+L+DRLHGR YH++KI
Sbjct: 67  DDDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126

Query: 123 EENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTN 182
           +EN+DAEIMGVVLQDAL+SY +EIVVELQS++TE+MDANV+RIV WQ+MWL QH++GVTN
Sbjct: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186

Query: 183 E 183
           E
Sbjct: 187 E 187

>KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa]
           {ON} similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 211

 Score =  285 bits (728), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 132/181 (72%), Positives = 153/181 (84%)

Query: 6   RYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIVXXX 65
           R++PN++++GTPGCGKSTTCELL RRLPEY YYNISDFAKEHDCYDGYD  RKS+IV   
Sbjct: 5   RFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEHDCYDGYDDARKSNIVDDD 64

Query: 66  XXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIEEN 125
                     R+G  IIDWHVNDVFPERL+DLV VLRCDN +LYDRL+ R YH+ KIEEN
Sbjct: 65  KLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGILYDRLNKRGYHNAKIEEN 124

Query: 126 MDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTNELE 185
           MDAEIMGVVLQDA +SYA+EIVVELQSDTTE+MD NVDRI+ WQ++WL+QH+ GVTNEL+
Sbjct: 125 MDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIAWQEIWLKQHKKGVTNELD 184

Query: 186 D 186
           D
Sbjct: 185 D 185

>Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON}
           YDL166C (REAL)
          Length = 197

 Score =  277 bits (708), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 150/183 (81%)

Query: 3   KSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIV 62
           +SRRY PN+++TGTPGCGKS+ CELL+ +L +YKYYNISDFAK+HDC++GYD+GRKSHIV
Sbjct: 2   ESRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDHDCFEGYDEGRKSHIV 61

Query: 63  XXXXXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKI 122
                        RQG SI+DWHVND+FPERLIDLV VLRCDNS LY RLH R YHD+KI
Sbjct: 62  DEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSKI 121

Query: 123 EENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTN 182
           EEN+DAEIMGVV QDA+ESY   IVVELQSDT E M++NV RI+ W+KMWLEQH +GVTN
Sbjct: 122 EENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVTN 181

Query: 183 ELE 185
           E +
Sbjct: 182 EYQ 184

>TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348
           YDL166C
          Length = 209

 Score =  276 bits (706), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 151/182 (82%)

Query: 3   KSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIV 62
           KSRRY PNLLI+GTPG GKS+TCELL+R L +YKY NISDFAKE +CYDG+DKGRKSHIV
Sbjct: 2   KSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHIV 61

Query: 63  XXXXXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKI 122
                        R+G +I+DWHVNDVFPERLIDLV +LR DNSVLYDRL  RKYHD K+
Sbjct: 62  DEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAKV 121

Query: 123 EENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTN 182
           +EN+DAEIMGVVLQDA++SYA+EIV+ELQS+ TE+M +NVDRIV W ++W +QH DGVTN
Sbjct: 122 QENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVTN 181

Query: 183 EL 184
           EL
Sbjct: 182 EL 183

>YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}
           FAP7Essential NTPase required for small ribosome subunit
           synthesis, mediates processing of the 20S pre-rRNA at
           site D in the cytoplasm but associates only transiently
           with 43S preribosomes via Rps14p, may be the
           endonuclease for site D
          Length = 197

 Score =  275 bits (702), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 128/183 (69%), Positives = 149/183 (81%)

Query: 3   KSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIV 62
           ++RRY PN+++TGTPGCGKS+TCE L+ +L +YKYYNISDFAK++DC++GYD+GRKSHIV
Sbjct: 2   EARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHIV 61

Query: 63  XXXXXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKI 122
                        RQG SI+DWHVNDVFPERLIDLV VLRCDNS LY RLH R YHD+KI
Sbjct: 62  DEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSKI 121

Query: 123 EENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTN 182
           EEN+DAEIMGVV QDA+ESY   IVVELQSDT E M +NV RIV W+KMWLEQH DGVTN
Sbjct: 122 EENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVTN 181

Query: 183 ELE 185
           E +
Sbjct: 182 EYQ 184

>KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.348
           YDL166C
          Length = 223

 Score =  273 bits (699), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 149/188 (79%)

Query: 1   MSKSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSH 60
           M +SRR  PN+L+TGTPG GKSTTCELL R LP+Y YYNISDFA ++ CYDGYD+ RKSH
Sbjct: 1   MGESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSH 60

Query: 61  IVXXXXXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDT 120
           IV               G +IIDWHVNDVFPERLIDLVAVLRCD+SVL+DRL+ R+YH +
Sbjct: 61  IVDEDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSS 120

Query: 121 KIEENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGV 180
           KI+ENMDAEIMGVVLQDAL+SY ++IVVELQSD TEQM ANVDR+V W  MW EQH +GV
Sbjct: 121 KIDENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGV 180

Query: 181 TNELEDKQ 188
           TNEL   Q
Sbjct: 181 TNELSAHQ 188

>Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON}
           similar to Ashbya gossypii ACL150W
          Length = 234

 Score =  273 bits (698), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 127/182 (69%), Positives = 147/182 (80%)

Query: 4   SRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIVX 63
           S R +PN+++TGTPGCGK+TTCELLQRRL + +YYNISDFAKEHDCY+GYD+GRKSHIV 
Sbjct: 17  STRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHIVD 76

Query: 64  XXXXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIE 123
                       R+G +IIDWHVNDVFPERLIDLV VLRCDNS LYDRLH R YHD KIE
Sbjct: 77  EDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAKIE 136

Query: 124 ENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTNE 183
           EN+DAEIMGVVLQDA++SY  +IVVELQS+T  QM+ NV RIV W+  W+ QH  GVTNE
Sbjct: 137 ENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVTNE 196

Query: 184 LE 185
           L+
Sbjct: 197 LQ 198

>ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 198

 Score =  270 bits (691), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 127/185 (68%), Positives = 152/185 (82%)

Query: 3   KSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIV 62
           +SRRY PN+LITGTPG GKSTT ELLQRRL +++YYNISDFA+E+DC+DGYD+GRKSHIV
Sbjct: 2   ESRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHIV 61

Query: 63  XXXXXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKI 122
                        R+G +IIDWHVNDVFPERLIDLV VLRC+NS+L+ RL  R YH TKI
Sbjct: 62  DEDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTKI 121

Query: 123 EENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTN 182
           +EN+DAEIMGVV+QDAL+SY KEIVVEL SD+TEQM+ NVDRIV W ++W +QH  GVTN
Sbjct: 122 DENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVTN 181

Query: 183 ELEDK 187
           EL ++
Sbjct: 182 ELHEQ 186

>CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {ON}
           highly similar to uniprot|Q12055 Saccharomyces
           cerevisiae YDL166c
          Length = 212

 Score =  271 bits (692), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 150/186 (80%)

Query: 4   SRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIVX 63
           SRR+ PN+++TGTPGCGKSTTCELLQRRL  YKYYNIS+FA+EH CYDGYD+GRKSHIV 
Sbjct: 3   SRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHIVD 62

Query: 64  XXXXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIE 123
                        +GKSIIDWHVNDVFPERLIDLV VLR +N  LYDRL  R YHD+KIE
Sbjct: 63  EDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSKIE 122

Query: 124 ENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTNE 183
           EN+DAEIMGVVLQDA ESY  EIVVELQS+TTE M+ NVDRI  W   W+E+H+DGV++E
Sbjct: 123 ENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVSSE 182

Query: 184 LEDKQR 189
           L+D ++
Sbjct: 183 LKDGKK 188

>Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON}
           YDL166C (REAL)
          Length = 206

 Score =  268 bits (686), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 126/183 (68%), Positives = 148/183 (80%)

Query: 3   KSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIV 62
           +SRRY PN+++TGTPGCGKS+TCELL+  L  YKYYNISDFAK++DC++GYD+GRKSHIV
Sbjct: 2   ESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHIV 61

Query: 63  XXXXXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKI 122
                        RQG SIIDWHVNDVFPERLIDLV VLRCDNS LY RLH R YHD+KI
Sbjct: 62  DEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSKI 121

Query: 123 EENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTN 182
           EEN+DAEIMGVV QDA++SY   IVVELQSDT + + +NV RI+ W+KMWLEQH +GVTN
Sbjct: 122 EENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVTN 181

Query: 183 ELE 185
           E +
Sbjct: 182 EYQ 184

>ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL166C (FAP7)
          Length = 219

 Score =  267 bits (683), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 147/180 (81%)

Query: 6   RYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIVXXX 65
           R +PN+L++GTPGCGKSTTCELLQR LP+Y+Y+NISDFA+EH+CYDGYD+ RKSHIV   
Sbjct: 5   RCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHIVDED 64

Query: 66  XXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIEEN 125
                     R+G +I+DWHVND+FPERLIDLV VLRCDN++L+DRL  R YH +KIEEN
Sbjct: 65  RLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSKIEEN 124

Query: 126 MDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTNELE 185
           +DAEIMGVVLQDAL+SY +EIVVELQSD TEQM  NVDRI  W+  W+ +H DGV+N L+
Sbjct: 125 IDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVSNALQ 184

>KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {ON}
           similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 214

 Score =  266 bits (680), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 144/181 (79%)

Query: 4   SRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIVX 63
           S R+ PN+L+TGTPGCGK++TCELLQRRL +  YYNISDFA++H+CYDGYD+ RKSHIV 
Sbjct: 3   STRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHIVD 62

Query: 64  XXXXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIE 123
                       R+G +I+DWHVND+FPERLIDLV VLR DN+VLYDRL  R YH+ KI+
Sbjct: 63  EDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAKIQ 122

Query: 124 ENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTNE 183
           EN+DAEIMGVV+QDA +SY KEIVVELQSDT +QMD NVDRI  W   WLEQ+  GVTNE
Sbjct: 123 ENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVTNE 182

Query: 184 L 184
           L
Sbjct: 183 L 183

>Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL166C
           (FAP7) - Nuclear protein involved in oxidative stress
           response [contig 161] FULL
          Length = 226

 Score =  266 bits (679), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 126/181 (69%), Positives = 143/181 (79%)

Query: 4   SRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIVX 63
           S R  PN+L+TGTPGCGK++TCELLQRRL   KYYNISDFAKE+ CYDGYD+ RKSHIV 
Sbjct: 3   STRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEYKCYDGYDEARKSHIVD 62

Query: 64  XXXXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIE 123
                       R G +I+DWHVNDVFPERLIDLV VLR DNS L+DRL  R YH+ KI+
Sbjct: 63  EDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSALFDRLSKRGYHEAKIQ 122

Query: 124 ENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTNE 183
           EN+DAEIMGVV+ DA +SYA+EIVVELQSDTTEQMD NVDRIV W+  W EQH +GVTNE
Sbjct: 123 ENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVTWRDAWREQHPEGVTNE 182

Query: 184 L 184
           L
Sbjct: 183 L 183

>Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON}
           YDL166C (REAL)
          Length = 194

 Score =  265 bits (676), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 125/179 (69%), Positives = 142/179 (79%)

Query: 5   RRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIVXX 64
           RR+ PN+++TGTPGCGKS+TCELL+  L  YKYYNISDFAK++DC++ YD+ RKSHIV  
Sbjct: 4   RRFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEAYDEARKSHIVDE 63

Query: 65  XXXXXXXXXXXRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIEE 124
                      RQG SIIDWHVNDVFPERLIDLV VLRCDNS LY RLH R YHD+KIEE
Sbjct: 64  DKLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSKIEE 123

Query: 125 NMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTNE 183
           N+DAEIMGVV QDA++SY   IVVELQ DT E M +NV RIV W+KMWLEQH DGVTNE
Sbjct: 124 NLDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVAWEKMWLEQHSDGVTNE 182

>YML065W Chr13 (142210..144954) [2745 bp, 914 aa] {ON}  ORC1Largest
           subunit of the origin recognition complex, which directs
           DNA replication by binding to replication origins and is
           also involved in transcriptional silencing; exhibits
           ATPase activity
          Length = 914

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 11/52 (21%)

Query: 11  LLITGTPGCGKSTTC-----ELL----QRRLPEYKYYNISDF--AKEHDCYD 51
           + + GTPG GK+ T      ELL    QR +P++ Y  I+     K  DCY+
Sbjct: 475 IYVAGTPGVGKTLTVREVVKELLSSSAQREIPDFLYVEINGLKMVKPTDCYE 526

>KNAG0G01880 Chr7 (420542..421219) [678 bp, 225 aa] {ON} Anc_8.236
          YER170W
          Length = 225

 Score = 32.7 bits (73), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 11 LLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEH 47
          LL+ G PG GK T  + L +R PE K  +  D  +++
Sbjct: 10 LLLLGAPGAGKGTQTKRLIKRFPEIKAISSGDLLRKN 46

>TBLA0C00480 Chr3 (88992..90074) [1083 bp, 360 aa] {ON} Anc_8.101
          YFR007W
          Length = 360

 Score = 32.3 bits (72), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 3/35 (8%)

Query: 1  MSKSR---RYQPNLLITGTPGCGKSTTCELLQRRL 32
           SK+R    Y  N++I G PG GKST  E L   L
Sbjct: 14 FSKTRAKDNYTINIIIVGPPGSGKSTIAEKLSANL 48

>Suva_13.92 Chr13 (144893..147664) [2772 bp, 923 aa] {ON} YML065W
           (REAL)
          Length = 923

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 11/52 (21%)

Query: 11  LLITGTPGCGKSTTC-----ELL----QRRLPEYKYYNISDF--AKEHDCYD 51
           + + GTPG GK+ T      EL+    Q+ LP++ Y  I+     K  DCY+
Sbjct: 485 IYVAGTPGVGKTLTVREVVKELISSSAQQELPDFLYVEINGLKMVKPTDCYE 536

>Smik_13.79 Chr13 (139688..142507) [2820 bp, 939 aa] {ON} YML065W
           (REAL)
          Length = 939

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 11/52 (21%)

Query: 11  LLITGTPGCGKSTTC-----ELL----QRRLPEYKYYNISDF--AKEHDCYD 51
           + + GTPG GK+ T      ELL    Q+ +P++ Y  I+     K  DCY+
Sbjct: 503 IYVAGTPGVGKTLTVREVVKELLSSSTQQEIPDFLYVEINGLKMVKPTDCYE 554

>Kwal_56.23638 s56 (632586..647354) [14769 bp, 4922 aa] {ON} YLR106C
            (MDN1) - Protein required for cell viability [contig 175]
            FULL
          Length = 4922

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 15/20 (75%)

Query: 11   LLITGTPGCGKSTTCELLQR 30
            +L+ G  GCGK+T C+L+ R
Sbjct: 1366 ILLVGETGCGKTTVCQLIAR 1385

>Ecym_3515 Chr3 complement(963673..965583) [1911 bp, 636 aa] {ON}
           similar to Ashbya gossypii AGR112C
          Length = 636

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 1/27 (3%)

Query: 11  LLITGTPGCGKSTTCELLQRRL-PEYK 36
           LL+TG  GC KST  +LL   L P+Y+
Sbjct: 90  LLLTGPAGCSKSTVVKLLSDELVPKYR 116

>YOR342C Chr15 complement(966666..967625) [960 bp, 319 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and the nucleus
          Length = 319

 Score = 29.6 bits (65), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 40/93 (43%), Gaps = 9/93 (9%)

Query: 92  ERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIEEN--------MDAEIMGVVLQDALESYA 143
           E L D     R DN + +  +H   + D  +E N        +  E++  +  +    +A
Sbjct: 5   EELNDSSIPQRLDNHIFFGSVHSLTHTDFLVENNIRFFINVDLSTELISHIYHEVRSKFA 64

Query: 144 KEIV-VELQSDTTEQMDANVDRIVDWQKMWLEQ 175
            EIV V + +D+   +++++ R   W    L Q
Sbjct: 65  HEIVIVNIDNDSQIPIESDLVRSFHWHNTSLLQ 97

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,999,052
Number of extensions: 787756
Number of successful extensions: 3420
Number of sequences better than 10.0: 37
Number of HSP's gapped: 3461
Number of HSP's successfully gapped: 37
Length of query: 224
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 118
Effective length of database: 41,326,803
Effective search space: 4876562754
Effective search space used: 4876562754
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)