Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0A141307.347ON19119110201e-143
Suva_4.817.347ON1911918761e-121
YDL165W (CDC36)7.347ON1911918751e-121
NDAI0A019207.347ON1931938741e-121
Skud_4.927.347ON1911918711e-120
Smik_4.737.347ON1911918701e-120
ZYRO0F11638g7.347ON1911918701e-120
TDEL0C020107.347ON1911918621e-119
KNAG0C037607.347ON1911918551e-118
Kpol_530.347.347ON1911918521e-117
KAFR0B008507.347ON1921928471e-117
CAGL0I03388g7.347ON1911918171e-112
TPHA0F029407.347ON1911918011e-109
TBLA0E005107.347ON2871677541e-101
KLTH0H01320g7.347ON1901927314e-99
Kwal_56.246347.347ON1901927281e-98
SAKL0F11308g7.347ON1911927281e-98
KLLA0D12408g7.347ON1841916672e-89
Ecym_47267.347ON1911986612e-88
ACL151C7.347ON2081986466e-86
ZYRO0C16588g3.370ON608821073e-05
SAKL0B08052g3.370ON576871046e-05
KAFR0H008603.370ON578821029e-05
Kwal_23.39623.370ON5531291021e-04
Smik_16.3163.370ON560821011e-04
KLTH0F11880g3.370ON5631291011e-04
YPR072W (NOT5)3.370ON560821011e-04
Skud_16.3613.370ON560821002e-04
Suva_16.4013.370ON565821002e-04
NDAI0A050803.370ON57582959e-04
TBLA0H014903.370ON55283940.001
KNAG0A072903.370ON50786940.001
Kpol_1006.73.370ON54080920.002
TPHA0A035003.370ON54879910.003
CAGL0D01342g3.370ON54885900.003
Ecym_34563.370ON50891870.009
TDEL0C051203.370ON56281860.011
ADL364C3.370ON50489860.013
KLTH0A03652g7.214ON77280800.069
KLLA0B09196g3.370ON59047780.12
Kpol_1070.257.214ON68683730.54
NCAS0E039405.53ON39145701.1
NCAS0A112103.370ON58238682.2
ZYRO0D16302g7.214ON829116673.5
Kpol_1036.938.362ON72456663.8
TBLA0D042707.214ON84766664.0
TDEL0H023307.214ON81281655.1
TPHA0C012907.214ON78682647.2
Kwal_47.181147.214ON76380639.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0A14130
         (191 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {...   397   e-143
Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W (R...   342   e-121
YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Compon...   341   e-121
NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.34...   341   e-121
Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W (R...   340   e-120
Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W (R...   339   e-120
ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {O...   339   e-120
TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.34...   336   e-119
KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON...   333   e-118
Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON} (82095..82...   332   e-117
KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON...   330   e-117
CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly ...   319   e-112
TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON...   313   e-109
TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON} ...   295   e-101
KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly ...   286   4e-99
Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa] ...   285   1e-98
SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {O...   285   1e-98
KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} simil...   261   2e-89
Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar ...   259   2e-88
ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON} Synt...   253   6e-86
ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} high...    46   3e-05
SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly...    45   6e-05
KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {O...    44   9e-05
Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {O...    44   1e-04
Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072...    44   1e-04
KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]...    44   1e-04
YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subun...    44   1e-04
Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072...    43   2e-04
Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072...    43   2e-04
NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa] ...    41   9e-04
TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {O...    41   0.001
KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON} Anc_3...    41   0.001
Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON} (30700.....    40   0.002
TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {O...    40   0.003
CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {...    39   0.003
Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}...    38   0.009
TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.3...    38   0.011
ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON} Syn...    38   0.013
KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some s...    35   0.069
KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {...    35   0.12 
Kpol_1070.25 s1070 complement(58286..59491,59501..59509,59592..6...    33   0.54 
NCAS0E03940 Chr5 complement(772432..773607) [1176 bp, 391 aa] {O...    32   1.1  
NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON} Anc_3...    31   2.2  
ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} simi...    30   3.5  
Kpol_1036.93 s1036 complement(241133..243307) [2175 bp, 724 aa] ...    30   3.8  
TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa] ...    30   4.0  
TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {O...    30   5.1  
TPHA0C01290 Chr3 complement(294072..296432) [2361 bp, 786 aa] {O...    29   7.2  
Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038...    29   9.5  

>NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  397 bits (1020), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 191/191 (100%), Positives = 191/191 (100%)

Query: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60
           MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW
Sbjct: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180
           GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 KDFLLFYNAIM 191
           KDFLLFYNAIM
Sbjct: 181 KDFLLFYNAIM 191

>Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  342 bits (876), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 162/191 (84%), Positives = 175/191 (91%)

Query: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60
           MDKFGL+ALVPLL+Q+DKELS  YDHSMTLGADLSSM++SLGIPRD+  HRVLDTFQSPW
Sbjct: 1   MDKFGLQALVPLLKQEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP FF P+SF  I  VLQS VTPP F+S QNDQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPSVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180
           GTV+QELTYLELR RNWRYH TL+AWLTKDP+MEP VSADGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 KDFLLFYNAIM 191
           +DFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Component
           of the CCR4-NOT complex, which has multiple roles in
           regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation;
           basal transcription factor
          Length = 191

 Score =  341 bits (875), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 162/191 (84%), Positives = 175/191 (91%)

Query: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60
           M+KFGLKALVPLL+ +DKELS  YDHSMTLGADLSSM++SLGIPRD+  HRVLDTFQSPW
Sbjct: 1   MEKFGLKALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP FF P+SF  I GVLQS VTPP F+S QNDQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSTVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180
           GTV+QELTYLELR RNWRYH TL+AWLTKDP+MEP VSADGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 KDFLLFYNAIM 191
           +DFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.347
           YDL165W
          Length = 193

 Score =  341 bits (874), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 164/193 (84%), Positives = 175/193 (90%), Gaps = 2/193 (1%)

Query: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60
           MDKFGL+ALVPL++ DDKELSK YDHSMTLGADL+SM+HSLGIPRD+ RHRVLDTFQSPW
Sbjct: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPV--TPPRFDSAQNDQQRVALFQDETLFYLFYK 118
           AETSRSEVEPTFFIPDSF  I  VLQS    TPP FDS Q DQQRVALFQDETLFYLFYK
Sbjct: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120

Query: 119 HPGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEK 178
           HPGTV+QELTYLELR RNWRYH TL+AWLTKDP+MEP VS DGLSERGSYVFFDPQRWEK
Sbjct: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180

Query: 179 CQKDFLLFYNAIM 191
           CQ++FLLFYNAIM
Sbjct: 181 CQREFLLFYNAIM 193

>Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  340 bits (871), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (91%)

Query: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60
           M+KFGL+ALVPLL+ +DKELS  YDHSMTLGADLSSM++SLGIPRD+  HRVLDTFQSPW
Sbjct: 1   MEKFGLRALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP FF P+SF  I GVLQS VTPP F+S QNDQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180
           GTV+QELTYLELR RNWRYH TL+AWLTKDP+MEP VSADGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 KDFLLFYNAIM 191
           +DFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  339 bits (870), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (91%)

Query: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60
           M+KFGL+ALVPLL+ +DKELS  YDHSMTLGADLSSM++SLGIPRD+  HRVLDTFQSPW
Sbjct: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP FF P+SF  I GVLQS VTPP F+S QNDQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180
           GTV+QELTYLELR RNWRYH TL+AWLTKDP+MEP VSADGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 KDFLLFYNAIM 191
           +DFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  339 bits (870), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 160/191 (83%), Positives = 174/191 (91%)

Query: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60
           MDKFGL+ALVPL++Q+D+ELS  YDHSMTLGADLSSM+HSLGIPRD+ RH+VLDTFQSPW
Sbjct: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP FFIP+SFV I  VL S  TPP F+S Q DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180
           GTV+QELTYLELR RNWRYH TL+AWLTKDP MEP VS+DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 KDFLLFYNAIM 191
           +DFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.347
           YDL165W
          Length = 191

 Score =  336 bits (862), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 174/191 (91%)

Query: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60
           M+KFGLKALVPL++Q+++E +  YDHS+TLGADLSSM+HSLGIPRD+ RHRVLDTFQSPW
Sbjct: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP FFIPDSF  I  VLQS  TPP F+S Q+DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180
           GTV+QELTYLELR RNWRYH TL+AWLTKDP MEP VS+DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 KDFLLFYNAIM 191
           ++FLLFYNAIM
Sbjct: 181 REFLLFYNAIM 191

>KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  333 bits (855), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 169/191 (88%)

Query: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60
           MDKFGLKALVPL+RQ D E++  YDHSM LGADLSSM+HSLGIPRD+ R  VL TFQSPW
Sbjct: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEPTF+IP SF+GI  VLQS  TPP FDS Q DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180
           GTV+QELTYLELR RNWRYH TL+AWLTKDP MEP VS DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 KDFLLFYNAIM 191
           +DFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON}
           (82095..82670) [576 nt, 192 aa]
          Length = 191

 Score =  332 bits (852), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 152/191 (79%), Positives = 173/191 (90%)

Query: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60
           MDKFGL+AL+PL++QDD ELSK Y+H+MT+G DLSSM+HSLGIPRDN R+R+LDTFQSPW
Sbjct: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP FF P+SF  I  VLQS VTPP F+S +NDQQRV LFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120

Query: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180
           GTV+QELTYLELR RNWRYH TL+AWLTKDP++EP VS DGLSERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180

Query: 181 KDFLLFYNAIM 191
           ++F+LFYNAIM
Sbjct: 181 REFVLFYNAIM 191

>KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON}
           Anc_7.347 YDL165W
          Length = 192

 Score =  330 bits (847), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 159/192 (82%), Positives = 171/192 (89%), Gaps = 1/192 (0%)

Query: 1   MDKFGLKALVPLLRQDDK-ELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSP 59
           MDKFGLKAL+PL++QD + E +  YDHSMTLGADLSSM++SLGIPRD   HRVLDTFQSP
Sbjct: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60

Query: 60  WAETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKH 119
           WAETSRSEVEP F IPDSF  IS VLQS VTPP FDS QNDQQRVALFQDETLFYLFYKH
Sbjct: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH 120

Query: 120 PGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKC 179
           P TV+QELTYLELR RNWRYH TL+AWLTKDP+MEP VS DGLSE+GSYVFFDPQRWEKC
Sbjct: 121 PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC 180

Query: 180 QKDFLLFYNAIM 191
           Q+DFLLFYNAIM
Sbjct: 181 QRDFLLFYNAIM 192

>CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165w CDC36 transcription factor
          Length = 191

 Score =  319 bits (817), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 166/191 (86%)

Query: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60
           M KFGL+ LVPL+R D+++  K YDHSMT+G DLSSM+HSLGIPRD+  HRVLDTFQSPW
Sbjct: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP ++IP+SF  I  VLQS  TPP FD  Q DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180
           GTV+QELTYLELR RNWRYH  L+AWLTKDP+MEP V+ADGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 KDFLLFYNAIM 191
           +DF LFY+AIM
Sbjct: 181 RDFPLFYSAIM 191

>TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  313 bits (801), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 143/191 (74%), Positives = 167/191 (87%)

Query: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60
           MDKFGL+AL+PL++QDD E SK Y+H+MT+GADL+S+ HSLGIP +N R+RVLDTFQSPW
Sbjct: 1   MDKFGLEALLPLIKQDDPEFSKKYNHAMTIGADLTSIQHSLGIPNNNKRYRVLDTFQSPW 60

Query: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP +F P SF  I  VLQS  TP  F+S + DQQR++LFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRYFTPKSFTNIPKVLQSIDTPSVFNSVETDQQRISLFQDETLFYLFYKHP 120

Query: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180
           GTV+QELTYLELR RNWRYH  L+AWLTKDP++EP V+ADG SERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKILKAWLTKDPIVEPIVTADGQSERGSYIFFDPQRWEKCQ 180

Query: 181 KDFLLFYNAIM 191
           +DF+LFYNAIM
Sbjct: 181 RDFVLFYNAIM 191

>TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON}
           Anc_7.347 YDL165W
          Length = 287

 Score =  295 bits (754), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 149/167 (89%)

Query: 25  DHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPWAETSRSEVEPTFFIPDSFVGISGV 84
           DHS+T+GADLSSM+HSLG+PRDN RHR+LDTFQSPWAETSRSEV+P FFIP SF  IS V
Sbjct: 121 DHSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRFFIPSSFSNISNV 180

Query: 85  LQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHPGTVLQELTYLELRNRNWRYHTTLR 144
           LQ   TPP F++ + DQQRVALFQDETLFYLFYKHPGTV+QELTYLELR RNWR+H  L+
Sbjct: 181 LQCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILK 240

Query: 145 AWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQKDFLLFYNAIM 191
            WLTKDP+MEP V+ADG SERGSYVFFDPQRWEKCQ++F+LFYNAIM
Sbjct: 241 TWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287

 Score = 32.0 bits (71), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 16/17 (94%)

Query: 1  MDKFGLKALVPLLRQDD 17
          MD+FGLKALVPL+R D+
Sbjct: 1  MDRFGLKALVPLIRLDE 17

>KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165W CDC36 Component of the CCR4-NOT complex which
           has multiple roles in regulating mRNA levels including
           regulation of transcription and destabilizing mRNAs by
           deadenylation basal transcription factor
          Length = 190

 Score =  286 bits (731), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 160/192 (83%), Gaps = 3/192 (1%)

Query: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDN-TRHRVLDTFQSP 59
           M+K+GL AL+PL+R++D+  S  YD SMTLG DLS ++HSLGIP +  +R+RVLDTFQSP
Sbjct: 1   MEKYGLSALLPLIRREDQ--SPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58

Query: 60  WAETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKH 119
           W ETSRSEVEP FF+P+SF  I  VLQS   PP F+S Q D  +++LFQDETLFYLFYKH
Sbjct: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118

Query: 120 PGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKC 179
           PG+V+QELTYLELR RNWRYH TL+ WLTKDP+MEP V+  G SERGSYVFFDPQRWEKC
Sbjct: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178

Query: 180 QKDFLLFYNAIM 191
           Q+DF+LFYNAIM
Sbjct: 179 QRDFVLFYNAIM 190

>Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa]
           {ON} YDL165W (CDC36) - nuclear protein that negatively
           regulates basal transcription [contig 161] FULL
          Length = 190

 Score =  285 bits (728), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 134/192 (69%), Positives = 160/192 (83%), Gaps = 3/192 (1%)

Query: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRD-NTRHRVLDTFQSP 59
           M+K+GL AL+PL+R++D+  S  YD SMTLG DLS ++HSLGI  + +TR+RVLDTFQSP
Sbjct: 1   MEKYGLSALLPLIRREDQ--SPEYDSSMTLGIDLSPVLHSLGIASNQSTRYRVLDTFQSP 58

Query: 60  WAETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKH 119
           W ETSRSEVEP FF+P+SF  I  VLQ+   PP F+S Q D  +++LFQDETLFYLFYKH
Sbjct: 59  WVETSRSEVEPKFFVPESFKNIPNVLQAGDKPPAFNSVQQDHAKISLFQDETLFYLFYKH 118

Query: 120 PGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKC 179
           PG+V+QELTYLELR RNWRYH TL+ WLTKDP+MEP V+  G SERGSYVFFDPQRWEKC
Sbjct: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178

Query: 180 QKDFLLFYNAIM 191
           Q+DF+LFYNAIM
Sbjct: 179 QRDFVLFYNAIM 190

>SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  285 bits (728), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 136/192 (70%), Positives = 159/192 (82%), Gaps = 4/192 (2%)

Query: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNT-RHRVLDTFQSP 59
           ++K+GLKAL+PL++Q+       YD +MT+G DLSSM+HSLGI  +   + RVLDTF SP
Sbjct: 3   VEKYGLKALLPLIKQETGNAE--YDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP 60

Query: 60  WAETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKH 119
           W ETSRSEVEP FF P+SFV I  VLQSP +PP F+S Q D  ++ALFQDETLFYLFYKH
Sbjct: 61  WVETSRSEVEPKFFTPESFVNIPNVLQSP-SPPSFNSVQQDHPKIALFQDETLFYLFYKH 119

Query: 120 PGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKC 179
           PGTV+QE+TYLELR RNWRYH TL+ WLTKDP+MEP VS DGLSERGSYVFFDPQRWEKC
Sbjct: 120 PGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKC 179

Query: 180 QKDFLLFYNAIM 191
           Q+DF+LFYNAIM
Sbjct: 180 QRDFVLFYNAIM 191

>KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} similar
           to uniprot|P06100 Saccharomyces cerevisiae YDL165W CDC36
           Component of the CCR4-NOT complex which has multiple
           roles in regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation
           basal transcription factor
          Length = 184

 Score =  261 bits (667), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 124/191 (64%), Positives = 148/191 (77%), Gaps = 7/191 (3%)

Query: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60
           M+K+GLK LVP+LR D       YD +MTLG DL+S+++SL I +D   H  LD F+SPW
Sbjct: 1   MEKYGLKDLVPVLRHD-----PTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55

Query: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120
            ETSRSEV+PTFFIP+SF  I G+L +      F S   DQ R++L QDETLFYLFYKHP
Sbjct: 56  VETSRSEVQPTFFIPESFKNIKGMLGTDQV--EFTSVNRDQPRISLLQDETLFYLFYKHP 113

Query: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180
           G+V+QELTYLELR RNWRYH TL+ WLTKDP+MEP V+ D +SERGSYVFFDPQRWEKCQ
Sbjct: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173

Query: 181 KDFLLFYNAIM 191
           +DF+L YNAIM
Sbjct: 174 RDFVLHYNAIM 184

>Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar to
           Ashbya gossypii ACL151C
          Length = 191

 Score =  259 bits (661), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 132/198 (66%), Positives = 147/198 (74%), Gaps = 14/198 (7%)

Query: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIP-RD------NTRHRVL 53
           M K+GLK+L+P+++ D     K YD SMTLG DL S++HSL +  RD      N  H  L
Sbjct: 1   MSKYGLKSLLPVIKHD-----KQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55

Query: 54  DTFQSPWAETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLF 113
           DTF SPW ETSRSEVEP FFIP+SF  I GVL  P T   F S   D  R++L QDETLF
Sbjct: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETLF 113

Query: 114 YLFYKHPGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDP 173
           YLFYKHPGTVLQELTYLELR RNWRYH TL+ WLTKDPLMEP VS D  SERGSYVFFDP
Sbjct: 114 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 173

Query: 174 QRWEKCQKDFLLFYNAIM 191
           QRWEKCQ+DF+L YNAIM
Sbjct: 174 QRWEKCQRDFILNYNAIM 191

>ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL165W
           (CDC36)
          Length = 208

 Score =  253 bits (646), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 126/198 (63%), Positives = 144/198 (72%), Gaps = 14/198 (7%)

Query: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDN-------TRHRVL 53
           MDK+GLK L+P+++ +     K YD  MTLG D+SS++HSL +   +         H  L
Sbjct: 18  MDKYGLKGLLPVIKHE-----KQYDAFMTLGVDVSSLLHSLQVSSKDGYNTALSNGHHAL 72

Query: 54  DTFQSPWAETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLF 113
           DTF SPW ETSRSEVEP FFIP+SF  I GVL    T   F S   D  R++L QDETLF
Sbjct: 73  DTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQAST--DFTSVARDHPRISLLQDETLF 130

Query: 114 YLFYKHPGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDP 173
           YLFYKHPGTVLQELTYLELR RNWRYH TL+ WLTKDPLMEP VS D  SERGSYVFFDP
Sbjct: 131 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 190

Query: 174 QRWEKCQKDFLLFYNAIM 191
           QRWEKCQ+DF+L Y+AIM
Sbjct: 191 QRWEKCQRDFILNYSAIM 208

>ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 608

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 44/82 (53%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVLQELTYLEL-RNRNWRYHTTLRAWLTKDPLMEPEVSADGLSER 165
           F  +TLF++FY + GT  Q L   EL +NR W+++   R W  K+    P   A   SE 
Sbjct: 519 FDLDTLFFIFYHYQGTYEQFLAARELAKNRKWKFNKVDRCWYYKEVEKLPPGMAQ--SEE 576

Query: 166 GSYVFFDPQR-W--EKCQKDFL 184
            S+ +FD QR W   +C  DF+
Sbjct: 577 ESWRYFDYQRSWLARRCNSDFI 598

>SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 576

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 47/87 (54%), Gaps = 6/87 (6%)

Query: 104 VALFQDETLFYLFYKHPGTVLQELTYLEL-RNRNWRYHTTLRAWLTKDPLMEPE--VSAD 160
            + F  +TLF++FY + GT  Q L   EL +NRNW+++     W  K+    P   VS++
Sbjct: 481 TSKFDLDTLFFIFYHYQGTYEQFLAARELSQNRNWQFNKLNHCWFYKEVEKLPPGVVSSE 540

Query: 161 GLSERGSYVFFDPQR-W--EKCQKDFL 184
              E  S+ +FD Q+ W   +C  DF+
Sbjct: 541 NKQEEISWRYFDYQKSWLARRCGSDFV 567

>KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {ON}
           Anc_3.370 YPR072W
          Length = 578

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVLQELTYLEL-RNRNWRYHTTLRAWLTKDPLMEPEVSADGLSER 165
           F  +TLF++FY + GT  Q L+  EL +NRNW+++   R W  K+  +E        SE 
Sbjct: 490 FDLDTLFFIFYHYQGTYEQFLSSRELNKNRNWQFNKVDRCWYYKE--IEKLPPGMNKSEE 547

Query: 166 GSYVFFDPQR-W--EKCQKDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 548 ESWRYFDYKKSWLARRCSPDFV 569

>Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {ON}
           YPR072W (NOT5) - member of the NOT complex, a global
           negative regulator of transcription [contig 255] FULL
          Length = 553

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 59/129 (45%), Gaps = 24/129 (18%)

Query: 71  TFFIPDSFVGISGVLQSPVTPPRFDSAQND-QQRVAL------FQDETLFYLFYKHPGTV 123
           + F P+  + +  V   PV   +    QND   R +L      F  +TLF++FY + GT 
Sbjct: 425 SIFFPNETIRL--VSNEPVDSTKSHPKQNDIYSRTSLARIMSKFDLDTLFFIFYHYQGTH 482

Query: 124 LQELTYLELRNRNWRYHTTLRAWLTKD-----PLMEPEVSADGLSERGSYVFFDPQR-W- 176
            Q L   EL  R W+++   R W  K+     P ME        SE  S+ +FD Q+ W 
Sbjct: 483 EQFLAARELTMRGWQFNKVNRCWFYKEVEKLPPGMEQ-------SEEISWRYFDYQKSWL 535

Query: 177 -EKCQKDFL 184
             +C  DF+
Sbjct: 536 ARRCGTDFV 544

>Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVLQELTYLEL-RNRNWRYHTTLRAWLTKDPLMEPEVSADGLSER 165
           F  +TLF++FY + G+  Q L   EL +NRNW ++   R W  K+  +E      G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQKDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|Q12514 Saccharomyces
           cerevisiae YPR072W NOT5 Subunit of global
           transcriptional regulator
          Length = 563

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 60/129 (46%), Gaps = 24/129 (18%)

Query: 71  TFFIPDSFVGISGVLQSPVTPPRFDSAQND-QQRVAL------FQDETLFYLFYKHPGTV 123
           + F P+  + +  V   PV P +     ND   R +L      F  +TLF++FY + GT 
Sbjct: 435 SIFFPNEPIRL--VSNEPVDPTKTHPKHNDIYSRTSLARIMSKFDLDTLFFIFYHYQGTY 492

Query: 124 LQELTYLELRNRNWRYHTTLRAWLTKD-----PLMEPEVSADGLSERGSYVFFDPQR-W- 176
            Q L+  EL  R W+++   R W  K+     P ME        SE  S+ +FD Q+ W 
Sbjct: 493 EQFLSARELSIRGWQFNKVNRCWFYKEVEKLPPGME-------QSEEISWRYFDYQKSWL 545

Query: 177 -EKCQKDFL 184
             +C  +F+
Sbjct: 546 ARRCGAEFV 554

>YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subunit
           of the CCR4-NOT complex, which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 560

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVLQELTYLEL-RNRNWRYHTTLRAWLTKDPLMEPEVSADGLSER 165
           F  +TLF++FY + G+  Q L   EL +NRNW ++   R W  K+  +E      G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELFKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQKDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVLQELTYLEL-RNRNWRYHTTLRAWLTKDPLMEPEVSADGLSER 165
           F  +TLF++FY + G+  Q L   EL +NRNW ++   R W  K+  +E      G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQKDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072W
           (REAL)
          Length = 565

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVLQELTYLEL-RNRNWRYHTTLRAWLTKDPLMEPEVSADGLSER 165
           F  +TLF++FY + G+  Q L   EL +NRNW ++   R W  K+  +E      G SE 
Sbjct: 477 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 534

Query: 166 GSYVFFDPQR-W--EKCQKDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 535 ESWRYFDYKKSWLARRCGNDFV 556

>NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa]
           {ON} Anc_3.370
          Length = 575

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 4/82 (4%)

Query: 107 FQDETLFYLFYKHPGTVLQELTYLEL-RNRNWRYHTTLRAWLTKDPLMEPEVSADGLSER 165
           F  +TLF++FY + GT  Q L   EL +NR+W+Y+     W  K+    P  +     E 
Sbjct: 485 FDLDTLFFIFYHYQGTYDQFLASRELSKNRDWKYNKVDYCWYYKEIEKLPPGANYNKDEE 544

Query: 166 GSYVFFDPQR-W--EKCQKDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 545 ESWRYFDYKKSWLSRRCGNDFV 566

>TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {ON}
           Anc_3.370 YPR072W
          Length = 552

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 10/83 (12%)

Query: 107 FQDETLFYLFYKHPGTVLQELTYLEL-RNRNWRYHTTLRAWLTKDPLMEPEVSADGL--S 163
           F  +TLF++FY + GT  Q L+  EL +NRNW ++   R W  +    E E    GL  S
Sbjct: 463 FDLDTLFFIFYHYQGTYDQFLSARELAKNRNWEFNKVDRRWYYR----EVEKLPPGLPQS 518

Query: 164 ERGSYVFFDPQR-W--EKCQKDF 183
           E  S+ +FD Q+ W   +C  +F
Sbjct: 519 EEISWRYFDYQKSWLSRRCNSNF 541

>KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON}
           Anc_3.370 YPR072W
          Length = 507

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 46/86 (53%), Gaps = 8/86 (9%)

Query: 107 FQDETLFYLFYKHPGTVLQELTYLELR-NRNWRYHTTLRAWLTKDPLMEPEVSADGLSER 165
           F  +TLF++FY + GT  Q L   EL  NR+W+++   R W  K+  +E        SE 
Sbjct: 419 FDLDTLFFIFYHYQGTYEQFLAARELSINRDWQFNKKDRCWYYKE--IEKLPPGMNKSEE 476

Query: 166 GSYVFFDPQR-W--EKCQKDFLLFYN 188
            S+ +FD ++ W   +C  DF+  YN
Sbjct: 477 ESWRYFDYKKSWLARRCNSDFV--YN 500

>Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON}
           (30700..32322) [1623 nt, 541 aa]
          Length = 540

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 10/80 (12%)

Query: 110 ETLFYLFYKHPGTVLQELTYLEL-RNRNWRYHTTLRAWLTKDPLMEPEVSADGL--SERG 166
           +TLF++FY + GT  Q L   EL ++RNW+++   R W  K+    P     G+  +E  
Sbjct: 455 DTLFFIFYHYQGTYEQFLVARELAKHRNWKFNKINRNWYYKEVTKSPP----GMQQAEEE 510

Query: 167 SYVFFDPQR-W--EKCQKDF 183
           ++ +FD Q  W   +C  DF
Sbjct: 511 TWRYFDYQNSWLARRCNSDF 530

>TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {ON}
           Anc_3.370 YPR072W
          Length = 548

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 8/79 (10%)

Query: 110 ETLFYLFYKHPGTVLQELTYLEL-RNRNWRYHTTLRAWLTKDPLME-PEVSADGLSERGS 167
           +TLF++FY + GT  Q L   EL + RNW+Y+   R W  K+     P+++    +E  +
Sbjct: 463 DTLFFIFYHYQGTYEQFLVARELSKCRNWKYNKVDRNWYFKEVTKSAPDMAQ---TEEET 519

Query: 168 YVFFDPQR-W--EKCQKDF 183
           + +FD Q  W   +C  DF
Sbjct: 520 WRYFDYQNSWLARRCNHDF 538

>CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072w NOT5
          Length = 548

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (52%), Gaps = 10/85 (11%)

Query: 106 LFQDETLFYLFYKHPGTVLQELTYLEL-RNRNWRYHTTLRAWLTKDPLMEPEVSADGL-- 162
           +F  +TLF++FY + GT  Q L   EL + RNW+++   R W  K    E E    G+  
Sbjct: 459 MFDLDTLFFIFYHYQGTYEQFLAARELAKIRNWQFNKKDRCWYYK----EIEKLPPGMTK 514

Query: 163 SERGSYVFFD-PQRW--EKCQKDFL 184
           SE  S+ +FD  + W   +C  DF+
Sbjct: 515 SEEESWRYFDFKKSWLSRRCGSDFV 539

>Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}
           similar to Ashbya gossypii ADL364C
          Length = 508

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 15/91 (16%)

Query: 102 QRVALFQDETLFYLFYKHPGTVLQELTYLELRNRNWRYHTTLRAWLTKD-----PLMEPE 156
           Q +  F  +TLF++FY + GT  Q L   EL  R W ++   R W  ++     P ME +
Sbjct: 416 QILTKFDLDTLFFIFYHYQGTYEQFLAARELNIRGWLFNRVNRCWFYREVEKLPPGMEQK 475

Query: 157 VSADGLSERGSYVFFDPQR-W--EKCQKDFL 184
                  E  S+ +FD Q+ W   +C  DF+
Sbjct: 476 -------EEVSWRYFDYQKSWLARRCGPDFV 499

>TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.370
           YPR072W
          Length = 562

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 42/81 (51%), Gaps = 10/81 (12%)

Query: 110 ETLFYLFYKHPGTVLQELTYLEL-RNRNWRYHTTLRAWLTKDPLMEPEVSADGL--SERG 166
           +TLF++FY + GT  Q L   EL +NR W+++   R W  K    E E    G+  +E  
Sbjct: 476 DTLFFIFYHYQGTYDQFLAARELSKNRKWKFNKIDRCWYYK----EVEKLPPGMLQAEEE 531

Query: 167 SYVFFDPQ-RW--EKCQKDFL 184
           S+ +FD Q  W   +C  D +
Sbjct: 532 SWRYFDYQGSWLARRCNNDVV 552

>ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR072W
           (NOT5)
          Length = 504

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 43/89 (48%), Gaps = 9/89 (10%)

Query: 102 QRVALFQDETLFYLFYKHPGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADG 161
           Q +  F  +TLF++FY + GT  Q L   EL  R W ++   R W  K    E E    G
Sbjct: 412 QIMTKFDLDTLFFIFYHYQGTYDQFLAARELIIRGWIFNRVNRCWFYK----EVEKLPPG 467

Query: 162 L--SERGSYVFFDPQR-W--EKCQKDFLL 185
           +   E  S+ +FD Q+ W   +C  DF+ 
Sbjct: 468 MDQKEEVSWRYFDYQKSWLARRCGPDFVF 496

>KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|P06102 Saccharomyces
           cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
           which is a global transcriptional regulator with roles
           in transcription initiation and elongation and in mRNA
           degradation
          Length = 772

 Score = 35.4 bits (80), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 4/80 (5%)

Query: 112 LFYLFYKHPGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFF 171
           LFY FY     + QE+ Y  L  RNW+   T   W ++  L  P+ S + L E   +  F
Sbjct: 667 LFYCFYYSITPLEQEIAYTLLGERNWKVSKTGENWFSRHSL--PKFSNE-LCEVADFKIF 723

Query: 172 DPQRWEKCQK-DFLLFYNAI 190
           +   W    K +F L Y+ +
Sbjct: 724 NLDDWTVTDKLNFKLDYSIL 743

>KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 590

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%)

Query: 104 VALFQDETLFYLFYKHPGTVLQELTYLELRNRNWRYHTTLRAWLTKD 150
           ++ F  +TLF++FY + G+  Q L   EL  R W ++   R W  K+
Sbjct: 499 MSKFALDTLFFIFYHYQGSYDQFLASRELSLRGWTFNKVNRCWFHKE 545

>Kpol_1070.25 s1070
           complement(58286..59491,59501..59509,59592..60437) [2061
           bp, 686 aa] {ON}
           complement(58286..59491,59501..59509,59592..60437) [2061
           nt, 687 aa]
          Length = 686

 Score = 32.7 bits (73), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 6/83 (7%)

Query: 111 TLFYLFYKHPGTVLQ-ELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYV 169
           TLFY +Y  P T LQ +++ + L  R+W+       W  K    EP+ S +   E G+Y 
Sbjct: 564 TLFYHYY-FPLTPLQKQISSILLIERDWKLLKNGTMWFLKQG--EPKFSNESF-EVGNYK 619

Query: 170 FFDPQRWEKCQK-DFLLFYNAIM 191
            F    W   +K +F L +N++M
Sbjct: 620 IFKADDWTVIEKFNFKLDFNSLM 642

>NCAS0E03940 Chr5 complement(772432..773607) [1176 bp, 391 aa] {ON}
           Anc_5.53
          Length = 391

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 4/45 (8%)

Query: 60  WAETSRSEVEPTFFIPDSFVG--ISGVLQSPVTPPRFDSAQNDQQ 102
           W +TS+S    TFFI +SF+G  ISG + + VT P FD  +   Q
Sbjct: 279 WMDTSKSHSNLTFFI-NSFIGGSISGTIAALVTHP-FDVGKTRWQ 321

>NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON}
           Anc_3.370 YPR072W
          Length = 582

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 110 ETLFYLFYKHPGTVLQELTYLEL-RNRNWRYHTTLRAW 146
           +TLF++FY + GT  Q L   EL +NR+W ++     W
Sbjct: 483 DTLFFIFYHYQGTYDQFLAARELSQNRHWLFNKVDSCW 520

>ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} similar
           to uniprot|P06102 Saccharomyces cerevisiae YIL038C NOT3
           Subunit of the CCR4-NOT complex which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 829

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 47/116 (40%), Gaps = 13/116 (11%)

Query: 84  VLQSPVTPPRFDSAQNDQQRVALFQDE-------TLFYLFYKHPGTVLQELTYLELRNRN 136
           +L+  + P   +S  NDQ++     +        TLFY +Y     + QE+  + L  R+
Sbjct: 678 ILRCSLRPIIQNSELNDQEKYEAILENFRSLEMFTLFYNYYFAVTPLEQEIASIILSERD 737

Query: 137 WRYHTTLRAWLTKDPLMEPEVS-ADGLSERGSYVFFDPQRWEKCQK-DFLLFYNAI 190
           W+       W     L + E   A+ L E   Y  F    W    + +F L Y A+
Sbjct: 738 WKVSKNCAMWF----LRQSETKFANELCEVADYKIFKLDDWTVIDRLNFKLDYAAL 789

>Kpol_1036.93 s1036 complement(241133..243307) [2175 bp, 724 aa]
           {ON} complement(241133..243307) [2175 nt, 725 aa]
          Length = 724

 Score = 30.0 bits (66), Expect = 3.8,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 57  QSPWA-ETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDS--AQNDQQRVALFQD 109
           Q  W   T+R E  P F +PD+   +  + ++P +   F S  ++ND Q   LFQ+
Sbjct: 309 QPQWGNSTARVERIPRFALPDNTSAVDHIYEAPNSDHGFYSSFSENDLQFATLFQN 364

>TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa]
           {ON} Anc_7.214 YIL038C
          Length = 847

 Score = 30.0 bits (66), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 111 TLFYLFYKHPGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVF 170
           TLFY +Y     + +E++ + L  R+WR       W ++    E ++S D L E G Y  
Sbjct: 725 TLFYNYYFSVTPLEKEVSMVVLAERDWRITNNETMWFSRQG--EAKLS-DELYEIGDYRI 781

Query: 171 FDPQRW 176
           F  + W
Sbjct: 782 FSLEDW 787

>TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {ON}
           Anc_7.214 YIL038C
          Length = 812

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 35/81 (43%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVF 170
           TLFY +Y     + Q +  L L  RNW+   +   W  +    EP+  A+ + E   Y  
Sbjct: 692 TLFYNYYFAVTPLEQTIASLVLSERNWKVSKSGTLWFLRQ--GEPKF-ANEVCEVADYKI 748

Query: 171 FDPQRWEKCQK-DFLLFYNAI 190
           F    W    K +F L Y A+
Sbjct: 749 FKLDDWTVADKPNFKLDYAAL 769

>TPHA0C01290 Chr3 complement(294072..296432) [2361 bp, 786 aa] {ON}
           Anc_7.214 YIL038C
          Length = 786

 Score = 29.3 bits (64), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 4/82 (4%)

Query: 111 TLFYLFYKHPGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVF 170
           TLFY FY    ++ +++    L  RNW   +    W  +   ++    A+  SE   Y  
Sbjct: 668 TLFYNFYFSVTSMERDIAAKILVERNWIQLSNGVMWFLRQGNIK---FANENSEVADYKI 724

Query: 171 FDPQRWEKCQK-DFLLFYNAIM 191
           F    W   +K +F L Y++IM
Sbjct: 725 FKADDWTVVEKLNFKLDYDSIM 746

>Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038C
           (NOT3) - CCR4 trascriptional complex component [contig
           198] FULL
          Length = 763

 Score = 28.9 bits (63), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 4/80 (5%)

Query: 112 LFYLFYKHPGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFF 171
           LFY FY     + +E+ Y  L  R+W+   +  +W ++  +  P+ S + L E   +  F
Sbjct: 674 LFYCFYYSITPLEREIAYTLLIERSWKVSKSGDSWFSRHGV--PKFSNE-LCEVADFKIF 730

Query: 172 DPQRWEKCQK-DFLLFYNAI 190
           +   W   +K +F L Y+ +
Sbjct: 731 NLDDWTVSEKLNFKLDYSIL 750

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,946,114
Number of extensions: 919455
Number of successful extensions: 2122
Number of sequences better than 10.0: 52
Number of HSP's gapped: 2112
Number of HSP's successfully gapped: 53
Length of query: 191
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 88
Effective length of database: 41,670,801
Effective search space: 3667030488
Effective search space used: 3667030488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)