Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0A141207.346ON42742723050.0
NDAI0A019307.346ON45042516680.0
KAFR0B008407.346ON42640215620.0
Skud_12.2667.346ON43643415590.0
KLLA0D12430g7.346ON41840115490.0
TDEL0C020207.346ON42540415460.0
YLR203C (MSS51)7.346ON43642615460.0
Suva_10.2977.346ON43643415450.0
Smik_12.2617.346ON43642615440.0
Kpol_530.357.346ON42541815370.0
TPHA0F029307.346ON43642315380.0
CAGL0A03927g7.346ON43741815370.0
NCAS0E028807.346ON42943015280.0
Ecym_47277.346ON42940015270.0
SAKL0F11286g7.346ON42342415240.0
ZYRO0F11616g7.346ON41540414890.0
KNAG0B026307.346ON43841114780.0
KLTH0H01342g7.346ON42240214740.0
NDAI0E044807.346ON44343114750.0
KNAG0C037507.346ON42440414670.0
Kwal_56.246317.346ON42240214470.0
TBLA0E005007.346ON43741414340.0
ACL152W7.346ON42840014120.0
NCAS0D001902.30ON781106732.3
KNAG0E028802.30ON719151713.3
TDEL0F004001.521ON32393686.7
KAFR0C032108.69ON2131118688.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0A14120
         (427 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   892   0.0  
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   647   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   606   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   605   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   601   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   600   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   600   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   599   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   599   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   596   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   597   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   596   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   593   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   592   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   591   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   578   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   573   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   572   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   572   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   569   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   561   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   556   0.0  
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   548   0.0  
NCAS0D00190 Chr4 complement(16895..19240) [2346 bp, 781 aa] {ON}...    33   2.3  
KNAG0E02880 Chr5 (581192..583351) [2160 bp, 719 aa] {ON} Anc_2.3...    32   3.3  
TDEL0F00400 Chr6 (63515..64486) [972 bp, 323 aa] {ON} Anc_1.521 ...    31   6.7  
KAFR0C03210 Chr3 (647217..653612) [6396 bp, 2131 aa] {ON} Anc_8....    31   8.5  

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  892 bits (2305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/427 (100%), Positives = 427/427 (100%)

Query: 1   MFAFKSPAATQLSLHPVSLFAIDSRISSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPW 60
           MFAFKSPAATQLSLHPVSLFAIDSRISSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPW
Sbjct: 1   MFAFKSPAATQLSLHPVSLFAIDSRISSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPW 60

Query: 61  DESPSPAIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEK 120
           DESPSPAIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEK
Sbjct: 61  DESPSPAIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEK 120

Query: 121 LRKVNIYEHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTK 180
           LRKVNIYEHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTK
Sbjct: 121 LRKVNIYEHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTK 180

Query: 181 MLSYPITIGSILYKYSPYNLIPKGPVTLEGLKSLAALRYTLRNNAFATTKTRPMRIFILG 240
           MLSYPITIGSILYKYSPYNLIPKGPVTLEGLKSLAALRYTLRNNAFATTKTRPMRIFILG
Sbjct: 181 MLSYPITIGSILYKYSPYNLIPKGPVTLEGLKSLAALRYTLRNNAFATTKTRPMRIFILG 240

Query: 241 ARAESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLA 300
           ARAESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLA
Sbjct: 241 ARAESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLA 300

Query: 301 YYPDYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTG 360
           YYPDYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTG
Sbjct: 301 YYPDYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTG 360

Query: 361 FSQDDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGK 420
           FSQDDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGK
Sbjct: 361 FSQDDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGK 420

Query: 421 RYHTVKA 427
           RYHTVKA
Sbjct: 421 RYHTVKA 427

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/425 (70%), Positives = 353/425 (83%), Gaps = 14/425 (3%)

Query: 17  VSLFAIDSRISSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIK 76
           +S F  + +  S+R  VGFVKNALG++PPP P EP F NRF+PWD+SPSP +RERAARI+
Sbjct: 26  ISYFKNNYQKFSNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDLRERAARIR 85

Query: 77  AQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRP 136
           A AKCPVTGKEI +TCP+SGIPTH+SKEAWENDTNYH+NKIY+ L+KVN++EHDLRSGR 
Sbjct: 86  ALAKCPVTGKEINYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRS 145

Query: 137 FPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYS 196
           FPEF+FP  Q  D  V+M NWD+FFYTRQF SMD+EFQLATVTKMLSYPITI SIL+KY 
Sbjct: 146 FPEFEFPQSQDHDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYC 205

Query: 197 PYNLIPKGPVTLEGLKSLAALRYTLRNNAFATTKTRPMRIFILGARAESQLPIHIWKQLQ 256
           PY L P GP+TLEGLKS+AAL+Y+LR+N F TTK RPMRIFILGARAESQLP HIWKQ  
Sbjct: 206 PYALEPNGPITLEGLKSIAALKYSLRHNEFETTKERPMRIFILGARAESQLPEHIWKQFS 265

Query: 257 FLFPAQAFEINFIGPECSLLE-------QDSNYLSSDS-------RIVKRVDESLTLAYY 302
           +LFP Q FEINFIGPECS+L        +++N  +S S       RIVKR+DE L L Y+
Sbjct: 266 YLFPFQNFEINFIGPECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRIDERLNLVYH 325

Query: 303 PDYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFS 362
            D+F   H A+DFFPYD YND+FFTFHPGFASPE++K+WMG+TMKALLDTKCAIFTTGF+
Sbjct: 326 TDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFN 385

Query: 363 QDDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRY 422
           + D++KDI  VQ+TYG+EVDMLM P KNVFGSTKWELND++PQ+VYQ+NMYIAGFRGKRY
Sbjct: 386 KQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRY 445

Query: 423 HTVKA 427
           H VK 
Sbjct: 446 HAVKV 450

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/402 (68%), Positives = 332/402 (82%), Gaps = 6/402 (1%)

Query: 30  RTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGKEIR 89
           RTLVGFV+NALG++PPP P EP  +NRFYPWD+SPSP +RERAA+IKA A+CP+TGKEI 
Sbjct: 25  RTLVGFVRNALGLEPPPTPDEPRVSNRFYPWDQSPSPELRERAAKIKAMARCPITGKEIN 84

Query: 90  FTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQARD 149
           +TCP+SGIPTH+S+EAWE D  YH+NKI + L+KVNIYEHDLRSGR FPEFDFP +Q  D
Sbjct: 85  YTCPISGIPTHHSREAWEQDEAYHRNKIPDILKKVNIYEHDLRSGRSFPEFDFPSDQTFD 144

Query: 150 STVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPVTLE 209
             VN+ NWDL+FYTR FYSMDTEFQLATVTKMLSYPITI S+L++YSPY+L P GP+TLE
Sbjct: 145 RAVNLANWDLYFYTRSFYSMDTEFQLATVTKMLSYPITIASVLHQYSPYSLYPHGPITLE 204

Query: 210 GLKSLAALRYTL-----RNNAFATTKTRPMRIFILGARAESQLPIHIWKQLQFLFPAQAF 264
           GLKS+AALRY+L     +++     KTRPMRIFILGARAESQLP H+WKQ Q+LFP Q F
Sbjct: 205 GLKSIAALRYSLYPSQHKSSRSVLNKTRPMRIFILGARAESQLPGHVWKQFQYLFPLQTF 264

Query: 265 EINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKFHKAQDFFPYDPYNDI 324
           EI FIGPEC L E  SN +   + IVKR+D++++L Y+P  F   HKAQDFFPYDPYND+
Sbjct: 265 EIIFIGPECQLREP-SNSVGGANNIVKRIDDTISLVYHPKLFHDIHKAQDFFPYDPYNDV 323

Query: 325 FFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQDTYGEEVDML 384
           FF FHPGFASPE+ + WM DT+KALLDTKCA+F TGFS+ D+  D+  +   YG+++D L
Sbjct: 324 FFVFHPGFASPETKELWMNDTVKALLDTKCAVFHTGFSKKDLSNDVKLLNKMYGDKLDTL 383

Query: 385 MNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVK 426
           M P+KN+FGSTKWELNDLNPQ+VYQFNMYI+ FRGKRYH ++
Sbjct: 384 MTPVKNLFGSTKWELNDLNPQEVYQFNMYISAFRGKRYHPIE 425

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/434 (66%), Positives = 352/434 (81%), Gaps = 8/434 (1%)

Query: 1   MFAFKSPA-ATQLSLHPVSLFAIDSRISSHRT---LVGFVKNALGIDPPPLPTEPVFANR 56
           M A  +P+ A Q+  H +     +  +  H+T   L+GFV+NALG+DPPP P +P   NR
Sbjct: 1   MTALYAPSGAAQMYSHLLRRSPYNRLVVYHQTRRHLMGFVRNALGLDPPPSPDDPTPENR 60

Query: 57  FYPWDESPSPAIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNK 116
           F+PWD+SPS  +RERAA+I+  A CPVTGK+I +TCPLSGIPTH+S+EAWE D  YH +K
Sbjct: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSK 120

Query: 117 IYEKLRKVNIYEHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLA 176
            YE L+KVNIYEHDLRSGRPFPEFDFP +Q  D  VN+TNWDLFFYTR FYSMDTEFQLA
Sbjct: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180

Query: 177 TVTKMLSYPITIGSILYKYSPYNLIPKGPVTLEGLKSLAALRYTL----RNNAFATTKTR 232
            VTKMLSYPITIGS+L+K+SPY+L PKGP+TLEGLKSLAALRYTL      +  ATTK R
Sbjct: 181 AVTKMLSYPITIGSVLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNR 240

Query: 233 PMRIFILGARAESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKR 292
            MRIFILGARAE+QLP H+WKQLQFLFP Q FEI+F+GPEC        Y+ S + +V+R
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQR 300

Query: 293 VDESLTLAYYPDYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDT 352
           VDE+L   ++ D+FD FH+AQDFFPYDPY D+FFTFHPG+ASPES  +WMG+TM+ALL+T
Sbjct: 301 VDETLRFIHHTDFFDVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLET 360

Query: 353 KCAIFTTGFSQDDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNM 412
           KCAIFTTGF++ D+M DI +V+  YG+E+D+LM+P++NVFGSTKWELND+NPQ+VYQFNM
Sbjct: 361 KCAIFTTGFNKKDLMDDINAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNM 420

Query: 413 YIAGFRGKRYHTVK 426
           YIAGFRGKRYHT+K
Sbjct: 421 YIAGFRGKRYHTIK 434

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/401 (68%), Positives = 333/401 (83%), Gaps = 4/401 (0%)

Query: 30  RTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGKEIR 89
           R ++GFV+NALG+DPP  P +P   NRF+PWD+SPSP +RERAARIKA A CPVT K+I+
Sbjct: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76

Query: 90  FTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQARD 149
           FTCPLSGIPTH+S+EAWE DT YHK+K YE L+KVNIYEHDLRSGRPFPEFDFP +Q  D
Sbjct: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136

Query: 150 STVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPVTLE 209
             VNM+NWDLFFYTR FYSMDTEFQLA VTKMLSYPITIGS+L++YSPY+L PKGP+TLE
Sbjct: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196

Query: 210 GLKSLAALRYTL---RNNAFATTKTRPMRIFILGARAESQLPIHIWKQLQFLFPAQAFEI 266
           GLKSLAALRYTL   ++  F   +  P+RIFILG RAE+QLP H+WKQLQ+L P  + E+
Sbjct: 197 GLKSLAALRYTLYPEQSGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIEL 256

Query: 267 NFIGPECSLLEQDSNYL-SSDSRIVKRVDESLTLAYYPDYFDKFHKAQDFFPYDPYNDIF 325
           +F+GPE     +  +Y+ SS   IVKR+DE + L Y+ D+F  FH+AQDFFPYDPYND+F
Sbjct: 257 HFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDVF 316

Query: 326 FTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQDTYGEEVDMLM 385
           F FHPGFA+PE+ + WMGDTMKAL+ TKCA+FTTGFS++D+++DI+ VQD YG E+DMLM
Sbjct: 317 FCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDMLM 376

Query: 386 NPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVK 426
            P+ NVFGSTKWELND NP +VYQFNMYIAGFRGKRYH ++
Sbjct: 377 EPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIE 417

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/404 (68%), Positives = 341/404 (84%), Gaps = 3/404 (0%)

Query: 27  SSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGK 86
           +  R ++GFV+NALG+DPPP P +P   NRF+PWD+SP   +RERAARI+  A+CPVTGK
Sbjct: 22  NQRRFIIGFVRNALGLDPPPSPDDPTPENRFHPWDQSPVGDLRERAARIRTLARCPVTGK 81

Query: 87  EIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQ 146
           EI +TCPLSGIPTH+S+EAWE D  YH++K YE L+KVNIYEHDLRSGRPFPEFDFP  Q
Sbjct: 82  EINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQ 141

Query: 147 ARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPV 206
             D TVNMTNWDLFFYTRQFYSMDTEFQLA VTKMLSYPI+I S+L+++SPY+L PKGPV
Sbjct: 142 DFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPV 201

Query: 207 TLEGLKSLAALRYT---LRNNAFATTKTRPMRIFILGARAESQLPIHIWKQLQFLFPAQA 263
           TLEGLKSLAALRYT   L N   ++TK RPMRIFILGARAE+QLP H+WKQLQ+LFP Q 
Sbjct: 202 TLEGLKSLAALRYTLYPLENKTISSTKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQM 261

Query: 264 FEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKFHKAQDFFPYDPYND 323
           FE++F+GPEC L ++   Y++S + +VKRVDE+++  Y+ D+F   H+AQDFFPYDPY D
Sbjct: 262 FELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLD 321

Query: 324 IFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQDTYGEEVDM 383
           +FF FHPGF +PE+S +W+ +TMK LL+TKCAIFTTGF++ D+++D+ +V+D YG+EVD+
Sbjct: 322 VFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDV 381

Query: 384 LMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVKA 427
           LM P+KNVFGSTKWELND+NPQ+VYQFNMYIAGFRGKRYH ++ 
Sbjct: 382 LMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/426 (67%), Positives = 346/426 (81%), Gaps = 7/426 (1%)

Query: 8   AATQLSLHPVSLFAIDSRISSHRT---LVGFVKNALGIDPPPLPTEPVFANRFYPWDESP 64
            ATQL  H +     +  + SH+T   L+GFV+NALG+DPPP P +P   NRF+PWD+SP
Sbjct: 9   GATQLYFHLLRKSPHNRLVVSHQTRRHLMGFVRNALGLDPPPSPEDPTPENRFHPWDQSP 68

Query: 65  SPAIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKV 124
           S  +RERAA+I+  A CPVTGK+I +TCPLSGIPTH+S+EAWE D  YH +K YE L+KV
Sbjct: 69  SVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKV 128

Query: 125 NIYEHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSY 184
           NIYEHDLRSGRPFPEFDFP +Q  D  VN+TNWDLFFYTR FYSMDTEFQLA VTKMLSY
Sbjct: 129 NIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSY 188

Query: 185 PITIGSILYKYSPYNLIPKGPVTLEGLKSLAALRYT---LRNNAF-ATTKTRPMRIFILG 240
           PITIGS+L+K+SPY+L PKGP+TLEGLKSLAALRYT   L N +   TTK R MRIFILG
Sbjct: 189 PITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILG 248

Query: 241 ARAESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLA 300
           ARAE+QLP H+WKQLQFLFP Q+FEI+FIGPEC        Y+ S + +V+RVDE+L   
Sbjct: 249 ARAEAQLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFI 308

Query: 301 YYPDYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTG 360
           Y  ++F+ FH+AQDFFPYDPY D+FFTFHPG+ASPES  +WMG+TMKALL+TKCAIFTTG
Sbjct: 309 YRTNFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTG 368

Query: 361 FSQDDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGK 420
           F++ D+  DI  V+  YG+E+D+LM P++NVFGSTKWELND+NPQ+VYQFNMYIAGFRGK
Sbjct: 369 FNKKDLTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGK 428

Query: 421 RYHTVK 426
           RYHT+K
Sbjct: 429 RYHTIK 434

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/434 (66%), Positives = 349/434 (80%), Gaps = 8/434 (1%)

Query: 1   MFAFKSPA-ATQLSLHPVSLFAIDSRISSHRT---LVGFVKNALGIDPPPLPTEPVFANR 56
           M A  +P+ A QL  H +     +  + SH+T   L+GFV+NALG+DPPP P +P   NR
Sbjct: 1   MTALYAPSGAAQLYSHLLRRSPQNRLVVSHQTRRHLMGFVRNALGLDPPPSPDDPTPENR 60

Query: 57  FYPWDESPSPAIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNK 116
           F+PWD+SPS  +RERAA+I+  A CPVTGK+I +TCPLSGIPTH+S+EAWE D  YH +K
Sbjct: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120

Query: 117 IYEKLRKVNIYEHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLA 176
            YE L+KVNIYEHDLRSGRPFPEFDFP +Q  D  VN+TNWDLF YTR FYSMDTEFQLA
Sbjct: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLA 180

Query: 177 TVTKMLSYPITIGSILYKYSPYNLIPKGPVTLEGLKSLAALRYTL----RNNAFATTKTR 232
            VTKMLSYPITIGS+L+K+SPY+L PKGP+TLEGLKSLAALRYTL      +  ATT+ R
Sbjct: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNR 240

Query: 233 PMRIFILGARAESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKR 292
            MRIFILGARAE+QLP H+WKQLQFLFP Q FEI+FIGPEC        Y+ S + +V+R
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQR 300

Query: 293 VDESLTLAYYPDYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDT 352
           +DE+L   ++ D+F  FH+AQDFFPYDPY D+FFTFHPG+ASPES  +WMG+TM ALL+T
Sbjct: 301 IDETLKFFHHTDFFQVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLET 360

Query: 353 KCAIFTTGFSQDDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNM 412
           KCAIFTTGF++ D+M DI  V+  YG+E+D+LM+P+KNVFGSTKWELND+NPQ+VYQFNM
Sbjct: 361 KCAIFTTGFNKKDLMDDINLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420

Query: 413 YIAGFRGKRYHTVK 426
           YIAGFRGKRYHT+K
Sbjct: 421 YIAGFRGKRYHTIK 434

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/426 (67%), Positives = 346/426 (81%), Gaps = 7/426 (1%)

Query: 8   AATQLSLHPVSLFAIDSRISSHRT---LVGFVKNALGIDPPPLPTEPVFANRFYPWDESP 64
            ATQL  H +   + +  + SH+T   L+GFV+NALG+DPPP P +P   NRF+PWD+SP
Sbjct: 9   GATQLYSHLLRRSSHNRLVLSHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSP 68

Query: 65  SPAIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKV 124
           S  +RERAA+I+  A CPVTGK+I +TCPLSGIPTH+S+EAWE D  YH +K YE L+KV
Sbjct: 69  SVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKV 128

Query: 125 NIYEHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSY 184
           NIYEHDLRSGRPFPEFDFP  Q  D  VN+TNWDLFFYTR FYSMDTEFQLA VTKMLSY
Sbjct: 129 NIYEHDLRSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSY 188

Query: 185 PITIGSILYKYSPYNLIPKGPVTLEGLKSLAALRYT---LRNNAFAT-TKTRPMRIFILG 240
           PITIGS+L+K+SPY+L PKGP+TLEGLKSLAALRYT   L N +  T TK R MRIFILG
Sbjct: 189 PITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILG 248

Query: 241 ARAESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLA 300
           ARAE+QLP H+WKQLQFLFP Q FEI+FIGPEC        Y+ S + +V+RVDE+L   
Sbjct: 249 ARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFI 308

Query: 301 YYPDYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTG 360
           +  D+F+ FH+AQDFFPYDPY D+FFTFHPG+ASPES  +WMG+TMKALL+TKCAIFTTG
Sbjct: 309 HRTDFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTG 368

Query: 361 FSQDDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGK 420
           F++ D+  D+  V+  YG+E+D+LM+P+KNVFGSTKWELND+NPQ+VYQFNMYIAGFRGK
Sbjct: 369 FNKKDLTDDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGK 428

Query: 421 RYHTVK 426
           RYHT+K
Sbjct: 429 RYHTIK 434

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/418 (67%), Positives = 346/418 (82%), Gaps = 6/418 (1%)

Query: 16  PVSLFAIDSRISSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARI 75
           P+ L A    +   R+L+GFV+NALG+DPPP P +P   NRF+PWD+SP   +RERAA+I
Sbjct: 8   PMRLGAGSYSLIQKRSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKI 67

Query: 76  KAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGR 135
           +  AKCPVT K+I +TCPLSGIPTH+ KEAW  D +YH++K YE L+KVNIYEHDLRSGR
Sbjct: 68  RTLAKCPVTHKDINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGR 127

Query: 136 PFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKY 195
           PFPEFDFP +Q  D  +N+TNWDLFFYTR FYSMDTEFQLA VTKMLSYPITIGS+L+++
Sbjct: 128 PFPEFDFPQDQDYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQF 187

Query: 196 SPYNLIPKGPVTLEGLKSLAALRYTL------RNNAFATTKTRPMRIFILGARAESQLPI 249
           SPY+L PKGPVTLEGLKSLAALRYTL        N    T+ RPMRIFILGARAE+QLP 
Sbjct: 188 SPYSLNPKGPVTLEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPG 247

Query: 250 HIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKF 309
           H+WKQ Q+LFP Q FEI+FIGPEC L ++ + Y++S + IVK+VD++L L ++PDYF  F
Sbjct: 248 HVWKQFQYLFPEQEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVF 307

Query: 310 HKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKD 369
           H+AQDFFPYDP+ D+FFTFHPG+A PE+++ W+G+TMKALLDTKCAIFTTGFS+ D+++D
Sbjct: 308 HEAQDFFPYDPFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRD 367

Query: 370 ITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVKA 427
           I  V++ YG E+DMLM+P+KNVFGSTKWELND+NPQ+VYQFNMYIAGFRGKRYH ++ 
Sbjct: 368 IDVVKNRYGNELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/423 (66%), Positives = 344/423 (81%), Gaps = 11/423 (2%)

Query: 15  HPVSLFAIDSRI------SSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAI 68
           HP+S+  ++         S  R+L+GFVKNALG+DP P P +P   NRF+PWD+SPSP +
Sbjct: 13  HPMSMNILNKNTLTSLPSSQKRSLMGFVKNALGLDPSPSPDDPTPENRFHPWDQSPSPDL 72

Query: 69  RERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYE 128
           RERAARI+  AKCPVT KEI +TCPLSGIPTH+S+EAWE D +YH++K YE L+KVNIYE
Sbjct: 73  RERAARIRTLAKCPVTKKEINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYE 132

Query: 129 HDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITI 188
           HDLRSGRPFPEFDFP +Q  D  VN+TNWDLFFYTR FYSMDTEFQLA VTKMLSYP+TI
Sbjct: 133 HDLRSGRPFPEFDFPLDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTI 192

Query: 189 GSILYKYSPYNLIPKGPVTLEGLKSLAALRYTL-----RNNAFATTKTRPMRIFILGARA 243
           GSIL+++SPY+L PKGP+TLEGLKSLAALRY+L     ++N       RPMRIFILGARA
Sbjct: 193 GSILHQFSPYSLNPKGPITLEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARA 252

Query: 244 ESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYP 303
           E+QLP H+WKQLQFLFP Q FEI+FIG EC L  + + Y+ S   +VK++DE++ L Y+ 
Sbjct: 253 EAQLPGHVWKQLQFLFPDQTFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHS 312

Query: 304 DYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQ 363
           DYF  +H+AQDF PYDPY D+FFTFHPGFA+PE+S  WMGDTMKALL+TKCAIFTTGF++
Sbjct: 313 DYFHVYHEAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNK 372

Query: 364 DDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYH 423
            DI  D+  V+  YG+E+D LM+PIKN +GSTKWELND+NPQ+++QFNMY+AGFRGKRYH
Sbjct: 373 QDITNDVEIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYH 432

Query: 424 TVK 426
           T+K
Sbjct: 433 TIK 435

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/418 (67%), Positives = 330/418 (78%), Gaps = 18/418 (4%)

Query: 28  SHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGKE 87
           S R L+GFV+NALG+DPPP P EP   NRF+PWD+SP+  +RERAARIK  AKCPVT K 
Sbjct: 20  SKRQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLRERAARIKTLAKCPVTHKP 79

Query: 88  IRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQA 147
           I++TCP+SGIPTH+S+EAWE D  YH +K YE L+KVNIYEHDLRSGRPFPEFDFP +Q 
Sbjct: 80  IQYTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEHDLRSGRPFPEFDFPRDQG 139

Query: 148 RDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPVT 207
            D TVN+TNWDLF YTR FYSMDTEFQLA VTKMLSYPITIGS+L+++SPY+L PKGP+T
Sbjct: 140 PDRTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPIT 199

Query: 208 LEGLKSLAALRYT---LRNNAFATT-KTRPMRIFILGARAESQLPIHIWKQLQFLFPAQA 263
           LEGLKSLAALRYT   L+N A  TT K +PMRIFILGARAE+QLP H+WKQLQFLFP Q 
Sbjct: 200 LEGLKSLAALRYTLYPLQNRAVTTTAKNKPMRIFILGARAEAQLPGHVWKQLQFLFPQQN 259

Query: 264 FEINFIGPECSLLEQDSNYLSSDSR--------------IVKRVDESLTLAYYPDYFDKF 309
           FEI+FIGPE     + + Y+ S +               + KR+DE++   Y+ DYF   
Sbjct: 260 FEIHFIGPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRIDETMKFFYHTDYFHTL 319

Query: 310 HKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKD 369
           H AQDFFPYDPY D+FF FHPG ASPES  TWM DT+K LLDTKCAIFTTGF++ D+  D
Sbjct: 320 HTAQDFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFTTGFNKKDMADD 379

Query: 370 ITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVKA 427
           I  +QDTYG+E+DMLMNP+KNVFGSTKWEL+D +P  VYQFNMYIAGFRGKRYH +K 
Sbjct: 380 IQILQDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFRGKRYHPIKV 437

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/430 (66%), Positives = 341/430 (79%), Gaps = 6/430 (1%)

Query: 1   MFAFKSPAATQLSLHPVSLFAIDSRISSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPW 60
           MF   S    + +L P + F +    + H  L+GFV+NALG+DPP  P +P   NRF+PW
Sbjct: 1   MFLRTSVPVYRTTLLPRNAFNVAGNQTRH--LMGFVRNALGLDPPTSPDDPTPENRFHPW 58

Query: 61  DESPSPAIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEK 120
           D+SPSP +RERAARI+  A+CPVTGKEI +TCP+SGIPTH+S+EAWE D  YH +K YE 
Sbjct: 59  DQSPSPDLRERAARIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYEL 118

Query: 121 LRKVNIYEHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTK 180
           L+KVNIYEHDLRSGRPFPEFDFP +Q +D  VNMTNWDLF YTR FYSMDTEFQ+A VTK
Sbjct: 119 LKKVNIYEHDLRSGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTK 178

Query: 181 MLSYPITIGSILYKYSPYNLIPKGPVTLEGLKSLAALRYTL----RNNAFATTKTRPMRI 236
           MLSYPITIGS+L+++SPY+L PKGP++LEGLKSLAALRYTL         +TTK RPMRI
Sbjct: 179 MLSYPITIGSVLHQFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRI 238

Query: 237 FILGARAESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDES 296
           FILGARAESQLP H+WKQLQ+LFP Q FEI+FIGPE    +    Y+   + I + VDE+
Sbjct: 239 FILGARAESQLPGHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDET 298

Query: 297 LTLAYYPDYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAI 356
           L L Y+ +YF K H+AQDFFPYDPY D+FF FHPGFAS E  + WM DTMK LLDTKCAI
Sbjct: 299 LKLIYHTEYFHKLHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAI 358

Query: 357 FTTGFSQDDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAG 416
           FTTGF+++D+++DI  VQD YG+E+D+LM P KNVFGSTKWELND+NPQ+VYQFNMYIAG
Sbjct: 359 FTTGFTKNDLLEDIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAG 418

Query: 417 FRGKRYHTVK 426
           FRGKRY T+K
Sbjct: 419 FRGKRYPTIK 428

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/400 (66%), Positives = 331/400 (82%), Gaps = 3/400 (0%)

Query: 30  RTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGKEIR 89
           R ++GFV+NALG+DPP  P EP   NRF+PWD+SPSP +RERAARIKA AKCPVTGK I+
Sbjct: 29  RQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCPVTGKNIQ 88

Query: 90  FTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQARD 149
           F+C  SGIPTH+S+EAW+ND+ YH++K Y  L+KVNIYEHDLRSGRPF EFDFP +Q  D
Sbjct: 89  FSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDFPEQQDYD 148

Query: 150 STVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPVTLE 209
             VNM NWDL+FYTR F+SMDTEFQLA VTKMLSYPITIGSIL++YSPY+L PKGP+TLE
Sbjct: 149 RMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNPKGPITLE 208

Query: 210 GLKSLAALRYTL---RNNAFATTKTRPMRIFILGARAESQLPIHIWKQLQFLFPAQAFEI 266
           GLKSLAALRYTL   +N    + + +P+R+FILGARAE+QLP H+WKQLQ+LFP    E+
Sbjct: 209 GLKSLAALRYTLYPEQNRRVRSIQDKPLRVFILGARAEAQLPGHVWKQLQYLFPESLIEL 268

Query: 267 NFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKFHKAQDFFPYDPYNDIFF 326
           +F+GPE +   +   Y++S   +VKR+D+++ + Y+ DYF  FH+AQDFFPYDPYNDIFF
Sbjct: 269 HFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDFFPYDPYNDIFF 328

Query: 327 TFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQDTYGEEVDMLMN 386
            FHPGF SPE+  TWM  T++ALL TKCAIFTTGF++ D+M D+ +V++ YG+E+DML++
Sbjct: 329 CFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYGDELDMLVD 388

Query: 387 PIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVK 426
           P KNVFGSTKWELNDLNP +VYQFNMYIAGFRGKRYH ++
Sbjct: 389 PTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIE 428

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/424 (66%), Positives = 342/424 (80%), Gaps = 9/424 (2%)

Query: 8   AATQLSLHPVSLFAIDSRISSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPA 67
           A  + S+ P S     +RI   R ++GFV+NALG+DPPP P +P   NRF+PWD+SPSP 
Sbjct: 5   AYKRCSIAPASA----TRIQK-RHIIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPSPD 59

Query: 68  IRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIY 127
           +R RAA I+A A+CPVTGKEI +TCP SGIPTH+S+EAWE DT YH  K YE L+KVNIY
Sbjct: 60  LRTRAATIRALARCPVTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIY 119

Query: 128 EHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPIT 187
           EHDLRSGRPFPEFDFP +Q  D  VNMTNWDLFFYTRQFYSMDTEFQLA VTKMLSYP T
Sbjct: 120 EHDLRSGRPFPEFDFPQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTT 179

Query: 188 IGSILYKYSPYNLIPKGPVTLEGLKSLAALRYTL----RNNAFATTKTRPMRIFILGARA 243
           +GS+L+++SPY L PKGP+TLEGLKSLAALRYTL         A TK RPMRIFILGARA
Sbjct: 180 VGSVLHEFSPYALNPKGPITLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARA 239

Query: 244 ESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYP 303
           E+QLP H+WKQ QFLFP   FE++FIGPE     +   Y++S + IV+RVDE+L+  Y+ 
Sbjct: 240 EAQLPGHVWKQFQFLFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHT 299

Query: 304 DYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQ 363
           DYF  FH+AQDFFPYDPY DIFF FHPGFA+PES++ WMG TM+ LL+TKCAIFTTGF++
Sbjct: 300 DYFHVFHEAQDFFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNE 359

Query: 364 DDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYH 423
            D+++D+T+V++ YG E+DMLM P++N+FGSTKWELND+NPQ+VYQFNMYIAGFRGKRYH
Sbjct: 360 QDLVRDMTAVREKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH 419

Query: 424 TVKA 427
            ++ 
Sbjct: 420 AIEV 423

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/404 (67%), Positives = 332/404 (82%), Gaps = 3/404 (0%)

Query: 26  ISSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTG 85
           I+  RT++GFV+NALG+DPPP P +P   NRF+ WD+SP+  +RERAARI+A A+CPVTG
Sbjct: 11  ITQRRTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIRALAQCPVTG 70

Query: 86  KEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGE 145
           KEI +TCPLSGIPTH+SKEAWE D  YH++K +E L+KVNIYEHDLRSGRPFPEFDFP +
Sbjct: 71  KEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQD 130

Query: 146 QARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGP 205
              D TVNMTNWDLFFYTRQFYSMDTEFQLA VTKMLSYPITI S+L ++SPY+L PKGP
Sbjct: 131 LEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGP 190

Query: 206 VTLEGLKSLAALRYTL---RNNAFATTKTRPMRIFILGARAESQLPIHIWKQLQFLFPAQ 262
           +TLEGLKSLAALRYTL    N   A TK RPMR+FILGARAE+ LP H+WKQLQFLFP  
Sbjct: 191 ITLEGLKSLAALRYTLYPFENKTVAATKDRPMRLFILGARAEALLPGHVWKQLQFLFPET 250

Query: 263 AFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKFHKAQDFFPYDPYN 322
           AFE++FIGPEC + ++   Y+SS + +VKR+DE+L+  Y+ DYF  +H AQDFFPYDPY 
Sbjct: 251 AFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYDPYL 310

Query: 323 DIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQDTYGEEVD 382
           D FF FHPGF +PES+K W+  T+  LL+TKCAIF TG ++  +++DI +V D + +E+D
Sbjct: 311 DAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSKEID 370

Query: 383 MLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVK 426
           +LM P KN++GSTKWELND+NPQ+VYQFNMYIAGFRGKRYH ++
Sbjct: 371 ILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIE 414

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/411 (65%), Positives = 324/411 (78%), Gaps = 12/411 (2%)

Query: 28  SHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGKE 87
           + R L+GFV+NALG++PPP P +P   NRF+PWD+SP  A+RERAARIK  AKCPVTG  
Sbjct: 27  ARRQLMGFVRNALGLEPPPSPMDPTPENRFHPWDQSPVDALRERAARIKTLAKCPVTGLN 86

Query: 88  IRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQA 147
           + +TCPLSGIPTH+S+EAWE DT YH  K YE L+KVNIYEHDLRSGRPFPEFDFP EQ 
Sbjct: 87  VEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQG 146

Query: 148 RDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPVT 207
            D  VNMTNWDLFFYTR FYSMDTEFQLA VTKMLSYP+TI S+L ++SPY+L PKGP+T
Sbjct: 147 YDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPIT 206

Query: 208 LEGLKSLAALRYTLRNNAF------------ATTKTRPMRIFILGARAESQLPIHIWKQL 255
           LEGLKSLAA+RYTL + +F               K RPMR+F+LGARAE+QLP H+WKQL
Sbjct: 207 LEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQL 266

Query: 256 QFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKFHKAQDF 315
            +LFP Q+FE+ FIGPE         Y+ S + +V++VDE+L   +Y DYF   H++QDF
Sbjct: 267 SYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQDF 326

Query: 316 FPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQD 375
           FPYDPY D FFTFHPGFASPE+  TW+ +T+ ALLDTKCAIFTTGF +DD+M D+  + +
Sbjct: 327 FPYDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNE 386

Query: 376 TYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVK 426
            +G E+D+LM P KNVFGSTKWELNDLNP +VYQFNMYIAGFRGKRYHT+K
Sbjct: 387 KFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIK 437

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/402 (67%), Positives = 327/402 (81%), Gaps = 4/402 (0%)

Query: 30  RTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGKEIR 89
           R ++GFV+NALG+DPPP P EP   NRF+PWD+SPSP +RERAA I+A AKCPVTG+EI 
Sbjct: 21  RHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGREIN 80

Query: 90  FTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQARD 149
           +TCP SGIPTHYS+EAWEND  Y ++K  E L+KVNIYEHDLRSGRPFPEFDFP +Q  D
Sbjct: 81  YTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFD 140

Query: 150 STVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPVTLE 209
             VN+TNWDLFFYTR FYSMDTEFQLA VTKMLSYP+TIGS+L+++SPY+L PKGPVTLE
Sbjct: 141 RMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPVTLE 200

Query: 210 GLKSLAALRYTL----RNNAFATTKTRPMRIFILGARAESQLPIHIWKQLQFLFPAQAFE 265
           GLKSLAALRYTL         + TK  P+RIFILGARAE+QLP H+WKQLQF+FP    E
Sbjct: 201 GLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETNIE 260

Query: 266 INFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKFHKAQDFFPYDPYNDIF 325
           ++F+GPE         Y+ S S IV+RVDE+L+  Y+ DYF  FH+AQDFFPYDPY DIF
Sbjct: 261 LHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYTDIF 320

Query: 326 FTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQDTYGEEVDMLM 385
           F FHPGFA+PES + WMG TM+ALL+TKCA+FTTGF++ D+ +D+ +V   +G+E+DMLM
Sbjct: 321 FCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKELDMLM 380

Query: 386 NPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVKA 427
            P+ N FGSTKWELND+NPQ+VYQFNM+IAGFRGKRYH ++ 
Sbjct: 381 EPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/431 (62%), Positives = 336/431 (77%), Gaps = 7/431 (1%)

Query: 3   AFKSPAATQLSLHPVSL-FAIDSRISSH--RTLVGFVKNALGIDPPPLPTEPVFANRFYP 59
           A++S   T L   P    F  ++ +S H  R+L+GFV+NALG+DP   P +P   NRF+P
Sbjct: 12  AYRSRLPTTLCFTPNPRNFRNNAHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHP 71

Query: 60  WDESPSPAIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYE 119
           WD+SP   +RERAA+I+  A CPVT KEI +TCP+SGIPTH+SK AWE D NYH NKIYE
Sbjct: 72  WDQSPCQDLRERAAKIRTLAHCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYE 131

Query: 120 KLRKVNIYEHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVT 179
            L+KVNIYEHDLRSGRPFPEF FP +Q  D  +NMTNWDLF YTR FYSMDTEFQ+A VT
Sbjct: 132 ILKKVNIYEHDLRSGRPFPEFVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVT 191

Query: 180 KMLSYPITIGSILYKYSPYNLIPKGPVTLEGLKSLAALRYTL---RNNAFAT-TKTRPMR 235
           KMLSYPITIGSIL+++SPY+L PKGP+TLEGLKS+AALRYTL    N +F T TK RPMR
Sbjct: 192 KMLSYPITIGSILHQFSPYSLQPKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMR 251

Query: 236 IFILGARAESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDE 295
           IF+LGARAE+QLP HIWKQLQ+LFP Q FE+ FIGPE    ++   YL  D  +++ +D+
Sbjct: 252 IFLLGARAEAQLPGHIWKQLQYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDD 311

Query: 296 SLTLAYYPDYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCA 355
           +L L +  +YF   H++QD FPYDPY D+FF FHPGF++ E+++ WM DTMK+LL+T+CA
Sbjct: 312 TLKLTFITEYFHTLHESQDLFPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCA 371

Query: 356 IFTTGFSQDDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIA 415
           IF TGFS++D++ D+  + + Y  ++D+LM P+KNVFGSTKWELNDLNPQ VYQFNMYIA
Sbjct: 372 IFNTGFSRNDMLNDMNILDEKYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIA 431

Query: 416 GFRGKRYHTVK 426
           GFRGKRY TV+
Sbjct: 432 GFRGKRYPTVE 442

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/404 (63%), Positives = 323/404 (79%), Gaps = 6/404 (1%)

Query: 25  RISSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVT 84
           R + HRT++G+V+NA G++P   P  P  +NRF+PW+ESP   +R+RAARIK  A+CPVT
Sbjct: 24  RYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVT 83

Query: 85  GKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPG 144
           GK I +TCP+SGIPTH+S++AWE+DT+YHKNK YEKL+KVNIYEHDLRSGR FPEFDFP 
Sbjct: 84  GKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPA 143

Query: 145 EQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKG 204
           EQ RD  VN+ NWDLF YTRQFYSMDTEF LATVTKMLSYPITI S+L+++SPY L P+G
Sbjct: 144 EQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRG 203

Query: 205 PVTLEGLKSLAALRYTL--RNNAFATTKTRPMRIFILGARAESQLPIHIWKQLQFLFPAQ 262
           PVTLEGLKS+AALRYTL  +    + +   PMRIFI+G RAESQLP H+WKQLQ+LF  +
Sbjct: 204 PVTLEGLKSIAALRYTLYPKLGKTSLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSER 263

Query: 263 AFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKFHKAQDFFPYDPYN 322
            FEI+FIGPEC L E      ++ + ++K+VD++L+L Y+P YF + HK+ D FPY+PY 
Sbjct: 264 IFEIHFIGPECQLKEPK----NTSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYK 319

Query: 323 DIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQDTYGEEVD 382
           D+FF FHPGFA P++ K W+ +T+  LL+TKCAIF TGF++ DI  D+T +   Y  E+D
Sbjct: 320 DVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEID 379

Query: 383 MLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVK 426
           +LM PIKNVFGS KWELND+NPQ+VYQFNMYIAGFRGKRYH +K
Sbjct: 380 VLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIK 423

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  561 bits (1447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/402 (65%), Positives = 326/402 (81%), Gaps = 4/402 (0%)

Query: 30  RTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGKEIR 89
           R ++GFV+NALG+DPPP P EP   NRF+PWD+SPSP +RERAA I+A AKCPVTG+EI 
Sbjct: 21  RHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGREIN 80

Query: 90  FTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQARD 149
           +TCP SGIPTH+S+EAWE D +Y ++K  E L+KVNIYEHDLRSGRPFPEFDFP +Q  D
Sbjct: 81  YTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFD 140

Query: 150 STVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPVTLE 209
             VN+TNWDLFFYTR F+SMDTEFQLA VTKMLSYPITIGS+L+++SPY+L PKGP+TLE
Sbjct: 141 RMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPITLE 200

Query: 210 GLKSLAALRYTL----RNNAFATTKTRPMRIFILGARAESQLPIHIWKQLQFLFPAQAFE 265
           GLKSLAALRYTL         +  K  P+RIF+LGARAE+QLP H+WKQLQF+FP    E
Sbjct: 201 GLKSLAALRYTLYPDQNRRVTSIAKNSPLRIFVLGARAEAQLPGHVWKQLQFMFPETQME 260

Query: 266 INFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKFHKAQDFFPYDPYNDIF 325
           I+F+GPE         Y+ S + I++RVDE+L   Y+ DYF  FH+AQDFFPYDPY DIF
Sbjct: 261 IHFVGPESYYDRNKREYVHSAAPIIRRVDETLNFVYHTDYFHVFHEAQDFFPYDPYTDIF 320

Query: 326 FTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQDTYGEEVDMLM 385
           F FHPGFA+PES + WMG TM+ALL+TKCAIFTTGF++ D+ +D+ +V   YG+E+D++M
Sbjct: 321 FCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVDLQRDLDAVVAEYGKELDIIM 380

Query: 386 NPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVKA 427
           +P KN FGSTKWELND+NPQ+VYQFNM++AGFRGKRYH ++ 
Sbjct: 381 DPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHAIEV 422

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/414 (63%), Positives = 326/414 (78%), Gaps = 16/414 (3%)

Query: 28  SHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGKE 87
           S R L+GFV++ LG+DPPP P +P   NRF+PW+ SP   +RERAARIK  AKCPV+  +
Sbjct: 23  SKRNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPCDDLRERAARIKTMAKCPVSNLD 82

Query: 88  IRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQA 147
           I +TCP+SGIPTH+S++ WE DTNYHKN I + L+KVNIYEHDLRSGRPFPEFDFP EQ 
Sbjct: 83  INYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDFPREQE 142

Query: 148 RDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPVT 207
            D+ +N+ NWDL+FYTR F+SMDTEFQLA VTKMLSYP+TI S+L+++SPY+L PKGPVT
Sbjct: 143 YDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTPKGPVT 202

Query: 208 LEGLKSLAALRYTLRNNAF--------------ATTKTRPMRIFILGARAESQLPIHIWK 253
           LEGLKSLAALRYTL NN+               AT+K RPMRIFILGARAE+QLP H+WK
Sbjct: 203 LEGLKSLAALRYTLNNNSLSDTSSGNSDSTTITATSKNRPMRIFILGARAEAQLPPHVWK 262

Query: 254 QLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKFHKAQ 313
           QLQ+LFP   FEI+FIGPE  L +  S+Y++S + I KR+D+S++L Y+ DYF  +HKAQ
Sbjct: 263 QLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTDYFHVYHKAQ 322

Query: 314 DFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSV 373
           DF+PYDPY DIFF FHPG A+  + +TW+ +TM+ LLD+KC IF TGF + DI  DI+ +
Sbjct: 323 DFYPYDPYFDIFFMFHPGLAA--TKETWLNETMQGLLDSKCPIFMTGFHEKDITADISVL 380

Query: 374 QDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVKA 427
              + +++D+LM P+KNVFGSTKWELND NPQ+VYQFNMYIAG+RGKRYH  + 
Sbjct: 381 NKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYHATET 434

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/400 (64%), Positives = 319/400 (79%), Gaps = 2/400 (0%)

Query: 30  RTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGKEIR 89
           R ++GFV+NALG+DPP  P EP   NRF+ W++SPSP +RERAARI+A A+CPVTGK+IR
Sbjct: 29  RPIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDLRERAARIRALARCPVTGKDIR 88

Query: 90  FTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQARD 149
           ++C  SGIPTH+S+EAWE D  YH++K +  LRKVN+YEHDLRSGRPF EFDFP EQ RD
Sbjct: 89  YSCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRD 148

Query: 150 STVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPVTLE 209
             VNM NWDLF YTRQFYSMDT+FQLA VTKMLSYPITIGS+L+++SPY L P+GP+TLE
Sbjct: 149 RMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLE 208

Query: 210 GLKSLAALRYTL--RNNAFATTKTRPMRIFILGARAESQLPIHIWKQLQFLFPAQAFEIN 267
           GLKSLAALRYTL   + +    +++PMRIFILGARAE+QLP H+WKQLQ+LFP    EI+
Sbjct: 209 GLKSLAALRYTLYPESESARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIH 268

Query: 268 FIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKFHKAQDFFPYDPYNDIFFT 327
           FIGPE     Q   Y+ S + + KRVD +L L ++ DY   FH+AQDFFPYDPYND+FF 
Sbjct: 269 FIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFFC 328

Query: 328 FHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQDTYGEEVDMLMNP 387
           FHPGFAS E   +WM  T+ ALL+TKCAIF TGF +DD+  D  +++ ++  E+D+LM+P
Sbjct: 329 FHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMHP 388

Query: 388 IKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVKA 427
            KN+FGSTKWELND+NP +VYQFNMYIAGFRGKRYH ++ 
Sbjct: 389 TKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428

>NCAS0D00190 Chr4 complement(16895..19240) [2346 bp, 781 aa] {ON}
           Anc_2.30 YDL234C
          Length = 781

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 44/106 (41%), Gaps = 6/106 (5%)

Query: 52  VFANRFYPWDESPSPAIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTN 111
           +F    YPWD S    ++   +  ++ +   +   +  F     G      KE W++   
Sbjct: 418 LFLFNVYPWDSSKDERLQILESLQESYSNLKMVSMKASF-----GEDNSEEKEYWDDQIF 472

Query: 112 YHKNKIYEKLRKVNIYEHDLRSGR-PFPEFDFPGEQARDSTVNMTN 156
             +  +    R V+IY+++   G+ P  E   P E+  DS ++  N
Sbjct: 473 RIEKDVKRNDRNVDIYQYNTTDGKQPLSEPTEPSEEGTDSEMDANN 518

>KNAG0E02880 Chr5 (581192..583351) [2160 bp, 719 aa] {ON} Anc_2.30
           YDL234C
          Length = 719

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 59/151 (39%), Gaps = 15/151 (9%)

Query: 10  TQLSLHPVSLFAIDSRISSHRTLVGFVKNAL---GIDPPPLPTEPVFANRFYPWDESPSP 66
           T  +L   SLF +  R+S     VG VK+ +   G+ P       +F    YPWD S   
Sbjct: 331 TLTALKWRSLFDLQGRLS---VTVGEVKDFIFHGGVAPEIRSEVWLFLLGVYPWDSS--- 384

Query: 67  AIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNI 126
               R  R++       +  E++        P  Y  E WE+     +  +    R + +
Sbjct: 385 ----RDERVQISETLRQSYLELKNEWVFR-TPESYDTEYWEDQVFRIEKDVLRNDRDIPL 439

Query: 127 YEHDLRSGRPFPEFDFPGEQARDSTVNMTNW 157
           Y+H+   G+   E D   +Q  +     ++W
Sbjct: 440 YKHNTGDGQTASE-DASEDQELEEAGARSHW 469

>TDEL0F00400 Chr6 (63515..64486) [972 bp, 323 aa] {ON} Anc_1.521
           YJR070C
          Length = 323

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/93 (20%), Positives = 40/93 (43%), Gaps = 8/93 (8%)

Query: 304 DYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQ 363
           D+   F ++ D    +   DI           +S K+ + +  +AL + KC         
Sbjct: 4   DFERHFQESVDDCSLEQLRDILVN--------KSGKSELANRFRALFNLKCVAEEFETKP 55

Query: 364 DDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTK 396
           +D  K +  + + +G++ ++L + +  V G TK
Sbjct: 56  EDAKKAVDYIAEAFGDKSELLKHEVAYVLGQTK 88

>KAFR0C03210 Chr3 (647217..653612) [6396 bp, 2131 aa] {ON} Anc_8.69
            YFL007W
          Length = 2131

 Score = 30.8 bits (68), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 56/118 (47%), Gaps = 12/118 (10%)

Query: 87   EIRFTCPLSGIPTHYSKEA-WENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPE-----F 140
            ++R   P   I ++ S ++  ++D+  H+      LR +++   D R+  P        F
Sbjct: 1723 DVRRCPPFIEIISNISNQSDLKSDSVNHQASRLLMLRNLSV-SQDFRTYHPMEIAEHLIF 1781

Query: 141  DFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPY 198
            D P +Q RD+T  + N  +   T  + S++T  +L      LS    +G+IL + +PY
Sbjct: 1782 DHPYDQMRDATAKLFN--ILVQTESYLSVETPEELLL---SLSRESDLGNILKRVAPY 1834

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,352,831
Number of extensions: 2207573
Number of successful extensions: 5423
Number of sequences better than 10.0: 32
Number of HSP's gapped: 5508
Number of HSP's successfully gapped: 32
Length of query: 427
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 315
Effective length of database: 40,638,807
Effective search space: 12801224205
Effective search space used: 12801224205
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)