Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0A141107.343ON75375338810.0
NDAI0A019407.343ON76572527520.0
CAGL0I03410g7.343ON72472526950.0
TDEL0C020407.343ON70563426880.0
Smik_4.747.343ON84573726830.0
Suva_4.827.343ON75574226750.0
Skud_4.937.343ON75577326730.0
YDL164C (CDC9)7.343ON75574126500.0
KNAG0C037407.343ON72773126390.0
ZYRO0F11572g7.343ON73173426280.0
KAFR0B008307.343ON71063725550.0
Kpol_2001.717.343ON72676625380.0
SAKL0F10912g7.343ON69362225210.0
Kwal_56.246167.343ON71572924270.0
KLTH0H01408g7.343ON72373423960.0
KLLA0D12496g7.343ON70064523040.0
TPHA0D045707.343ON73674722640.0
ACL155W7.343ON69773522320.0
TBLA0E020507.343ON72061422000.0
ACR008W6.18ON9814052423e-20
KLLA0D01089g6.18ON9073802353e-19
TBLA0G010406.18ON9722672344e-19
ZYRO0C07854g6.18ON9444012335e-19
TDEL0G045106.18ON9694142326e-19
Smik_15.1746.18ON9452832317e-19
TPHA0M002606.18ON9664292282e-18
NCAS0D026506.18ON9502822245e-18
YOR005C (DNL4)6.18ON9442682229e-18
KLTH0C11286g6.18ON9513902183e-17
KNAG0F028706.18ON9542402173e-17
Kwal_56.224146.18ON9633982156e-17
CAGL0E02695g6.18ON9464182131e-16
KAFR0A050506.18ON9482562093e-16
Skud_15.1666.18ON9472682084e-16
Suva_15.1806.18ON9484542076e-16
NDAI0I022606.18ON9672791987e-15
Kpol_1032.76.18ON9652471881e-13
Ecym_12443.483ON57398742.9
Kwal_23.50498.69ON2141109709.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0A14110
         (753 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...  1499   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...  1064   0.0  
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...  1042   0.0  
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...  1040   0.0  
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...  1038   0.0  
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...  1035   0.0  
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...  1034   0.0  
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...  1025   0.0  
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...  1021   0.0  
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...  1016   0.0  
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   988   0.0  
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   982   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   975   0.0  
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   939   0.0  
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   927   0.0  
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   892   0.0  
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   876   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   864   0.0  
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   852   0.0  
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...    98   3e-20
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...    95   3e-19
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...    95   4e-19
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...    94   5e-19
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...    94   6e-19
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...    94   7e-19
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...    92   2e-18
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...    91   5e-18
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...    90   9e-18
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...    89   3e-17
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...    88   3e-17
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...    87   6e-17
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...    87   1e-16
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...    85   3e-16
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...    85   4e-16
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...    84   6e-16
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...    81   7e-15
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...    77   1e-13
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...    33   2.9  
Kwal_23.5049 s23 (982874..989299) [6426 bp, 2141 aa] {ON} YFL007...    32   9.9  

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 1499 bits (3881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 730/753 (96%), Positives = 730/753 (96%)

Query: 1   MLRSILAGKKPFIIPKSIMSSPAGFPKKQKQATLAKFFSSMKNEKPADKKDPEDSTTTTT 60
           MLRSILAGKKPFIIPKSIMSSPAGFPKKQKQATLAKFFSSMKNEKPADKKDPEDSTTTTT
Sbjct: 1   MLRSILAGKKPFIIPKSIMSSPAGFPKKQKQATLAKFFSSMKNEKPADKKDPEDSTTTTT 60

Query: 61  EKPSLSPYTANSKKTFEEILNRPASNLASSSQGVSDIASTPSIPNISTDESTGPDLKKQK 120
           EKPSLSPYTANSKKTFEEILNRPASNLASSSQGVSDIASTPSIPNISTDESTGPDLKKQK
Sbjct: 61  EKPSLSPYTANSKKTFEEILNRPASNLASSSQGVSDIASTPSIPNISTDESTGPDLKKQK 120

Query: 121 LEESNLEPSKEPTIENVTQDSTKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIK 180
           LEESNLEPSKEPTIENVTQDSTKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIK
Sbjct: 121 LEESNLEPSKEPTIENVTQDSTKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIK 180

Query: 181 IMKENPQNLIPVTYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKSLAQVRNKYRELG 240
           IMKENPQNLIPVTYLFINKLGPDYEP           MKTISESCGKSLAQVRNKYRELG
Sbjct: 181 IMKENPQNLIPVTYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSLAQVRNKYRELG 240

Query: 241 DLGQIAMDARNVQPTMFKPKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGT 300
           DLGQIAMDARNVQPTMFKPKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGT
Sbjct: 241 DLGQIAMDARNVQPTMFKPKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGT 300

Query: 301 EAKFLIRSLESKLRIGLAEKTVLISLSKALLVHECKDNKDFDMELLETAEQKIRDAFCQV 360
           EAKFLIRSLESKLRIGLAEKTVLISLSKALLVHECKDNKDFDMELLETAEQKIRDAFCQV
Sbjct: 301 EAKFLIRSLESKLRIGLAEKTVLISLSKALLVHECKDNKDFDMELLETAEQKIRDAFCQV 360

Query: 361 PNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYD 420
           PNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYD
Sbjct: 361 PNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYD 420

Query: 421 GERAQVHLLSDGTMRIYSRNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQN 480
           GERAQVHLLSDGTMRIYSRNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQN
Sbjct: 421 GERAQVHLLSDGTMRIYSRNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQN 480

Query: 481 KILPFQVLSTRKRXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVT 540
           KILPFQVLSTRKR            CLFAFDILCHNDEKLINKSLRERRQILQEVTKSVT
Sbjct: 481 KILPFQVLSTRKRKDVDLKDVKVKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVT 540

Query: 541 GEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDY 600
           GEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDY
Sbjct: 541 GEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDY 600

Query: 601 LEGIGDSLDLCVIGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLY 660
           LEGIGDSLDLCVIGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLY
Sbjct: 601 LEGIGDSLDLCVIGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLY 660

Query: 661 TRLTPTVLDGPKATFVYDSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLR 720
           TRLTPTVLDGPKATFVYDSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLR
Sbjct: 661 TRLTPTVLDGPKATFVYDSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLR 720

Query: 721 FPRFIRTREDKGVEDATSSEQIIELYENQAHTQ 753
           FPRFIRTREDKGVEDATSSEQIIELYENQAHTQ
Sbjct: 721 FPRFIRTREDKGVEDATSSEQIIELYENQAHTQ 753

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score = 1064 bits (2752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/725 (73%), Positives = 585/725 (80%), Gaps = 11/725 (1%)

Query: 28  KQKQATLAKFFSSMKNEKPADKKDPEDSTTTTTEKPSLSPYTANSKKTFEEILNRPASNL 87
           +++QATL +FFSS+ ++KP         T  T  K      T    K   + + R    L
Sbjct: 48  RKQQATLGRFFSSINHKKP---------TKDTALKNESKEETKEENKDDSDSIPRKKIRL 98

Query: 88  ASSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKEPTIENVTQDSTKPYFS 147
           ++SS   S +A +     I  +              +      + T++  T  S KP+  
Sbjct: 99  STSSSSPSIMAESKPKSPIKLNTERSSSPASASASTTPTPIVADHTLDPKTAVS-KPFLC 157

Query: 148 SIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFINKLGPDYEPX 207
           +IPY+EVC LFQEIE+TSSRL+IIKLCSDF IKIMK++PQNLIPVTYLFINKLGPDYEP 
Sbjct: 158 AIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPG 217

Query: 208 XXXXXXXXXXMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMFKPKPLTVGEV 267
                     MKTISESCGKSL Q+R +YRELGDLGQIA++ARNVQPTMFKPKPLTVGEV
Sbjct: 218 LELGLGEGLLMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEV 277

Query: 268 FENLRLIAKSEGKDSQTRKIKLIKRMLTACE-GTEAKFLIRSLESKLRIGLAEKTVLISL 326
           F NL++IAK+ GKDSQT+KIKLIKRMLTACE G EAKFLIRSLESKLRIGLAEKTVLISL
Sbjct: 278 FNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISL 337

Query: 327 SKALLVHECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIMELETHCSLRP 386
           SKALLV E   NKDFDMELLETAE KIRDAFCQVPNYEIVINSCL+YGIM L  HCSLRP
Sbjct: 338 SKALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRP 397

Query: 387 GIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIYSRNGENMTE 446
           GIPLKPMLAKPTKAINEILDRFQGE FTSEYKYDGERAQVHLL DGTMRIYSRNGENMTE
Sbjct: 398 GIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTE 457

Query: 447 RYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRXXXXXXXXXXXXC 506
           RYPEIHI DF+ D   T TLILDCEAVAWD EQ KILPFQVLSTRKR            C
Sbjct: 458 RYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVRVC 517

Query: 507 LFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLDQSVH 566
           LFAFDILCHN  KLIN SL+ERR+IL  VT    GEFQYATE+T+SNLDELQKFLDQSV+
Sbjct: 518 LFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVN 577

Query: 567 DSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGKRTGMY 626
           DSCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCV+GAYYGRGKRTG Y
Sbjct: 578 DSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRTGTY 637

Query: 627 GGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVYDSSAEPDVW 686
           GGFLLGCYN +TGEFETCCKIGTGFSDEMLQQL+ +L  TV+DGPKAT++YDSSAEPDVW
Sbjct: 638 GGFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEPDVW 697

Query: 687 FEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATSSEQIIELY 746
           FEP+LLFEVLTADLSLSPIYKAGSS YDKG+SLRFPRFIR REDKGVEDATSSEQIIELY
Sbjct: 698 FEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELY 757

Query: 747 ENQAH 751
           ENQ+H
Sbjct: 758 ENQSH 762

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score = 1042 bits (2695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/725 (69%), Positives = 586/725 (80%), Gaps = 31/725 (4%)

Query: 29  QKQATLAKFFSSMKNEKPADKKDPEDSTTTTTEKPSLSPYTANSKKTFEEILNRPASNLA 88
           ++QATLA+FFSS+K +   DKK  +    T     +     AN K   +++      +L 
Sbjct: 28  KRQATLARFFSSVKKDADGDKKGEQADVKTAAVDLNSHEVDAN-KSPLKKMKLESTGSLT 86

Query: 89  SSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKEPTIENVTQDSTKPYFSS 148
           ++  G                         Q  EE    P     I +  +     +F  
Sbjct: 87  ATKNG------------------------NQGKEEHEGTP-----IASTPRQVDSKFFCK 117

Query: 149 IPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFINKLGPDYEPXX 208
           +PY ++CNLF+EIE TSSRLAIIKLCSDFFIKIMKE+PQNLIPVTYLFINKLGPDYEP  
Sbjct: 118 VPYSDLCNLFEEIEGTSSRLAIIKLCSDFFIKIMKEDPQNLIPVTYLFINKLGPDYEPGL 177

Query: 209 XXXXXXXXXMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMFKPKPLTVGEVF 268
                    MKTISESCGKS+ Q++N+YRE+GDLGQIA++ARNVQPTMFKPKPL VGEVF
Sbjct: 178 ELGLGENLLMKTISESCGKSMQQIKNQYREIGDLGQIALEARNVQPTMFKPKPLVVGEVF 237

Query: 269 ENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGLAEKTVLISLSK 328
           ENL+ IAKS+GKDSQT+K+KLIKRMLTAC+GTEAKFLIRSLESKLRIGLAEKTVLI+LSK
Sbjct: 238 ENLKTIAKSQGKDSQTKKMKLIKRMLTACQGTEAKFLIRSLESKLRIGLAEKTVLIALSK 297

Query: 329 ALLVHECK-DNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIMELETHCSLRPG 387
           ALL+H+ K  NK+  M+++E AEQKIRDAFCQVPNYE+VIN+CL YGIM+L+ HC+++PG
Sbjct: 298 ALLIHDEKYSNKEPSMDVVEQAEQKIRDAFCQVPNYELVINACLDYGIMKLDEHCTIQPG 357

Query: 388 IPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIYSRNGENMTER 447
           IPLKPMLAKPTKAINE+LDRFQG+ FTSEYKYDGERAQVHLL DGTMRIYSRNGENMTER
Sbjct: 358 IPLKPMLAKPTKAINEVLDRFQGQTFTSEYKYDGERAQVHLLKDGTMRIYSRNGENMTER 417

Query: 448 YPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRXXXXXXXXXXXXCL 507
           YPEI I+DF+ADP  T++LILDCEAVAWD EQNKILPFQVL+TRKR            CL
Sbjct: 418 YPEIQIKDFLADPASTTSLILDCEAVAWDKEQNKILPFQVLTTRKRKDVNINEVKVRVCL 477

Query: 508 FAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLDQSVHD 567
           FAFDIL HND +LIN+ L +RR++L EVTK V GEFQYAT+MT+SNLDELQKFLD+SV +
Sbjct: 478 FAFDILLHNDMRLINEPLSKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKN 537

Query: 568 SCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGKRTGMYG 627
           SCEGLMVKM+DG+ES+YEPSKRSRNWLKLKKDYLEG+GDSLDLCV+GAY+GRGKRTG YG
Sbjct: 538 SCEGLMVKMMDGVESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYG 597

Query: 628 GFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVYDSSAEPDVWF 687
           GFLLGCYN D+ +FETCCKIGTGFS+EMLQ LY +L+PTV+DGPK T+V+DSSAEPDVWF
Sbjct: 598 GFLLGCYNADSEDFETCCKIGTGFSEEMLQTLYEKLSPTVIDGPKGTYVFDSSAEPDVWF 657

Query: 688 EPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATSSEQIIELYE 747
           EPT+LFEVLTADLSLSPIYKAGSS YDKGISLRFPRF+R R+DK VEDATSSEQIIE+Y+
Sbjct: 658 EPTMLFEVLTADLSLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSVEDATSSEQIIEMYQ 717

Query: 748 NQAHT 752
           NQ+H 
Sbjct: 718 NQSHV 722

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score = 1040 bits (2688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/634 (77%), Positives = 549/634 (86%), Gaps = 1/634 (0%)

Query: 120 KLEESNLEPSKEPTIENVTQD-STKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFF 178
           KL+ S+L P K   +E+  +  S   Y+S +PY +VCN+FQEIE TSSRL+IIK+CS+FF
Sbjct: 71  KLQTSSLSPVKSAGVESGDKPVSPDLYYSKVPYSDVCNVFQEIEGTSSRLSIIKICSEFF 130

Query: 179 IKIMKENPQNLIPVTYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKSLAQVRNKYRE 238
            +IMK+NPQNLIP TYLFIN+LGPDYEP           MKTISE+CGKSL QV+N+YRE
Sbjct: 131 SRIMKDNPQNLIPTTYLFINRLGPDYEPGLELGLGEGLLMKTISEACGKSLVQVKNRYRE 190

Query: 239 LGDLGQIAMDARNVQPTMFKPKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACE 298
           +GDLGQIA++ARNVQPTMFKPKPLTVGEVFENLR IA S+GKDSQTRKIKLIKRMLTACE
Sbjct: 191 MGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKDSQTRKIKLIKRMLTACE 250

Query: 299 GTEAKFLIRSLESKLRIGLAEKTVLISLSKALLVHECKDNKDFDMELLETAEQKIRDAFC 358
           G EAKFLIRSLESKLRIGLAEKTVLISLSKALL +E +  K+  MEL+E AE KIRDAFC
Sbjct: 251 GVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGETGKEPSMELVEQAEAKIRDAFC 310

Query: 359 QVPNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYK 418
           QVPNYEIVIN+CL YGIMEL+ HC LRPGIPLKPMLAKPTK+I E+LDRFQG+ FTSEYK
Sbjct: 311 QVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTFTSEYK 370

Query: 419 YDGERAQVHLLSDGTMRIYSRNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNE 478
           YDGERAQVHLL DGTMRIYSRNGENMTERYPEI IRDF+AD   T TLILDCEAVAWD  
Sbjct: 371 YDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFVADLEHTKTLILDCEAVAWDKV 430

Query: 479 QNKILPFQVLSTRKRXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERRQILQEVTKS 538
           Q KILPFQVLSTRKR            CLFAFDI+CHN E+ INKSLRERR++L +VTK 
Sbjct: 431 QQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGERQINKSLRERRELLAQVTKP 490

Query: 539 VTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKK 598
           V GEFQYA E+T+S+++ELQKFLDQSV DSCEGLMVKMLDG ESHYEPSKRSRNWLKLKK
Sbjct: 491 VAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKK 550

Query: 599 DYLEGIGDSLDLCVIGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQ 658
           DYL+G+GDSLDLCV+GAYYGRGKRTG YGGFLLGCYNQD+GEFETCCKIGTGFSDEMLQQ
Sbjct: 551 DYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSGEFETCCKIGTGFSDEMLQQ 610

Query: 659 LYTRLTPTVLDGPKATFVYDSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGIS 718
           LY R + T LDGPKAT+V+DSSAEPDVWFEPT LFEVLTADLSLSP+YKAG+STYDKG+S
Sbjct: 611 LYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPVYKAGASTYDKGVS 670

Query: 719 LRFPRFIRTREDKGVEDATSSEQIIELYENQAHT 752
           LRFPRF+R R+DK VEDATSS QI+ELY++Q+H 
Sbjct: 671 LRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHV 704

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score = 1038 bits (2683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/737 (70%), Positives = 598/737 (81%), Gaps = 25/737 (3%)

Query: 27  KKQKQATLAKFFSSMKNEKPADKKDPEDSTTTTTEKPSL----SPYTANSKKTFEEILNR 82
           KK KQATLA+FF+SMKN KP+    P D +     + S+    S    N KK+      +
Sbjct: 123 KKPKQATLARFFTSMKN-KPSGNTSPPDKSAKHMLQDSVDDDSSVGVRNVKKS-----QQ 176

Query: 83  PASNLASSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKEPTIENVTQDS- 141
            A   A++ Q    ++S PS    S   S+G DL  QK +         P +E+   +S 
Sbjct: 177 VAVAQAATVQPF--MSSFPSSLPSSAPSSSGADLS-QKFQGLG------PKVEDFEMNSN 227

Query: 142 -TKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFINKL 200
            +  Y S+IPY +VC +F +IE+ SSRL II++CSDFFIK+MK++ +NLIP TYLFIN+L
Sbjct: 228 DSDHYSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRL 287

Query: 201 GPDYEPXXXXXXXXXXXMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMFKPK 260
           GPDYE            MKTISESCGKS++Q++ KY+E+GDLG+IAM ARNVQPTMFKPK
Sbjct: 288 GPDYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPK 347

Query: 261 PLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGLAEK 320
           PLTVGEVF+NLR IAK++GKDSQ RKIKLIKRMLTAC+G EAKFLIRSLESKLRIGLAEK
Sbjct: 348 PLTVGEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEK 407

Query: 321 TVLISLSKALLVH----ECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIM 376
           TVLISLSKALL+H    E   +KD  M++LE+A+QKIRDAFCQVPNYEIVINSCL++GIM
Sbjct: 408 TVLISLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIM 467

Query: 377 ELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRI 436
            L+ +C+LRPGIPLKPMLAKPTKAINE+LDRFQGE FTSEYKYDGERAQVHLL+DGTMRI
Sbjct: 468 NLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRI 527

Query: 437 YSRNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRXXX 496
           YSRNGENMTERYPEI I DFI D  +T  LILDCEAVAWD +Q KILPFQVLSTRKR   
Sbjct: 528 YSRNGENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDV 587

Query: 497 XXXXXXXXXCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDE 556
                    CLFAFDILCHNDE+LIN SLRERR+ L +VTK V GEFQYAT++ ++NLDE
Sbjct: 588 ELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDE 647

Query: 557 LQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAY 616
           LQKFLD+SV+ SCEGLMVKMLDG ESHYEPSKRSRNWLKLKKDYLEG+GDSLDLCV+GAY
Sbjct: 648 LQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAY 707

Query: 617 YGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFV 676
           YGRGKRTG YGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQ L+ RLTPT++DGPKAT+V
Sbjct: 708 YGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYV 767

Query: 677 YDSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDA 736
           +DSSAEPDVWFEPT LFEVLTADLSLSPIYKAGS+T+DKG+SLRFPRF+R REDKGVEDA
Sbjct: 768 FDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDA 827

Query: 737 TSSEQIIELYENQAHTQ 753
           TSS+QI+ELYENQ+H Q
Sbjct: 828 TSSDQIVELYENQSHVQ 844

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 1035 bits (2675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/742 (69%), Positives = 589/742 (79%), Gaps = 22/742 (2%)

Query: 20  SSPAGFPKKQKQATLAKFFSSMKNEKPADKKDPEDSTTTTTEKPS--LSPYTANSKKTFE 77
           S P+   KK KQATLA+FF+SMKN+       PE +     E  +  +S   A++ K  +
Sbjct: 27  SLPSSAGKKPKQATLARFFTSMKNKPSGGSSSPEKAVKHKIENGTNEISSEGASAIKKLK 86

Query: 78  EI--LNRPASNLASSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKEPTIE 135
            +  +  P           SD++S+ S    S   S+G D  ++  E   L P  E    
Sbjct: 87  HLSAVQTPVEQ--------SDMSSSSSPLPSSAPSSSGVDASQKSRE---LTPKVEEEQG 135

Query: 136 NVTQDSTKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYL 195
            +  D    Y S+IPY EVC +F EIE+ SSRL II++CSDFFIKIMK++ +NLIP TYL
Sbjct: 136 PIDNDH---YSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYL 192

Query: 196 FINKLGPDYEPXXXXXXXXXXXMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPT 255
           FIN+LGPDYEP           MKTISESCGKS+ Q++ KY+E+GDLG+IAM ARNVQPT
Sbjct: 193 FINRLGPDYEPGLELGLGENLLMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPT 252

Query: 256 MFKPKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRI 315
           MFKPKPLTVGEVF+NLR IAK++GKDSQ RK+KLIKRMLTAC+G EAKFLIRSLESKLRI
Sbjct: 253 MFKPKPLTVGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRI 312

Query: 316 GLAEKTVLISLSKALLVH----ECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCL 371
           GLAEKTVLISLSKALL+H    E     D  M++LE+A+QKIRDAFCQVPNYEIVINSCL
Sbjct: 313 GLAEKTVLISLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCL 372

Query: 372 KYGIMELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSD 431
           ++GIM L+  C+L+PGIPLKPMLAKPTKAINE+LDRFQGE FTSEYKYDGERAQVHLL D
Sbjct: 373 EHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDD 432

Query: 432 GTMRIYSRNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTR 491
           GTMRIYSRNGENMTERYPEI I DFI D   T  LILDCEAVAWD EQ KILPFQVLSTR
Sbjct: 433 GTMRIYSRNGENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTR 492

Query: 492 KRXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTS 551
           KR            CLFAFD+LCHN E+LINKSLRERR+ L +VTK V GEFQYAT++ +
Sbjct: 493 KRKDVELSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVT 552

Query: 552 SNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLC 611
            NLDELQKFLD+SV+ SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYLEG+GDSLDLC
Sbjct: 553 DNLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLC 612

Query: 612 VIGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGP 671
           V+GAYYGRGKRTG YGGFLLGCYNQDTGEFETCCKIGTGFSDE LQQL+ RLTPT++DGP
Sbjct: 613 VLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGP 672

Query: 672 KATFVYDSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDK 731
           KATFV+DSSAEPDVWFEPT LFEVLTADLSLSPIYKAGS+T+ KG+SLRFPRF+R REDK
Sbjct: 673 KATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDK 732

Query: 732 GVEDATSSEQIIELYENQAHTQ 753
           GVEDATSSEQI+ELYENQ+H Q
Sbjct: 733 GVEDATSSEQIVELYENQSHVQ 754

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 1034 bits (2673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/773 (67%), Positives = 609/773 (78%), Gaps = 40/773 (5%)

Query: 2   LRSILAG-----------KKPFIIPKSIMSSPAGFPKKQKQATLAKFFSSMKNEKPADKK 50
           +R +LAG           +   ++P S+ SS AG  KK KQATLA+FFSSMKNE      
Sbjct: 1   MRRLLAGLLFSPARSLNPRLSLLMPPSLPSS-AG--KKPKQATLARFFSSMKNEPSGSSS 57

Query: 51  DPEDSTTTTTEKPSLSPYTANSKKTFEEILNRPASNLASSSQGVSDIASTPSIPNISTDE 110
            PE +                 K   E  ++  +S  A +++ +  +++  ++   ST  
Sbjct: 58  SPEKA----------------PKHKLENNIDNNSSEGADATKKLKQVSTVQTLVAPSTMG 101

Query: 111 STGPDLKKQKLEESNLEPSKE-----PTIENVTQDSTKPYFSS-IPYREVCNLFQEIEST 164
           S+   L       S ++ S+E     P +E     +   ++SS IPY EVC +F +IE+ 
Sbjct: 102 SSPFSLPSSAPSSSGVDVSQESREFTPQVEKEPSSNDNDHYSSNIPYSEVCEVFNKIEAI 161

Query: 165 SSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFINKLGPDYEPXXXXXXXXXXXMKTISES 224
           SSRL II++CSDFFIKIM ++ +NLIP TYLFIN+LGPDYE            MKTISES
Sbjct: 162 SSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISES 221

Query: 225 CGKSLAQVRNKYRELGDLGQIAMDARNVQPTMFKPKPLTVGEVFENLRLIAKSEGKDSQT 284
           CGKS++Q++ KY+E+GDLG+IAM ARNVQPTMFKPK LTVGEVF+NLR IAK++GKDSQ 
Sbjct: 222 CGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTVGEVFKNLRTIAKTQGKDSQL 281

Query: 285 RKIKLIKRMLTACEGTEAKFLIRSLESKLRIGLAEKTVLISLSKALLVH-ECKDN---KD 340
           RK+KLIKRMLTAC+G EAKFLIRSLESKLRIGLAEKTVLISLSKALL+H E K+N   K+
Sbjct: 282 RKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENKENSPDKE 341

Query: 341 FDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKA 400
             M++LE+A+Q+IRDAFCQVPNYEIVINSCL +GIM L+ +C+LRPGIPLKPMLAKPTKA
Sbjct: 342 IPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKA 401

Query: 401 INEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIYSRNGENMTERYPEIHIRDFIADP 460
           INE+LDRFQGE FTSEYKYDGERAQVHLL+DGTMRIYSRNGENMTERYPEI I DFI D 
Sbjct: 402 INEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDL 461

Query: 461 LVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRXXXXXXXXXXXXCLFAFDILCHNDEKL 520
             T  LILDCEAVAWD EQ KILPFQ+LSTRKR            CLFAFDILC+NDE+L
Sbjct: 462 NSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDVKVKVCLFAFDILCYNDERL 521

Query: 521 INKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDGI 580
           INKSLRERR+ L +VTK V GEFQYAT++ ++NLDELQKFLD+SV++SCEGLMVKMLDG 
Sbjct: 522 INKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGP 581

Query: 581 ESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGKRTGMYGGFLLGCYNQDTGE 640
           ESHYEPSKRSRNWLKLKKDYLEG+GDSLDLCV+GAYYGRGKRTG YGGFLLGCYNQDTGE
Sbjct: 582 ESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGE 641

Query: 641 FETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVYDSSAEPDVWFEPTLLFEVLTADL 700
           FETCCKIGTGFSDEMLQ L+ RLTPT++DGPKATFV+D+SAEPDVWFEPT LFEVLTADL
Sbjct: 642 FETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDASAEPDVWFEPTTLFEVLTADL 701

Query: 701 SLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATSSEQIIELYENQAHTQ 753
           SLSPIYKAGS+T+DKG+SLRFPRF+R REDKGVEDATSS+QIIELYENQ+H Q
Sbjct: 702 SLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIIELYENQSHVQ 754

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score = 1025 bits (2650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/741 (68%), Positives = 591/741 (79%), Gaps = 34/741 (4%)

Query: 27  KKQKQATLAKFFSSMKNEKPADKKDPEDSTTTTTEKPSLSPYTANSKKTFEEILNRPASN 86
           KK KQATLA+FF+SMKN KP +                    T + KK+ + +L     N
Sbjct: 34  KKPKQATLARFFTSMKN-KPTEG-------------------TPSPKKSSKHMLEDRMDN 73

Query: 87  LASSSQ-GVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKEPT--------IEN- 136
           ++   +     +  T     ++   S G +         +   +  P         +E+ 
Sbjct: 74  VSGEEEYATKKLKQTAVTHTVAAPSSMGSNFSSIPSSAPSSGVADSPQQSQRLVGEVEDA 133

Query: 137 VTQDSTKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLF 196
           ++ ++   Y S+IPY EVC +F +IE+ SSRL II++CSDFFIKIMK++ +NLIP TYLF
Sbjct: 134 LSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLF 193

Query: 197 INKLGPDYEPXXXXXXXXXXXMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTM 256
           IN+LGPDYE            MKTISE+CGKS++Q++ KY+++GDLG+IAM ARNVQPTM
Sbjct: 194 INRLGPDYEAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTM 253

Query: 257 FKPKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIG 316
           FKPKPLTVGEVF+NLR IAK++GKDSQ +K+KLIKRMLTAC+G EAKFLIRSLESKLRIG
Sbjct: 254 FKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIG 313

Query: 317 LAEKTVLISLSKALLVH----ECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLK 372
           LAEKTVLISLSKALL+H    E   +KD  M++LE+A+QKIRDAFCQVPNYEIVINSCL+
Sbjct: 314 LAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLE 373

Query: 373 YGIMELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDG 432
           +GIM L+ +C+LRPGIPLKPMLAKPTKAINE+LDRFQGE FTSEYKYDGERAQVHLL+DG
Sbjct: 374 HGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG 433

Query: 433 TMRIYSRNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRK 492
           TMRIYSRNGENMTERYPEI+I DFI D   T  LILDCEAVAWD +Q KILPFQVLSTRK
Sbjct: 434 TMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRK 493

Query: 493 RXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSS 552
           R            CLFAFDILC+NDE+LINKSL+ERR+ L +VTK V GEFQYAT++T++
Sbjct: 494 RKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTN 553

Query: 553 NLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCV 612
           NLDELQKFLD+SV+ SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYLEG+GDSLDLCV
Sbjct: 554 NLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCV 613

Query: 613 IGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPK 672
           +GAYYGRGKRTG YGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQ L+ RLTPT++DGPK
Sbjct: 614 LGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPK 673

Query: 673 ATFVYDSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKG 732
           ATFV+DSSAEPDVWFEPT LFEVLTADLSLSPIYKAGS+T+DKG+SLRFPRF+R REDKG
Sbjct: 674 ATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKG 733

Query: 733 VEDATSSEQIIELYENQAHTQ 753
           VEDATSS+QI+ELYENQ+H Q
Sbjct: 734 VEDATSSDQIVELYENQSHMQ 754

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score = 1021 bits (2639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/731 (69%), Positives = 582/731 (79%), Gaps = 26/731 (3%)

Query: 26  PKKQKQATLAKFFSSMKNEKPADKKDPEDSTTTTTEKPSLSPYTANSKKTFEEILNRPAS 85
           PK ++Q TL  FF+S+K    +D   P  +T    EK              +E    PA+
Sbjct: 19  PKMKRQMTLNNFFTSVKK---SDTNTPASTTPKKMEK--------------DESPQIPAT 61

Query: 86  NLASSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEP--SKEPTIENVTQDSTK 143
             A       D+ + P I   S+ E +    +   L   +  P  SK+  I++   D TK
Sbjct: 62  KTAEEKHENMDVDTDPVI---SSSEVSAK--RNSPLTSPSPTPVVSKKIKIQDENND-TK 115

Query: 144 PYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFINKLGPD 203
            ++S++PY ++CNLFQEIE  SSRLAIIKLCS F I +MK +P+NLIP+TYLFINKLGPD
Sbjct: 116 EFYSTVPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPD 175

Query: 204 YEPXXXXXXXXXXXMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMFKPKPLT 263
           Y P           +KTI+ESCG+SL Q++ KY E+GDLGQIA++AR VQPTMFKPKPLT
Sbjct: 176 YMPGLELGLGENLLIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLT 235

Query: 264 VGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGLAEKTVL 323
           VGEVF+NL+ IA S+GKDSQT+KIKLIKRMLT+C+G EAKFLIRSLESKLRIGLAEKTVL
Sbjct: 236 VGEVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVL 295

Query: 324 ISLSKALLVHE-CKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIMELETHC 382
           ISLSKALLV+E  + +KD DME +E AEQKIRDAFCQVPNYE+VI+SCLK+GIM L+ HC
Sbjct: 296 ISLSKALLVYEYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHC 355

Query: 383 SLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIYSRNGE 442
           SLRP IPLKPMLAKPTK+I+EI DRFQ + FT EYKYDGERAQVHLL DGTMRIYSRNGE
Sbjct: 356 SLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGE 415

Query: 443 NMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRXXXXXXXXX 502
           NMTERYPEIHIRDF+ D   T +LILDCEAVAWD EQNKILPFQVLSTRKR         
Sbjct: 416 NMTERYPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIK 475

Query: 503 XXXCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLD 562
              CLFAFDIL HNDEKLINKSL+ERR IL  +TK VTGEFQ+ATEMT++NL+ELQ FLD
Sbjct: 476 VRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLD 535

Query: 563 QSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGKR 622
           QSV +SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYL G+GDSLDLCV+GAY+GRGKR
Sbjct: 536 QSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKR 595

Query: 623 TGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVYDSSAE 682
           TG YGGFLLGCYNQDTGEFET CKIGTGFSDE+LQQL+ RL  TV+D PKAT+V+D SAE
Sbjct: 596 TGNYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAE 655

Query: 683 PDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATSSEQI 742
           PDVWFEPTLLFEVLTADLSLSP+YKAGSSTYDKG+SLRFPRF+R REDKGVEDATSSEQI
Sbjct: 656 PDVWFEPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQI 715

Query: 743 IELYENQAHTQ 753
           +E+YENQA+ Q
Sbjct: 716 VEMYENQANLQ 726

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score = 1016 bits (2628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/734 (68%), Positives = 582/734 (79%), Gaps = 23/734 (3%)

Query: 19  MSSPAGFPKKQ-KQATLAKFFSSMKNEKPADKKDPEDSTTTTTEKPSLSPYTANSKKTFE 77
           M++ +  PKKQ KQATLAKFFSS+K+     KK+   +  TTT     SP  +NS +   
Sbjct: 18  MATSSSQPKKQAKQATLAKFFSSVKDRNSPTKKNATPAFPTTTNVKRESPVRSNSNE--- 74

Query: 78  EILNRPASNLASSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKEPTIENV 137
               + +S +   S G S   S+  +     +  + P  KK K+E  +   SK       
Sbjct: 75  ----KESSPMFDDSNGRSSACSSAGL-----EMESAPAPKKLKMESDSNSTSKN------ 119

Query: 138 TQDSTKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFI 197
            QD    +FS++PY +VCN+FQEIESTSSRL+IIK+CSDFF +I+KE+ +NL+P TYLFI
Sbjct: 120 NQDD---HFSTVPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFI 176

Query: 198 NKLGPDYEPXXXXXXXXXXXMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMF 257
           NKLGPDYEP           MKTISESCGKSLAQV+N+YRE+GDLGQIAM+ARNVQPTMF
Sbjct: 177 NKLGPDYEPGMELGLGEGLLMKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMF 236

Query: 258 KPKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGL 317
           KPKPLTVGEVF NLR IA ++GKDSQ +KIKLIKRMLTAC+G EAKFLIRSLESKLRIGL
Sbjct: 237 KPKPLTVGEVFVNLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGL 296

Query: 318 AEKTVLISLSKALLVHECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIME 377
           AEKTVLISLS ALL HE   + +   E ++ AEQ IRDAFCQVPNYEIVIN+CL++GI +
Sbjct: 297 AEKTVLISLSNALLRHEQGLDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQ 356

Query: 378 LETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIY 437
           L  HC L PGIPLKPMLAKPTKAI E+LDRFQG++F SEYKYDGERAQ+HLL DGTMRIY
Sbjct: 357 LHKHCQLTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIY 416

Query: 438 SRNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRXXXX 497
           SRNGENMTERYPEI IRDF++DP  T +LILDCEAVAWD EQ KILPFQVLSTRKR    
Sbjct: 417 SRNGENMTERYPEIDIRDFLSDP-STESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVD 475

Query: 498 XXXXXXXXCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDEL 557
                   CLFAFD+LCHN E LINKSLRER+  LQ+VTK V GEF+YA ++ ++N++EL
Sbjct: 476 AKDVKVRVCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEEL 535

Query: 558 QKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYY 617
           Q FLDQSV DSCEGLMVKMLDG ESHYEPSKRSRNWLKLKKDYL G+GDSLDLCV+GAYY
Sbjct: 536 QHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYY 595

Query: 618 GRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVY 677
           GRGKRTG YGGFLLGCYNQDTGE+ETCCKIGTGFS+E+LQQLY RL PT ++ P A +VY
Sbjct: 596 GRGKRTGTYGGFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVY 655

Query: 678 DSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDAT 737
           DS+ +PDVWFEPTLLFEVL ADLSLSP+YKAGS+ YDKGISLRFPRF+R R+DK VE+AT
Sbjct: 656 DSAQQPDVWFEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEAT 715

Query: 738 SSEQIIELYENQAH 751
           SSEQ+++LYE QAH
Sbjct: 716 SSEQVVDLYEAQAH 729

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score =  988 bits (2555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/637 (74%), Positives = 538/637 (84%), Gaps = 5/637 (0%)

Query: 116 LKKQKLEESNLEPSKEPTIENVTQDSTKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCS 175
           LKK KL  S +E SK  + E   +   + +   IPY +VC LFQEIE+ SSRL IIKLCS
Sbjct: 77  LKKPKL--SPIESSKTDSSETTVK---QEFVCDIPYADVCVLFQEIENISSRLQIIKLCS 131

Query: 176 DFFIKIMKENPQNLIPVTYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKSLAQVRNK 235
           +FF K MK+N  NLIP+TYLFINKLGPDYE            MKTISESCGKSL QV+  
Sbjct: 132 EFFTKAMKQNTANLIPLTYLFINKLGPDYEMGLELGLGENLLMKTISESCGKSLQQVKLD 191

Query: 236 YRELGDLGQIAMDARNVQPTMFKPKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLT 295
           Y+++GDLG IAM+ARNVQPTMFKPKPLTVG VF+NL+LIAKS GKDSQ +KI+LIK++LT
Sbjct: 192 YKDIGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQLKKIRLIKKLLT 251

Query: 296 ACEGTEAKFLIRSLESKLRIGLAEKTVLISLSKALLVHECKDNKDFDMELLETAEQKIRD 355
           AC+G EAK+LIRSLESKLRIGLAEK+VLISLSKALL++E  +  D DMEL+E AEQKIRD
Sbjct: 252 ACKGIEAKYLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELIEKAEQKIRD 311

Query: 356 AFCQVPNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTS 415
           AFCQ+PNYEIVINSCLKYGIM L+ HCSLRPGIPLKPMLAKPTK I E+ DRFQ   FTS
Sbjct: 312 AFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTS 371

Query: 416 EYKYDGERAQVHLLSDGTMRIYSRNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAW 475
           EYKYDGERAQVHL++DG+MRIYSRNGENMTERYPEI++ DFI D  +T +LI+DCEAVAW
Sbjct: 372 EYKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAW 431

Query: 476 DNEQNKILPFQVLSTRKRXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERRQILQEV 535
           D E+ KILPFQVLSTRKR            CLFAFDILCHNDEKLINKSLRERR+IL  V
Sbjct: 432 DREEKKILPFQVLSTRKRKDVDIKDIKVRICLFAFDILCHNDEKLINKSLRERREILHSV 491

Query: 536 TKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLK 595
           T+ V GEF YA E++++NLDELQ FLDQSV DSCEGLMVK+LDG +SHYEPSKRSRNWLK
Sbjct: 492 TREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLK 551

Query: 596 LKKDYLEGIGDSLDLCVIGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEM 655
           LKKDYL+G+GDSLDLCV+GA+YGRGKRTG YGGFLLGCYNQDTGEFET CKIGTGFSDE+
Sbjct: 552 LKKDYLDGVGDSLDLCVLGAFYGRGKRTGTYGGFLLGCYNQDTGEFETACKIGTGFSDEV 611

Query: 656 LQQLYTRLTPTVLDGPKATFVYDSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDK 715
           LQ LY RL  T +DGPKAT++YDSSA+PDVWFEPTLLFEVLTADLS+SPIYKAG+STY K
Sbjct: 612 LQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSK 671

Query: 716 GISLRFPRFIRTREDKGVEDATSSEQIIELYENQAHT 752
           GISLRFPRFIR REDK VE+ATSSEQIIELYENQ+H 
Sbjct: 672 GISLRFPRFIRLREDKSVEEATSSEQIIELYENQSHV 708

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  982 bits (2538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/766 (64%), Positives = 587/766 (76%), Gaps = 54/766 (7%)

Query: 1   MLRSILAGKKPFIIPKSIMSSPAGFPKKQKQATLAKFFSSMKNEKPADKKDP------ED 54
           ML+S+ A    +II     +   G  KKQ  ATLA+FFSSM   K  D          +D
Sbjct: 1   MLKSLYATHWRYIIMSGSSAVNGGGAKKQ--ATLARFFSSMPKRKIDDDSSTDSTTINKD 58

Query: 55  STTTTTEKPSLSPYTANSKKTFEEILNRPASNLAS-SSQGVSDIASTPSIPNISTDESTG 113
             + T++K  L     NS +T       P ++  S +S+    + S+P  P ++      
Sbjct: 59  DDSDTSKKIKL-----NSDET-------PTTSAGSVTSKDEPSLTSSPQKPIVT------ 100

Query: 114 PDLKKQKLEESNLEPSKEPTIENVTQDSTKP--YFSSIPYREVCNLFQEIESTSSRLAII 171
                         P+K P+       +TKP  +FS++PY ++C +FQE+ESTSSRL+II
Sbjct: 101 --------------PAKVPS-------NTKPVKFFSTVPYADLCEVFQEVESTSSRLSII 139

Query: 172 KLCSDFFIKIMKENPQNLIPVTYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKSLAQ 231
           K+CSDF IK+MK++PQNL+P+TYLFINKLGPDYEP           MKTISESCGKS+ Q
Sbjct: 140 KICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSMQQ 199

Query: 232 VRNKYRELGDLGQIAMDARNVQPTMFKPKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIK 291
           ++N+YRE+GDLGQIA DARNVQPTMFKPKPLTVGEVF+NL+ IA+S+GKDSQ RK++LIK
Sbjct: 200 LKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKMRLIK 259

Query: 292 RMLTACEGTEAKFLIRSLESKLRIGLAEKTVLISLSKALLVHECKDNKDFDMELLETAEQ 351
           RMLTAC+G EAKFLIRSLESKLRIGLAEKTVLISLSKALL++E + +KD  MEL+ETAE+
Sbjct: 260 RMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYETSKDPSMELIETAEE 319

Query: 352 KIRDAFCQVPNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGE 411
           KIRDAFCQVPNYEI+I SCL  GIMEL+ +C LRPGIPLKPMLAKPTKAINE+LD FQGE
Sbjct: 320 KIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGE 379

Query: 412 IFTSEYKYDGERAQVHLLSDGTMRIYSRNGENMTERYPEIHIRDFIADPLVTS----TLI 467
            FT EYKYDGER QVHLLS+G MRIYSRNGENMTERYPE+HI DF+      +    +LI
Sbjct: 380 EFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVSLI 439

Query: 468 LDCEAVAWDNEQNKILPFQVLSTRKRXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRE 527
           LDCE VAWDNEQNKILPFQVLSTRKR            CLFAFDIL +N E LI K+LRE
Sbjct: 440 LDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEGLITKTLRE 499

Query: 528 RRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPS 587
           RR+IL EVTK V GEFQYAT + ++ LDE+QKFLDQ++ DSCEGLMVK+LDG ES YEPS
Sbjct: 500 RRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPS 559

Query: 588 KRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKI 647
           KRSRNWLKLKKDYL G+GDSLDLCV+GAYYG+GKRTG YGGFLLGCYNQD+GE+ETCCKI
Sbjct: 560 KRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLLGCYNQDSGEYETCCKI 619

Query: 648 GTGFSDEMLQQLYTRLTPTVLDGPKATFVYDSSAEPDVWFEPTLLFEVLTADLSLSPIYK 707
           GTGFSDEML +LY       ++ PK+ + +DSSAEPD+WFEP +LFEVLTADLSLSPIYK
Sbjct: 620 GTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTADLSLSPIYK 679

Query: 708 AGSSTYDKGISLRFPRFIRTREDKGVEDATSSEQIIELYENQAHTQ 753
           AGS+TYDKGISLRFPRF+R R+DK VEDATSS+QIIE+YENQ+H Q
Sbjct: 680 AGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHIQ 725

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  975 bits (2521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/622 (73%), Positives = 527/622 (84%), Gaps = 1/622 (0%)

Query: 132 PTIENVTQDSTKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIP 191
           P I   T      + S IPY +VCN+F EIESTSSRL+I+K+CS+FF  ++K+NP NL+P
Sbjct: 72  PIISTSTPVMAPVHHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSNLVP 131

Query: 192 VTYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKSLAQVRNKYRELGDLGQIAMDARN 251
           +TYLFIN+LGPDYEP           MKTI+ESCGKSL QVR KYRE+GDLG++A +AR 
Sbjct: 132 ITYLFINRLGPDYEPGLELGLGEGLLMKTIAESCGKSLQQVRAKYREIGDLGEVAQEARA 191

Query: 252 VQPTMFKPKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLES 311
           VQPTMFKPKPLTVGEVF NL+ IAKS+GKDSQTRKI+LIKRMLTAC+G EAKFLIRSLES
Sbjct: 192 VQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFLIRSLES 251

Query: 312 KLRIGLAEKTVLISLSKALLVHECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCL 371
           KLRIGLAEKTVLISLSKALL +E  D ++   EL+E AEQ++RDAFCQVPNYEIVIN+CL
Sbjct: 252 KLRIGLAEKTVLISLSKALLSYE-HDGEEPSSELVENAEQRVRDAFCQVPNYEIVINTCL 310

Query: 372 KYGIMELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSD 431
           ++GIME+  HC L+PGIPLKPMLAKP+K+I E+LDRF GE FT EYKYDGERAQVHLL D
Sbjct: 311 EHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPD 370

Query: 432 GTMRIYSRNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTR 491
           G+M IYSRNGENMTERYPE+HIRD++ADP  T +LILDCEAVAWD EQ KILPFQ+LSTR
Sbjct: 371 GSMNIYSRNGENMTERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTR 430

Query: 492 KRXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTS 551
           KR            CLFAFD+LC+N + LIN SL ERR+ LQ V K VTG+FQ+A E+ S
Sbjct: 431 KRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNS 490

Query: 552 SNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLC 611
           SNL+++QK+L+QSV D+CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL+G+GDSLDLC
Sbjct: 491 SNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLC 550

Query: 612 VIGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGP 671
           V+GAYYGRGKRTG YGGFLLGCYNQDTGEFETCCKIGTGFSDEML  LY +L P+ L+ P
Sbjct: 551 VLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKPSSLEQP 610

Query: 672 KATFVYDSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDK 731
           KA +VYDSSAEPDVWFEPT+LFEVLTADLSLSPIYKAG+S Y KGISLRFPRFIR R+DK
Sbjct: 611 KAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDK 670

Query: 732 GVEDATSSEQIIELYENQAHTQ 753
            VEDATSSEQI+ELYE+Q + Q
Sbjct: 671 DVEDATSSEQIVELYESQVNLQ 692

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  939 bits (2427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/729 (63%), Positives = 561/729 (76%), Gaps = 34/729 (4%)

Query: 29  QKQATLAKFFSSMKNEKPADKKDPEDSTTTTT-----EKPSLSPYTA-NSKKTFEEILNR 82
           +KQATLAKFFSS K     +K+ P++S   +       KP  S  +  N  +T  E L +
Sbjct: 13  KKQATLAKFFSSKKRSND-EKEGPQESAKKSQLNAIDAKPESSKGSQPNVDETNHETLQK 71

Query: 83  PASNLASSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKEPTIENVTQDST 142
           P     S+++  ++ A  P+   ++ ++S G D+ K  +                    +
Sbjct: 72  PQ---LSAAEPKTEFAMNPA--KLAVEKSHG-DVAKIGI--------------------S 105

Query: 143 KPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFINKLGP 202
            P  S++ Y E+C++F EIE TSSRL I+KLCSDF   ++ +  ++L+P+TYL INKLGP
Sbjct: 106 APKDSNVMYSEMCSVFNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGP 165

Query: 203 DYEPXXXXXXXXXXXMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMFKPKPL 262
           DY+P           MKTISESCGKSL QV+ +YRELGDLG+IA +AR+VQPTMFKPKPL
Sbjct: 166 DYQPGLELGLGEGLLMKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPL 225

Query: 263 TVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGLAEKTV 322
           T G VF NL+ IA+++GKDSQ RK++LIK+MLTACEG EAKFLIRSLESKLRIGLAEK+V
Sbjct: 226 TTGMVFANLQDIARAQGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSV 285

Query: 323 LISLSKALLVHECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIMELETHC 382
           L++LSKA+L HE    K+   +L++ AEQKIRDAFCQVPNYEIVIN+ L++GIMELE HC
Sbjct: 286 LVALSKAILTHE-HGGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHC 344

Query: 383 SLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIYSRNGE 442
            L PGIPLKPMLAKP+K+I+E+LDRFQG+ FT EYKYDGERAQVHLL DG+MRIYSRNGE
Sbjct: 345 VLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGE 404

Query: 443 NMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRXXXXXXXXX 502
           NMTERYPEI+I DF+A P  T TLILDCEAVAWD ++N ILPFQVLSTRKR         
Sbjct: 405 NMTERYPEINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVK 464

Query: 503 XXXCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLD 562
              CLFAFDILC+NDE LINKSL ERR  L+ + K V GE Q A+E+T+ +LDE+Q +LD
Sbjct: 465 VRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLD 524

Query: 563 QSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGKR 622
           QSV D CEGLMVK+LDG ESHYEPSKRSRNWLKLKKDYL+G+GDSLDLCV+GAYYGRGKR
Sbjct: 525 QSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKR 584

Query: 623 TGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVYDSSAE 682
           TG YGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQ LY +L+PT +  PKA +VY  SA+
Sbjct: 585 TGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQ 644

Query: 683 PDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATSSEQI 742
           PDVW EP++LFEVLTADLSLSP+YKAG S+Y KGISLRFPRFIR R+DK VEDATSSEQ+
Sbjct: 645 PDVWLEPSMLFEVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQV 704

Query: 743 IELYENQAH 751
           IE YE+Q+H
Sbjct: 705 IEFYESQSH 713

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/734 (62%), Positives = 561/734 (76%), Gaps = 34/734 (4%)

Query: 29  QKQATLAKFFSSMK-------NEKPADK--KDP-EDSTTTTTEKPSLSPYTANSKKTFEE 78
           +KQATLAKFFSS K       + +PA K   DP    + + +  P L+  ++++     E
Sbjct: 13  KKQATLAKFFSSKKRSVEEEKSHEPAKKLHSDPIGAGSGSPSSSPPLATGSSDAGSVKVE 72

Query: 79  ILNRPASNLASSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKEPTIENVT 138
                    +++S G +  A TP++P+  +DE       K+ +  +  +P+K        
Sbjct: 73  T--------SATSTGENTKAGTPTLPD--SDEPA-----KRAVAATKGDPAK-------- 109

Query: 139 QDSTKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFIN 198
             ++ P  S I Y E+CN+F EIE TSSRL I+KLC DF   ++ +  ++++P+TYL IN
Sbjct: 110 LGASAPKDSKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLIN 169

Query: 199 KLGPDYEPXXXXXXXXXXXMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMFK 258
           KLGPDY+P           MKTISESCGKSL Q++ +YRELGDLG+IA +AR VQPTMFK
Sbjct: 170 KLGPDYQPGLELGLGEGLLMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFK 229

Query: 259 PKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGLA 318
           PKPLT GEVF NL+ IA+S+GKDSQ RK++LIKRMLTAC+G EAKFLIRSLESKLRIGLA
Sbjct: 230 PKPLTTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLA 289

Query: 319 EKTVLISLSKALLVHECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIMEL 378
           EK+VL++LSKALL +E  + K+   EL++TAEQKIRDAFCQVPNY+IVI + L++GIMEL
Sbjct: 290 EKSVLVALSKALLTYE-HNGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMEL 348

Query: 379 ETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIYS 438
           + HC L PGIPLKPMLAKP+K+I+E+LDRFQG+ FT EYKYDGERAQVHLL DG+MRIYS
Sbjct: 349 DKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYS 408

Query: 439 RNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRXXXXX 498
           RNGENMTERYPEI I DFIADP  T TLILDCEAVAWD E+N ILPFQVLSTRKR     
Sbjct: 409 RNGENMTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAV 468

Query: 499 XXXXXXXCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQ 558
                  CLFAFDILC+NDE LI + L ERR  L+     V GE Q A+E+T+ +LDELQ
Sbjct: 469 EDVKVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQ 528

Query: 559 KFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYG 618
            +LDQ+V D CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL+G+GDSLDLCV+GAYYG
Sbjct: 529 HYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYG 588

Query: 619 RGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVYD 678
           RGKRTG YGGFLLGCYNQD+GE+ETCCKIGTGFS+EMLQ L+ RL+PT +  PKA +V+ 
Sbjct: 589 RGKRTGTYGGFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHS 648

Query: 679 SSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATS 738
            SA PDVWFEPTLLFEVLTADLSLSP+YKAG+S+Y KGISLRFPRFIR R+DK  E+ATS
Sbjct: 649 ESAPPDVWFEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATS 708

Query: 739 SEQIIELYENQAHT 752
           SEQ++E YE+Q+H 
Sbjct: 709 SEQVVEFYESQSHV 722

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/645 (66%), Positives = 503/645 (77%), Gaps = 1/645 (0%)

Query: 109 DESTGPDLKKQKLEESNLEPSKEPTIENVTQDSTKPYFSSIPYREVCNLFQEIESTSSRL 168
           DE+      K +   SN+ P K          S   + S+IP+ E+C+ FQ IE TSSRL
Sbjct: 57  DETAAAPPVKSESSLSNITPPKSRGETLTPVPSKLKFHSNIPFAELCDTFQAIEVTSSRL 116

Query: 169 AIIKLCSDFFIKIMKENPQNLIPVTYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKS 228
           AI  +CS F   +++ +P++L+P+TYLFI+KLGPDYEP           +KTISE+CGKS
Sbjct: 117 AITAICSKFLYSVLERDPESLVPITYLFIHKLGPDYEPGLELGLGESLLIKTISEACGKS 176

Query: 229 LAQVRNKYRELGDLGQIAMDARNVQPTMFKPKPLTVGEVFENLRLIAKSEGKDSQTRKIK 288
           + Q+RNKYRE+GDLG+IAM ARNVQPTMFKPKPLTVGEVF NL  IAKS GKDSQ+RK  
Sbjct: 177 IQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKGS 236

Query: 289 LIKRMLTACEGTEAKFLIRSLESKLRIGLAEKTVLISLSKALLVHECKDNKDFDMELLET 348
           LIK+MLTAC+G EAKFLIRSLESKLRIGLAEKTVLIS+SKA+L HE  + ++   E++E 
Sbjct: 237 LIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLISVSKAILTHE-HNGQEPSTEMVEQ 295

Query: 349 AEQKIRDAFCQVPNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEILDRF 408
           AE  IRDAFCQVPNYE++IN  L+YGIM L  H  LRPGIPL+PMLAKPTK+I+E+LDRF
Sbjct: 296 AESLIRDAFCQVPNYEMIINVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRF 355

Query: 409 QGEIFTSEYKYDGERAQVHLLSDGTMRIYSRNGENMTERYPEIHIRDFIADPLVTSTLIL 468
           QG  FT EYKYDGERAQVHL  DG+M+IYSRNGE+MTERYPEI ++ ++ D   T + I+
Sbjct: 356 QGTKFTCEYKYDGERAQVHLCRDGSMKIYSRNGEDMTERYPEIDVKHYVKDLGATKSFIV 415

Query: 469 DCEAVAWDNEQNKILPFQVLSTRKRXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRER 528
           D EAVAWD EQ KILPFQVLSTRKR            CL+AFDILC NDE LINKS  ER
Sbjct: 416 DSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVKVRVCLYAFDILCLNDEPLINKSFHER 475

Query: 529 RQILQEVTKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSK 588
           RQIL +      G+F +A E+T++N DELQK+LDQSV DSCEGLMVKML+G ESHYEPSK
Sbjct: 476 RQILLDTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSK 535

Query: 589 RSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKIG 648
           RSRNWLKLKKDYLEG+GDSLDL V+GAYYGRGKRTG YGGFLLGCYN D+ EFETCCKIG
Sbjct: 536 RSRNWLKLKKDYLEGVGDSLDLVVLGAYYGRGKRTGTYGGFLLGCYNLDSEEFETCCKIG 595

Query: 649 TGFSDEMLQQLYTRLTPTVLDGPKATFVYDSSAEPDVWFEPTLLFEVLTADLSLSPIYKA 708
           TGFSDEMLQ LYT+L  T ++ P    +YDSSA  DVWFEP++LFEVLTADLSLSP+YKA
Sbjct: 596 TGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTADLSLSPVYKA 655

Query: 709 GSSTYDKGISLRFPRFIRTREDKGVEDATSSEQIIELYENQAHTQ 753
           G   + KGISLRFPRF+R R+DK V DATSS+Q+IE YE+QAH +
Sbjct: 656 GFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAHMK 700

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/747 (60%), Positives = 533/747 (71%), Gaps = 78/747 (10%)

Query: 29  QKQATLAKFFSSMKNEKPADKKDPEDSTTTTTEKPSLSPYTANSKKTFEEILNRPASNLA 88
           +KQATLA+FF+SM  + P     P     T  E    SP     KK       R      
Sbjct: 45  KKQATLARFFTSMGKKTP-----PAVEVATKQE----SPENHVDKK-------RKVEVHP 88

Query: 89  SSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKEPTIENVTQDSTKPYFSS 148
           S S G S+ A +P            PD  K                            S+
Sbjct: 89  SQSVGASEKAESP------------PDQTK----------------------------ST 108

Query: 149 IPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFINKLGPDYEPXX 208
           + Y EVCNLFQ+IE TSSRLAIIKLCS+FFI+++K NP ++I V YLFIN+LGPDYEP  
Sbjct: 109 VLYSEVCNLFQQIEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRLGPDYEPGL 168

Query: 209 XXXXXXXXXMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMFKPKPLTVGEVF 268
                    +KTISE+ GKS+ Q++ + +E GDLG IA DARN+QPTMFKPKPLT+ +VF
Sbjct: 169 ELGLGENLLIKTISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFKPKPLTISDVF 228

Query: 269 ENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGLAEKTVLISLSK 328
            NL+ IA + GKDSQ RKIKLIK+ML+A +G EAKFLIRSLESKLRIGLAEKTVLISLSK
Sbjct: 229 NNLKKIASATGKDSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRIGLAEKTVLISLSK 288

Query: 329 ALLVHEC---KDNKDFD------MELLETAEQKIRDAFCQVPNYEIVINSCLKYGIMELE 379
           ALL+HE    K    FD      M+L+E AE K+R+A CQVPNYEIVIN CL+ GI+ ++
Sbjct: 289 ALLLHEHWKEKGESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIVINLCLQDGILNID 348

Query: 380 THCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIYSR 439
             C+LRPGIPLKPMLAKPTKAI E+L+ FQG+ F SEYKYDGERAQVHLL  G MRIYSR
Sbjct: 349 KTCTLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSR 408

Query: 440 NGENMTERYPEIHIRDFIADPLVTST-------------LILDCEAVAWDNEQNKILPFQ 486
           NGENMTERYPE+ ++DF+      +              +ILDCE VAWD EQ KILPFQ
Sbjct: 409 NGENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQ 468

Query: 487 VLSTRKRXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYA 546
           VL+TRKR            CLFAFD+L  N+E +INKSLRER++IL++VT  V GEFQYA
Sbjct: 469 VLTTRKRKNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYA 528

Query: 547 TEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGD 606
           T + +S++DELQ FLDQ+V +SCEGLMVKMLDG ESHYEPSKRSRNWLKLKKDYL+G+GD
Sbjct: 529 TSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGD 588

Query: 607 SLDLCVIGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPT 666
           SLDL V+GAY+G+GKRTG YGGFLLGCYN+DT EFETCCKIGTGFSDEML  L+T L PT
Sbjct: 589 SLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPT 648

Query: 667 VLDGPKATFVYDSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIR 726
            +D P  T++YDSSAEPDVWF+  +LFEVLTADLSLSP+YKAG+S YDKGISLRFPRF+R
Sbjct: 649 EIDNPPMTYIYDSSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLR 708

Query: 727 TREDKGVEDATSSEQIIELYENQAHTQ 753
            REDK V D T+SE IIE YE+Q+H Q
Sbjct: 709 IREDKDVTDGTTSEDIIEFYESQSHIQ 735

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  864 bits (2232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/735 (58%), Positives = 520/735 (70%), Gaps = 41/735 (5%)

Query: 19  MSSPAGFPKKQKQATLAKFFSSMKNEKPADKKDPEDSTTTTTEKPSLSPYTANSKKTFEE 78
           MS+P      +KQATL +FF+++K         P+D  T              SK    E
Sbjct: 1   MSAP------KKQATLGRFFTALKR--------PQDGATAAAT-------VKKSKVEAAE 39

Query: 79  ILNRPASNLASSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKEPTIENVT 138
            L  PA +         D     S+P ++   + G  L           P     +    
Sbjct: 40  CLAAPAGH-------EQDAEVKNSLPELADKPAPGGVL-----------PQAASAVPRAQ 81

Query: 139 QDSTKPYFS-SIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFI 197
               KP  S S+ Y ++C +F+ +E+TSSRL+I KLC+DF   ++K +P +LIPVTYLFI
Sbjct: 82  SSPVKPAASTSVMYADLCAVFEAVEATSSRLSITKLCADFMYSVLKCDPGHLIPVTYLFI 141

Query: 198 NKLGPDYEPXXXXXXXXXXXMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMF 257
           N+LGPDYEP           +KTIS++CGKS AQVR+ YRE GDLG +A  AR VQPTMF
Sbjct: 142 NRLGPDYEPGLELGLGEGILIKTISDACGKSAAQVRSSYRECGDLGTVAQQARVVQPTMF 201

Query: 258 KPKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGL 317
           KPKPLTV +VF  L+ IA++EGKDSQ +KI+LIK+MLTAC+G EAK+LIRSLESKLRIGL
Sbjct: 202 KPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTACQGMEAKYLIRSLESKLRIGL 261

Query: 318 AEKTVLISLSKALLVHECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIME 377
           AEKTVL++LSKA+L HE  D K+   E ++ AE  +RD FCQVPNYE++IN+ L+YGIM 
Sbjct: 262 AEKTVLVALSKAILTHE-HDGKEPSPEQVDAAEALVRDTFCQVPNYEMIINAALQYGIMN 320

Query: 378 LETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIY 437
           L  HC L PGIPLKPMLAKPTK+I E+LDRFQG+ FT EYKYDGERAQVHL+ DGT+RIY
Sbjct: 321 LPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTIRIY 380

Query: 438 SRNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRXXXX 497
           SRN ENMTERYPEI    F+A+P  T +LI+DCEAVAWDNE+ KILPFQVLSTRKR    
Sbjct: 381 SRNSENMTERYPEIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVE 440

Query: 498 XXXXXXXXCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDEL 557
                   CLFAFD+L  N E L+  SL +RR+ L  V K V GE Q+A E+T+  L EL
Sbjct: 441 LKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSEL 500

Query: 558 QKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYY 617
           Q +L+QSV  SCEGLMVKMLDG ES YEPSKRSRNWLKLKKDYLEG+GDSLDL V+GAYY
Sbjct: 501 QTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYY 560

Query: 618 GRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVY 677
           GRGKRTG YGGFLLGCYN D  EFETCCKIGTGFS+E+LQ L+ +L  TV+  P+    Y
Sbjct: 561 GRGKRTGTYGGFLLGCYNPDLEEFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGDVSY 620

Query: 678 DSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDAT 737
           D S+ PDVWFEP +LFEVLTADLSLSP+YKAG   Y KGISLRFPRF+R REDK V DAT
Sbjct: 621 DDSSPPDVWFEPAMLFEVLTADLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDAT 680

Query: 738 SSEQIIELYENQAHT 752
           SS+QI+E Y+ QA++
Sbjct: 681 SSDQIVEFYQRQANS 695

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/614 (66%), Positives = 487/614 (79%), Gaps = 4/614 (0%)

Query: 142 TKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFINKLG 201
           +KP  SS+PY ++C LF+ IES SSRL I  LC+ FF + ++ +P  L+PVTYL INKLG
Sbjct: 108 SKPATSSLPYADLCQLFETIESESSRLTITNLCTAFFSRTLQLDPSLLVPVTYLCINKLG 167

Query: 202 PDYEPXXXXXXXXXXXMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPT--MFKP 259
           PDY             +K I  +CG S  Q++ +YR+LGDLGQ+AM  R +QPT  MFK 
Sbjct: 168 PDYS-GVELGLGEGLLLKAIGSACGVSQQQLKLQYRKLGDLGQLAMSTRVLQPTITMFKL 226

Query: 260 KPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGLAE 319
           +PLT+ +VF+ L  IA S+GKDSQ +KI +IKR+LT+C+G EAKFLIRSLESKLRIGLAE
Sbjct: 227 EPLTITKVFDTLAKIAASQGKDSQNQKINMIKRLLTSCQGVEAKFLIRSLESKLRIGLAE 286

Query: 320 KTVLISLSKALLVHECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIMELE 379
           KTVL SL++AL++HE K N +   +    AEQ I+D+FCQ+PNYEI+I + L+YG+ +L 
Sbjct: 287 KTVLTSLARALVIHE-KGNDNIQDDDYSNAEQIIKDSFCQIPNYEIIITTSLQYGVSQLA 345

Query: 380 THCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIYSR 439
           +H  L PGIPLKPMLAKPTK+I+E+LD FQ   FTSEYKYDGERAQVHLL DG+MRIYSR
Sbjct: 346 SHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDGSMRIYSR 405

Query: 440 NGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRXXXXXX 499
           NGE+MT+RYPE++I+D++ D   T+ LILDCEAVAWD E  KILPFQVLSTRKR      
Sbjct: 406 NGEDMTQRYPELNIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSVDLK 465

Query: 500 XXXXXXCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQK 559
                 CLFAFDIL HN++ LIN +LRERR IL  +TK   G+FQ+ATE+T+SNLDELQ 
Sbjct: 466 DIKVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTTSNLDELQT 525

Query: 560 FLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGR 619
           FLD+++ DSCEGLMVK LDG +SHYEPSKRSRNWLKLKKDYL+G+GDSLDLCV+GAYYGR
Sbjct: 526 FLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCVLGAYYGR 585

Query: 620 GKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVYDS 679
           GKRTG YGGFLL CYNQDT EFETCCKIGTGFSDEMLQ LY  L  T ++ P+A FV+DS
Sbjct: 586 GKRTGTYGGFLLACYNQDTEEFETCCKIGTGFSDEMLQTLYNGLKETAIESPRANFVFDS 645

Query: 680 SAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATSS 739
           SAEPDVWF PT++FEVLTADLSLSPIYKAGS+ Y KGISLRFPRFIR R DK V DATSS
Sbjct: 646 SAEPDVWFNPTMVFEVLTADLSLSPIYKAGSTVYGKGISLRFPRFIRIRTDKSVNDATSS 705

Query: 740 EQIIELYENQAHTQ 753
           EQ+I+ YENQ+H Q
Sbjct: 706 EQVIDFYENQSHLQ 719

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score = 97.8 bits (242), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 106/405 (26%), Positives = 166/405 (40%), Gaps = 66/405 (16%)

Query: 383 SLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDG-TMRIYSRNG 441
           S+R G    P +A+  K   E +    G  F  E K DG+R QVH +  G ++  +SRNG
Sbjct: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346

Query: 442 ENMTERYPEIHIRDFIADPLV----TSTLILDCEAVAWDNEQNKILPFQV----LSTRKR 493
            N T  Y E   +  I++ L         ILD E V++D E   ILPF +     S +  
Sbjct: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406

Query: 494 XXXXXXXXXXXXCLFA-FDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSS 552
                        L+A FD+L  N + L N+ + +R++ L+++           +    S
Sbjct: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466

Query: 553 NLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCV 612
           + + +   L  +V    EG+++K      S Y   KR  +W+K+K +YLE  G+++DL V
Sbjct: 467 DAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVV 523

Query: 613 IGAYYGRGKRTGMYGGFLLGCYNQDTGE----------------------------FETC 644
           IG   GR         F+      D  E                            F + 
Sbjct: 524 IGRDKGRKD------SFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQPKIEKFISF 577

Query: 645 CKIGTGFSDEMLQQLYTRLT-----PTVLDGPKATFVYDSSAEPDVWFEP--TLLFEVLT 697
           C I  G S+E  +++  RLT     P     P   +V   +  P  W +P  +++ EV  
Sbjct: 578 CSIANGISNEEFKEI-DRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKA 636

Query: 698 ADL----SLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATS 738
             +    S S +YK GS+ Y+           R R DK    A++
Sbjct: 637 RSIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTAST 674

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 91/380 (23%), Positives = 165/380 (43%), Gaps = 29/380 (7%)

Query: 379 ETHCSLRPGIPLKPMLAKPTK-AINEILDRFQGEIFTSEYKYDGERAQVHLLSDG-TMRI 436
           +T  S+      +P LAK T  +   +  + Q + F  E K DGER Q+H ++ G  ++ 
Sbjct: 236 QTDLSITISHAFEPQLAKRTHLSYERVASKLQHD-FIIEEKMDGERLQIHYINYGEQIKY 294

Query: 437 YSRNGENMTERYPEIHIRDFIADPLV----TSTLILDCEAVAWDNEQNKILPFQVLST-- 490
            SR G + +  Y E      I+  L         ILD E + +D E++ +LPF ++ +  
Sbjct: 295 LSRRGVDFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSA 354

Query: 491 ----RKRXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYA 546
               +                 AFD++  N + L N +L  R+  L ++   V    +  
Sbjct: 355 MNQIQSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEII 414

Query: 547 TEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGD 606
             M + N + ++  L+Q++    EG+++K L    S Y    R+ +W+K+K +YLE  G+
Sbjct: 415 QYMKAINAEAIKDSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGE 471

Query: 607 SLDLCVIGAYYGRGKRTGMYGGFLLGCYNQ--DTGEFETCCKIGTGFSDEMLQQL----Y 660
           ++DL +IG    +GK+   + G  +   N+  +   F + C I  G S+E  + +    +
Sbjct: 472 NMDLLIIGR--EQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTW 529

Query: 661 TRLTPTVLDGPKATFVYDSSAEPDVWFEP--TLLFEVLTADLSLSPIYKAGSSTYDKGIS 718
            +      D P    +   +  P  W  P  +++ EV    +      ++    Y  G +
Sbjct: 530 GKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCT 586

Query: 719 LRFPRFIRTREDKGVEDATS 738
           L F    + R DK  +   S
Sbjct: 587 LHFGYCKQIRYDKDWKTVAS 606

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 79/267 (29%), Positives = 128/267 (47%), Gaps = 15/267 (5%)

Query: 383 SLRPGIPLKPMLAKPTK-AINEILDRFQGEIFTSEYKYDGERAQVHLLSDG-TMRIYSRN 440
           S++ G    P LAK    + + I +R   + F  E K DGER Q+H ++ G T++ +SR+
Sbjct: 268 SIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEE-KMDGERIQLHYMNYGETVKFFSRH 326

Query: 441 GENMTERYPEIHIRDFIADPLV----TSTLILDCEAVAWDNEQNKILPFQVL--STRKRX 494
           G + T  Y        IA  L         +LD E V +D+   K+LPF ++  S   + 
Sbjct: 327 GTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQL 386

Query: 495 XXXXXXXXXXXCLF-AFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSN 553
                       LF  FDIL  N   LI+  L +R++ L  V        +  + +  ++
Sbjct: 387 NKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTD 446

Query: 554 LDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVI 613
             +++K LD ++    EG+++K      S Y P+ R  NW+K+K +YLE  G+++DL VI
Sbjct: 447 SIQIKKGLDAAISVGSEGIVLKQY---ISKYIPNARHNNWIKVKPEYLEEFGENMDLIVI 503

Query: 614 GAYYGRGKRTGMYGGFLLGCYNQDTGE 640
           G     GK+  +  G L+    Q+  E
Sbjct: 504 GR--DSGKKDCLICGILVTEEKQELSE 528

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 100/401 (24%), Positives = 167/401 (41%), Gaps = 51/401 (12%)

Query: 387 GIPLKPMLAKPTK-AINEILDRFQGEIFTSEYKYDGERAQVHLLSDG-TMRIYSRNGENM 444
           G+P  P LAK    + +++  R + + +  E K DGER Q+H +  G  ++ +SR G + 
Sbjct: 253 GLPFAPFLAKRLYISYDKVALRLKSDFYIEE-KMDGERIQLHYMDYGRKLKWFSRRGNDY 311

Query: 445 TERYPEIHIRDFIA-----DPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRXXXXXX 499
           T  Y E      +A     DP V    +LD E +++D E+N +LPF ++ +  R      
Sbjct: 312 TYLYGEDIGTGTVAKYLQLDPKVREC-VLDGEMISFDTEENSVLPFGLVKSSARDSLTAE 370

Query: 500 XXXXXX---CLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDE 556
                         D L  N   LIN  L  R+Q L  +        +    M   +   
Sbjct: 371 GILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTS 430

Query: 557 LQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAY 616
           ++  L++++    EG+++K     +S YE   R+ NW+K+K +YLE  G++LDL VIG  
Sbjct: 431 IKSSLEKAIMMGSEGIILKHF---KSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGR- 486

Query: 617 YGRGKRTGMYGGFLL-------------GCYNQDTGE----------FETCCKIGTGFSD 653
              GK+  +  G  +                N D+ E          F + C I  G S 
Sbjct: 487 -DPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQ 545

Query: 654 EMLQQLYTRLT---PTVLDGPKATFVYDSSAEPDVWFEP--TLLFEVLTADLSLSPIYKA 708
           E  +Q+  +         D      +   S  P+ W  P  +++ EV    L  +   ++
Sbjct: 546 EEFKQIERKTAGKWKNTEDHKPPKILEFGSKLPEEWIYPEDSVVLEVKARSLDNT---ES 602

Query: 709 GSSTYDKGISLRFPRFIRTREDKGVEDATSSEQIIELYENQ 749
               +  G +L      R REDK   + T    + EL++ +
Sbjct: 603 SGRKFKVGCTLHGGYCRRIREDK---NWTECYTLYELWQER 640

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 99/414 (23%), Positives = 170/414 (41%), Gaps = 57/414 (13%)

Query: 383 SLRPGIPLKPMLAKP-TKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGT-MRIYSRN 440
           S+  G    P LAK  T +  +I  +   + F  E K DGER QVH +  G  +R  SR 
Sbjct: 264 SINLGYAFVPQLAKKMTISYEKICTKLNND-FLIEEKMDGERIQVHYMDYGAKIRFLSRR 322

Query: 441 GENMTERYPEIHIRDFIADPLVTSTLILDC----EAVAWDNEQNKILPFQVLSTRKRXXX 496
           G + T+ Y E      +A+ L   + + DC    E + +D ++N +LPF ++ +  R   
Sbjct: 323 GVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQAL 382

Query: 497 XXX---XXXXXXCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSN 553
                        L   D++  N   LI   L +R++ L  V K      +    +  S 
Sbjct: 383 STEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSE 442

Query: 554 LDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVI 613
              ++K L++S+    EG+++K     ++ YE   R+  W+K+K +YLE  G++LDL +I
Sbjct: 443 HTAIRKSLEKSISMGSEGIVLK---SYKARYEIGARNDYWIKVKPEYLEQFGENLDLVII 499

Query: 614 GAYYGRGKRTGMYGGFLLGCYNQDTGEFE------------------------------T 643
           G     GK+  +  G  +    +D  E E                              +
Sbjct: 500 GR--TPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFIS 557

Query: 644 CCKIGTGFSDEMLQQLYTRLTPTVLDG----PKATFVYDSSAEPDVWFEP--TLLFEVLT 697
            C I  G S +  +++  +     +      P A  +   S  P+ W +P  +++ EV  
Sbjct: 558 FCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKA 617

Query: 698 ADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATSSEQIIELYENQAH 751
             L  +   ++    +  G +L      R R+DK   D T      EL++ + H
Sbjct: 618 RSLDNT---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score = 93.6 bits (231), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 80/283 (28%), Positives = 127/283 (44%), Gaps = 18/283 (6%)

Query: 383 SLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDG-TMRIYSRNG 441
           +++ G    P LAK      E + R     F  E K DGER QVH ++ G ++R YSR G
Sbjct: 247 TIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRG 306

Query: 442 ENMTERYPEI-------HIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVL--STRK 492
            + T  Y          H  DF  +       +LD E V +D  +  ILPF ++  S + 
Sbjct: 307 IDYTYLYGASLSSGTISHHLDFTDN---VRECVLDGEMVTFDARRKVILPFGLVKGSAKD 363

Query: 493 RXXXXXXXXXXXXCLFA-FDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTS 551
                         L+  FD+L  N   L    L +R++ L+ +   V    +       
Sbjct: 364 ALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRC 423

Query: 552 SNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLC 611
            N++ ++K L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YLE  G++LDL 
Sbjct: 424 YNVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLV 480

Query: 612 VIGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDE 654
           +IG   G+ K + M G  LL     D  + E    I     +E
Sbjct: 481 IIGRDPGK-KDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNE 522

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 104/429 (24%), Positives = 174/429 (40%), Gaps = 81/429 (18%)

Query: 390 LKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDG-TMRIYSRNGENMTERY 448
            +P LAK      E+L R     FT E K DGER Q+H +  G  ++ +SR G + T  Y
Sbjct: 264 FEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGNDYTYLY 323

Query: 449 PE----IHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRXXXXXXXXXXX 504
            +      I  ++         ILD E V++D  +N ILPF ++ +              
Sbjct: 324 GKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSLKIDGLEND 383

Query: 505 XC---LFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFL 561
            C      FD+L  N   L N  L +R++ L  +        +      + + + ++  L
Sbjct: 384 LCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAHDSESIRSAL 443

Query: 562 DQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGK 621
             ++    EG+++K  D +   Y    R+ +W+K+K +YLE  G++LDL VIG   G+ K
Sbjct: 444 QAAISVGSEGIVLKKYDSL---YSVGDRNNDWIKVKPEYLEQFGENLDLIVIGRDPGK-K 499

Query: 622 RTGMYGGFLLGCYNQDTGE----------------------------------FETCCKI 647
            + M G  +L   N+++ E                                  F + C I
Sbjct: 500 DSLMCGVAVLE--NEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRITKFISFCVI 557

Query: 648 GTGFSDEMLQQL-------YTRLTPTVLDGPKATFVYDSSAEPDVWFEP--TLLFEV--- 695
             G S+E  +++       + + +    + P   ++   +  P  W  P  +++ EV   
Sbjct: 558 ANGISNEEFKEIDRKTFGCWKKFSD---EAPPTDYLEFGTRLPVEWINPHDSVVLEVKAR 614

Query: 696 -LTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDA-TSSEQII---------E 744
            L  + +L   +K G + Y  G   R     R R DK   D  T S+ +I         E
Sbjct: 615 SLENNEALRDKFKTGYTLY--GAYCR-----RIRTDKDFNDCYTFSDLVIATNKKRSSSE 667

Query: 745 LYENQAHTQ 753
           LY N +H +
Sbjct: 668 LYGNHSHIK 676

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 120/282 (42%), Gaps = 28/282 (9%)

Query: 346 LETAEQKIRDAFCQVPNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEIL 405
           L T   ++ D   ++ N ++VIN                 PG    P LAK      E +
Sbjct: 235 LRTVTTRLWDPEIRLQNNDLVIN-----------------PGFAFAPQLAKKLSISYEKI 277

Query: 406 DRFQGEIFTSEYKYDGERAQVHLLSDG-TMRIYSRNGENMTERYPEIHIRDFIADPLVTS 464
                  F  E K DGER Q+H    G  ++ +SR G + T  Y E     FI   L  +
Sbjct: 278 CMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGTDYTYLYGESIHDGFIGKHLKLN 337

Query: 465 TLILDC----EAVAWDNEQNKILPFQVLSTRKRXXXXXXXXXXXX---CLFAFDILCHND 517
             + DC    E + +D  QN ILPF ++ +  R                   FD++  N 
Sbjct: 338 KDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTKDGIMNEGYQPLFMVFDLIFMNG 397

Query: 518 EKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKML 577
             L N  L  R++ L  +        +  +     N D ++K L+ ++    EG+++K  
Sbjct: 398 TSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNEDSIRKSLELAISMGSEGIVLKRY 457

Query: 578 DGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGR 619
           D   S Y  + R+ +W+K+K +YLE  G+++DL VIG   G+
Sbjct: 458 D---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGRDPGK 496

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 124/268 (46%), Gaps = 17/268 (6%)

Query: 383 SLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDG-TMRIYSRNG 441
           S++ G    P LAK      E + R   + F  E K DGER QVH ++ G +++ +SR G
Sbjct: 247 SIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRG 306

Query: 442 ENMTERYPEIHIRDFIADPL----VTSTLILDCEAVAWDNEQNKILPFQVL--STRKRXX 495
            + T  Y        I+  L         +LD E V +D ++  ILPF ++  S ++   
Sbjct: 307 IDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALS 366

Query: 496 XXXXXXXXXXCLF-AFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNL 554
                      L+  FD+L  N   L    L +R+Q L  +   +    +         +
Sbjct: 367 FNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGV 426

Query: 555 DELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIG 614
           + ++K L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YLE  G++LDL VI 
Sbjct: 427 ESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLIVI- 482

Query: 615 AYYGRGKRTGMYGGFLLGCYNQDTGEFE 642
                G+ +G    F+LG    D  E++
Sbjct: 483 -----GRDSGKKDSFMLGLLVLDEEEYK 505

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 92/390 (23%), Positives = 162/390 (41%), Gaps = 39/390 (10%)

Query: 383 SLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGT-MRIYSRNG 441
           S+  G    P LAK      E +       F  E K DGER Q+H ++ G+ ++  SR G
Sbjct: 258 SINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRG 317

Query: 442 ENMTERYPEIHIRDFIADPLVTSTLILDC----EAVAWDNEQNKILPFQVLSTRK----- 492
            + +  Y +   R  I+  L   + + DC    E V++D ++  ILPF ++ +       
Sbjct: 318 IDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELI 377

Query: 493 RXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSS 552
                            FD++  N   L    L  R++ L+E+   V    +    + + 
Sbjct: 378 NSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRAC 437

Query: 553 NLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCV 612
           +   ++ F+ +++    EG++VK      S YE   R+ +W+K+K +Y E +G+++DL V
Sbjct: 438 DAKAIKNFMQRAIEMGSEGVIVKQ---ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVV 494

Query: 613 IGAYYGRGKRTGMYGGFLLGCYN---QDTGEFE------------TCCKIGTGFSDEMLQ 657
           IG     GK+  +  G L+       ++ G  E            + C +  G SDE  +
Sbjct: 495 IGR--DPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFK 552

Query: 658 QLYTRLTPTVLD----GPKATFVYDSSAEPDVWFEP--TLLFEVLTADLSLSPIYKAGSS 711
           ++  +   + +      P  + +   S  P  W +P  +++ EV    +  S   +  S 
Sbjct: 553 EINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS---EYSSK 609

Query: 712 TYDKGISLRFPRFIRTREDKGVEDATSSEQ 741
            Y  G +L      R R DK     TS  Q
Sbjct: 610 RYRAGSTLHSAYCRRIRNDKDWTTCTSVAQ 639

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 111/240 (46%), Gaps = 11/240 (4%)

Query: 383 SLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGT-MRIYSRNG 441
           +L+ G    P LAK      E + +  G  F+ E K DGER Q+H +  G  ++  SR G
Sbjct: 248 TLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRG 307

Query: 442 ENMTERYPEIHIRDFIADPLV----TSTLILDCEAVAWDNEQNKILPFQVLSTRKRXXXX 497
            + T  Y        IA  L         ILD E V +D E+  ILPF ++ +  +    
Sbjct: 308 TDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLS 367

Query: 498 XXXXXXXX---CLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNL 554
                         AFD++  N   L++  L +R+  L ++     G     +    +NL
Sbjct: 368 KESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNL 427

Query: 555 DELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIG 614
           + + K L  ++    EG+++K L+   S Y  + R+ +W+K+K  YL+  G+++DL +IG
Sbjct: 428 ESITKSLAAAISVGSEGIILKKLN---SRYMVASRNDSWIKIKPQYLKQFGENMDLIIIG 484

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 97/398 (24%), Positives = 165/398 (41%), Gaps = 48/398 (12%)

Query: 364 EIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGER 423
           E + N  ++ G  EL    S+  G    P LAK      E +     + F  E K DGER
Sbjct: 257 ETLWNPTMRLGKNEL----SINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGER 312

Query: 424 AQVHLLSDGT-MRIYSRNGENMTERYPEIHIRDFIADPLVTSTLILDC----EAVAWDNE 478
            Q+H +  G  +R  SR G + T  Y +      I+  L     + DC    E V++D E
Sbjct: 313 IQLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKE 372

Query: 479 QNKILPFQVLSTRKRXXXXXXXXXXXX-----CLFAFDILCHNDEKLINKSLRERRQILQ 533
           +N +LPF ++ +                        FD++  N   L    L  R+  L+
Sbjct: 373 KNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLR 432

Query: 534 EVTKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNW 593
            +   V    +  +++ +S  + ++  L++++    EG+++K      S YE   R+ +W
Sbjct: 433 SILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFS---SPYEIGARNDSW 489

Query: 594 LKLKKDYLEGIGDSLDLCVIGAYYGRGKRTGMYGGFLLG---------CYNQD------- 637
           +K+K +Y E +G+++DL VIG     GK+  +  G +L            +QD       
Sbjct: 490 IKIKPEYFEELGETMDLVVIGR--DPGKKDSLMCGLILADETDGSSVNLASQDDPLRPKQ 547

Query: 638 -TGEFETCCKIGTGFSDEMLQQLYTR----LTPTVLDGPKATFVYDSSAEPDVWFEP--T 690
              +  + C I  G SD   +++  +       T    P +  +   +  P  W +P  +
Sbjct: 548 RNPKVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSS 607

Query: 691 LLFEV----LTADLSLSPIYKAGSSTYDKGISLRFPRF 724
           L+ EV    +  D   S  YK GS+   +G   R  RF
Sbjct: 608 LVLEVKARSVDTDELSSKKYKTGSTL--RGAYCRALRF 643

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 95/418 (22%), Positives = 176/418 (42%), Gaps = 57/418 (13%)

Query: 346 LETAEQKIRDAFCQVPNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEIL 405
           LET  +++ D   ++ N ++ IN                  G+   P LA       + +
Sbjct: 242 LETVAKRLWDPSQRLGNQDLKIN-----------------IGLAFAPQLATKLHVSYQKI 284

Query: 406 DRFQGEIFTSEYKYDGERAQVHLLSDGT-MRIYSRNGENMTERYPEI----HIRDFIADP 460
               G  F  E K DGER Q+H  + G+ ++ YSR   + T  Y        + +FI   
Sbjct: 285 GEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYTYLYGNNLKTGTLANFINLN 344

Query: 461 LVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRXXXXXXXXXXXX---CLFAFDILCHND 517
                 +LDCE V +D+    +LPF ++ +  +                L  FD+L  N 
Sbjct: 345 KNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGIDTQGFHPLLMVFDVLYLNG 404

Query: 518 EKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKML 577
             L++    +RR+ L+++        +    + +++   ++K L++++    EG+++K  
Sbjct: 405 ATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQMIKKSLEKALSVGSEGIILKRY 464

Query: 578 DGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGKRTGMYGGFL------- 630
           D   S Y  + RS +W+K+K +YLE  G+++DL ++G      K+  +  G L       
Sbjct: 465 D---SRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGR--DPSKKDSLMLGLLDYEEVIQ 519

Query: 631 ---LGCYNQDTGE-------FETCCKIGTGFSDEMLQQLYTRLTPTVLDG---PKATFVY 677
              +   +Q + E       F + C I  G S+E  +++  +      D    P   ++ 
Sbjct: 520 DSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEYKEIDRKTKGLWNDSEKIPPLEYMK 579

Query: 678 DSSAEPDVWFEP--TLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIR-TREDKG 732
             S  P  W +P  +L+ E+    L  +   ++    +  G +L F  + R  REDK 
Sbjct: 580 FGSKVPRQWIDPKKSLILEIKARSLDNT---RSSERKFAAGCTL-FGGYCRQIREDKN 633

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 115/256 (44%), Gaps = 15/256 (5%)

Query: 383 SLRPGIPLKPMLAKP-TKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGT-MRIYSRN 440
           S+  G    P LAK  + + ++I  + + + F  E K DGER Q+H +  G  ++  SR 
Sbjct: 247 SINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEE-KMDGERIQIHYMDYGNDIKFLSRR 305

Query: 441 GENMTERYPEIHIRDFIADPLV----TSTLILDCEAVAWDNEQNKILPFQVLSTRKRXXX 496
           G + T  Y E      IA  L         +LD E V +D +Q+ +LPF ++ +      
Sbjct: 306 GVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNAL 365

Query: 497 XXXXXXXXX---CLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSN 553
                        L  FD++  N   L+   L +R+  L  V +      Q       SN
Sbjct: 366 TKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSN 425

Query: 554 LDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVI 613
            + ++K L+ ++    EG+++K      S Y    R+ +W+K+K +YLE  G+++DL VI
Sbjct: 426 ENIIRKSLEHAISVGSEGIVLK---NYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVI 482

Query: 614 GAYYGRGKRTGMYGGF 629
           G      K+   Y G 
Sbjct: 483 GR--DSAKKDSFYCGL 496

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 122/268 (45%), Gaps = 17/268 (6%)

Query: 383 SLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDG-TMRIYSRNG 441
           S++ G    P LAK      E + R     F  E K DGER QVH ++ G +++ +SR G
Sbjct: 247 SIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRG 306

Query: 442 ENMTERYPEIHIRDFIADPL-VTSTL---ILDCEAVAWDNEQNKILPFQVLSTRKRXXXX 497
            + T  Y        I+  L +T+T+   +LD E V +D+ +  ILPF ++    +    
Sbjct: 307 IDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLS 366

Query: 498 XXXXXXXX---CLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNL 554
                          FD+L  N+  L    L +R++ L  +        +        ++
Sbjct: 367 CSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDV 426

Query: 555 DELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIG 614
             ++  L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YLE  G++LDL +I 
Sbjct: 427 QSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDLIII- 482

Query: 615 AYYGRGKRTGMYGGFLLGCYNQDTGEFE 642
                G+ +G    F+LG    D  E E
Sbjct: 483 -----GRDSGKKDSFMLGLLVIDEREME 505

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 114/454 (25%), Positives = 190/454 (41%), Gaps = 62/454 (13%)

Query: 342 DMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTK-A 400
           + +LL       +D    V +  +V +      I       S++ G    P LAK    +
Sbjct: 206 EHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIKVGFAFAPQLAKKVNLS 265

Query: 401 INEILDRFQGEIFTSEYKYDGERAQVHLLSDG-TMRIYSRNGENMTERYPEIHIRDFIAD 459
             +I    + + F  E K DGER QVH ++ G +++ +SR G + T  Y    +   I+ 
Sbjct: 266 YEKICHALRNDFFVEE-KMDGERIQVHYMNYGKSIKFFSRRGIDYTYLYGVNLLSGTISQ 324

Query: 460 PLVTST----LILDCEAVAWDNEQNKILPFQVL--STRKRXXXXXXXXXXXXCLF-AFDI 512
            L  S      +LD E V +D  +  ILPF ++  S ++              L+  FD+
Sbjct: 325 YLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFNDINNNDFHPLYMVFDL 384

Query: 513 LCHNDEKLINKSLRERRQILQEV---TKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSC 569
           L  N   L    L +R++ L  +   +KSV    +Y+      + + ++K L+ ++    
Sbjct: 385 LYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSR---CYDAESVKKSLEVAISLGS 441

Query: 570 EGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGKRTGMYGGF 629
           EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL +IG   G+ K + M G  
Sbjct: 442 EGVVLKHY---SSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGRDSGK-KDSFMLG-- 495

Query: 630 LLGCYNQDTGEFE----------------------------TCCKIGTGFSDEMLQQL-- 659
           LL    Q+TG+ +                            + C I  G S E  +++  
Sbjct: 496 LLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGISQEEFKEIDR 555

Query: 660 YTRLTPTVLDG--PKATFVYDSSAEPDVWFEP--TLLFEVLTADLSLSPIYKAGSSTYDK 715
            TR       G  P  + +   S  P  W EP  +++ E+ +  L  +   +     Y  
Sbjct: 556 KTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNT---ETNMQKYAT 612

Query: 716 GISLRFPRFIRTREDKGVEDATSSEQIIELYENQ 749
             +L      R R DK   D T    + ELYEN+
Sbjct: 613 NCTLYGGYCRRIRYDK---DWTECYTLDELYENR 643

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 122/279 (43%), Gaps = 32/279 (11%)

Query: 346 LETAEQKIRDAFCQVPNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKP-TKAINEI 404
           L+T   K+ D    + N ++ IN                  G P  P  AK  + +  +I
Sbjct: 243 LKTVANKLWDPAVHLKNDDLTINV-----------------GSPFAPQSAKKLSISYEKI 285

Query: 405 LDRFQGEIFTSEYKYDGERAQVHLLSDGT-MRIYSRNGENMTERYPEIHIRDFIADPLV- 462
             + + + F  E K DGER Q+H    G  +   SR G + T  Y E  I+D      + 
Sbjct: 286 CAKLKHDFFIEE-KMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGE-SIKDGTVSKYLH 343

Query: 463 ----TSTLILDCEAVAWDNEQNKILPFQVLSTRKRXXXXXXXXXXXX---CLFAFDILCH 515
                   +LD E V +D E+N +LPF ++ +  R                L  FD++  
Sbjct: 344 LDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYL 403

Query: 516 NDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVK 575
           N   L+N  L +R+  L+++        +       S+   ++  L+ ++    EG+++K
Sbjct: 404 NGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLK 463

Query: 576 MLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIG 614
             +   S Y  + R+ +W+K+K +YLE  G+++DL VIG
Sbjct: 464 HYN---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVIG 499

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 114/247 (46%), Gaps = 14/247 (5%)

Query: 398 TKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGT-MRIYSRNGENMTERYPEIHIRDF 456
           T + + I  R + + F  E K DGER Q+H ++ G  ++  SR G + +  Y +      
Sbjct: 285 TYSYDTIARRLKNDFFIEE-KMDGERIQLHYMNYGAKLKFLSRRGLDYSYLYGDNRNNGA 343

Query: 457 IADPLV----TSTLILDCEAVAWDNEQNKILPFQVLSTRKRXXXXXXXXX---XXXCLFA 509
           I   L         ILD E V +D+ +N ILPF ++ +                     A
Sbjct: 344 IGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSLSVSDIEPDGYHPLYMA 403

Query: 510 FDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSC 569
           FD++  N   L    L +R+  L ++        +    +  ++   ++  L++++    
Sbjct: 404 FDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCNDSSLIKSSLEKAIELGS 463

Query: 570 EGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGKRTGMYGGF 629
           EG+++K  D   S Y  +KRS +W+K+K +YLE  G+++DL VIG     GK+  +  G 
Sbjct: 464 EGIILKRFD---SQYLVAKRSDDWIKIKPEYLEQFGENMDLIVIGR--DPGKKDSLMCGL 518

Query: 630 LLGCYNQ 636
           +L   N+
Sbjct: 519 ILTGDNE 525

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 43/98 (43%), Gaps = 9/98 (9%)

Query: 382 CSLRPGI-PLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIYSRN 440
           C  R GI   KP+  + +K I      + G +  ++  +  ER  +  L  G   I S +
Sbjct: 7   CYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQPIVSDD 66

Query: 441 GENM----TERYPEIHIRDFIAD-PLVTSTLILDCEAV 473
           G  +     E Y  IH+RD  AD P  T   + DCE +
Sbjct: 67  GNYVLCVNGEIYNHIHLRDICADYPFST---LSDCEPI 101

>Kwal_23.5049 s23 (982874..989299) [6426 bp, 2141 aa] {ON} YFL007W
           (BLM3) - Involved in protecting the cell against
           bleomycin damage [contig 7] FULL
          Length = 2141

 Score = 31.6 bits (70), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 54/109 (49%), Gaps = 21/109 (19%)

Query: 98  ASTPSIPNISTDESTGPDLKKQKLEESNLEPS--KEPTIENVTQDST-------KPYF-- 146
           ++TP   ++  DE +   L +++LE  NL+ +  K   +EN+   S+       KP F  
Sbjct: 61  SATPLSSHMGGDEESYKTLLRKRLEHYNLDYAEDKHKHLENIYDPSSKWFCRDVKPDFII 120

Query: 147 -SSIPYREVCNLFQEIESTSSRLAII-KLCSDFFIKIMKENPQNLIPVT 193
            +S+PY        EIES + +   +  +  + +I I  ++ Q LIP++
Sbjct: 121 ENSLPY--------EIESHTEQAKYLCHVLVNLYIAICSQDIQGLIPIS 161

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,160,891
Number of extensions: 3402909
Number of successful extensions: 16086
Number of sequences better than 10.0: 307
Number of HSP's gapped: 16764
Number of HSP's successfully gapped: 414
Length of query: 753
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 636
Effective length of database: 40,065,477
Effective search space: 25481643372
Effective search space used: 25481643372
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)