Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0A14100singletonON65165134170.0
NDAI0H01220singletonON62060617670.0
NDAI0G00360na 1ON71061515460.0
NCAS0J00100singletonON63761715070.0
NCAS0G04080na 1ON69560715010.0
SAKL0E05346gsingletonON75161314910.0
SAKL0E05324gsingletonON69260814250.0
TDEL0G00230singletonON63359814190.0
TDEL0H00210singletonON70859513970.0
KAFR0A03580singletonON69059813930.0
NCAS0D02410na 2ON76160513930.0
NDAI0I02510na 2ON72467313690.0
KAFR0G01330singletonON67060613541e-179
NCAS0A07470singletonON67360413301e-175
NCAS0J00180singletonON64964913061e-172
NCAS0J00200singletonON64758113021e-172
NDAI0E02100singletonON63460112961e-171
NDAI0B04300singletonON70361812951e-170
TBLA0B04760singletonON82160512881e-167
Kpol_487.8singletonON71766512791e-167
NDAI0J00920singletonON61055312161e-159
TBLA0C07230singletonON72661512221e-158
TBLA0G03660singletonON70959711991e-155
TBLA0C07290singletonON67559911831e-153
TBLA0B00680singletonON71161711771e-152
TBLA0D00120singletonON66560811611e-150
TBLA0B04770singletonON70959311571e-149
TBLA0C07240singletonON68757911491e-148
TBLA0B00700singletonON71459811401e-146
TBLA0H03920singletonON62460211141e-144
TBLA0C07250singletonON69260110601e-135
KNAG0E03160singletonON61958310231e-130
KAFR0G00110singletonON3423449961e-130
TBLA0C07280singletonON75462910121e-127
TBLA0B00690singletonON6745879871e-124
TBLA0F01560singletonON7086179891e-124
KNAG0D03060singletonON6315849481e-119
KNAG0E04230singletonON5975079401e-118
TBLA0B04780singletonON6806079361e-116
Kpol_457.16singletonON5414628921e-112
CAGL0B02948gsingletonON5974548971e-112
CAGL0B02882gsingletonON6164498491e-104
CAGL0B02970gsingletonON6295548461e-104
CAGL0D00286gsingletonON7335838371e-101
TBLA0C07270singletonON7426268341e-101
CAGL0B02926gsingletonON6185648251e-101
SAKL0H24090gsingletonON5786128122e-99
CAGL0B02904gsingletonON6054637872e-95
TBLA0G00100singletonON6396017422e-88
CAGL0K12980gsingletonON7225504304e-44
TBLA0G03700singletonON7234463392e-32
Kpol_1008.1singletonON74742161e-20
TBLA0D00130singletonON3162492074e-17
CAGL0D06710gsingletonON3812211313e-07
CAGL0K05621g5.690ON76846761.6
KAFR0I028903.17ON42655751.9
SAKL0A01650gna 3ON169447742.9
CAGL0D02310g7.37ON70989724.7
Ecym_30246.20ON107957716.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0A14100
         (651 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0A14100 Chr1 (2772160..2774115) [1956 bp, 651 aa] {ON}           1320   0.0  
NDAI0H01220 Chr8 complement(290645..292507) [1863 bp, 620 aa] {O...   685   0.0  
NDAI0G00360 Chr7 complement(61916..64048) [2133 bp, 710 aa] {ON}      600   0.0  
NCAS0J00100 Chr10 (30..1943) [1914 bp, 637 aa] {ON}                   585   0.0  
NCAS0G04080 Chr7 (762649..764736) [2088 bp, 695 aa] {ON}              582   0.0  
SAKL0E05346g Chr5 complement(439917..442172) [2256 bp, 751 aa] {...   578   0.0  
SAKL0E05324g Chr5 (436428..438506) [2079 bp, 692 aa] {ON} weakly...   553   0.0  
TDEL0G00230 Chr7 complement(44234..46135) [1902 bp, 633 aa] {ON}      551   0.0  
TDEL0H00210 Chr8 complement(25089..27215) [2127 bp, 708 aa] {ON}      542   0.0  
KAFR0A03580 Chr1 complement(731876..733948) [2073 bp, 690 aa] {O...   541   0.0  
NCAS0D02410 Chr4 complement(458364..460649) [2286 bp, 761 aa] {O...   541   0.0  
NDAI0I02510 Chr9 (579118..581292) [2175 bp, 724 aa] {ON}              531   0.0  
KAFR0G01330 Chr7 (297931..299943) [2013 bp, 670 aa] {ON}              526   e-179
NCAS0A07470 Chr1 complement(1482301..1484322) [2022 bp, 673 aa] ...   516   e-175
NCAS0J00180 Chr10 complement(20130..22079) [1950 bp, 649 aa] {ON}     507   e-172
NCAS0J00200 Chr10 complement(24719..26662) [1944 bp, 647 aa] {ON}     506   e-172
NDAI0E02100 Chr5 complement(426032..427936) [1905 bp, 634 aa] {O...   503   e-171
NDAI0B04300 Chr2 (1081332..1083443) [2112 bp, 703 aa] {ON}            503   e-170
TBLA0B04760 Chr2 complement(1118043..1120508) [2466 bp, 821 aa] ...   500   e-167
Kpol_487.8 s487 (41650..43803) [2154 bp, 717 aa] {ON} (41650..43...   497   e-167
NDAI0J00920 Chr10 complement(203498..205330) [1833 bp, 610 aa] {...   473   e-159
TBLA0C07230 Chr3 (1755294..1757474) [2181 bp, 726 aa] {ON}            475   e-158
TBLA0G03660 Chr7 complement(970121..972250) [2130 bp, 709 aa] {O...   466   e-155
TBLA0C07290 Chr3 (1775736..1777763) [2028 bp, 675 aa] {ON}            460   e-153
TBLA0B00680 Chr2 (145277..147412) [2136 bp, 711 aa] {ON}              457   e-152
TBLA0D00120 Chr4 complement(19863..21860) [1998 bp, 665 aa] {ON}      451   e-150
TBLA0B04770 Chr2 complement(1121182..1123311) [2130 bp, 709 aa] ...   450   e-149
TBLA0C07240 Chr3 (1759547..1761610) [2064 bp, 687 aa] {ON}            447   e-148
TBLA0B00700 Chr2 (152367..154511) [2145 bp, 714 aa] {ON}              443   e-146
TBLA0H03920 Chr8 (950326..952200) [1875 bp, 624 aa] {ON}  possib...   433   e-144
TBLA0C07250 Chr3 complement(1761923..1764001) [2079 bp, 692 aa] ...   412   e-135
KNAG0E03160 Chr5 complement(630192..632051) [1860 bp, 619 aa] {O...   398   e-130
KAFR0G00110 Chr7 (27758..28786) [1029 bp, 342 aa] {ON}                388   e-130
TBLA0C07280 Chr3 complement(1770359..1772623) [2265 bp, 754 aa] ...   394   e-127
TBLA0B00690 Chr2 (149162..151186) [2025 bp, 674 aa] {ON}              384   e-124
TBLA0F01560 Chr6 complement(387571..389697) [2127 bp, 708 aa] {O...   385   e-124
KNAG0D03060 Chr4 (549174..551069) [1896 bp, 631 aa] {ON}              369   e-119
KNAG0E04230 Chr5 (841386..843179) [1794 bp, 597 aa] {ON}              366   e-118
TBLA0B04780 Chr2 complement(1124158..1126200) [2043 bp, 680 aa] ...   365   e-116
Kpol_457.16 s457 (47317..48939) [1623 bp, 541 aa] {ON} (47317..4...   348   e-112
CAGL0B02948g Chr2 complement(288006..289799) [1794 bp, 597 aa] {...   350   e-112
CAGL0B02882g Chr2 complement(279334..281184) [1851 bp, 616 aa] {...   331   e-104
CAGL0B02970g Chr2 complement(291248..293137) [1890 bp, 629 aa] {...   330   e-104
CAGL0D00286g Chr4 (37583..39784) [2202 bp, 733 aa] {ON} weakly s...   327   e-101
TBLA0C07270 Chr3 complement(1767045..1769273) [2229 bp, 742 aa] ...   325   e-101
CAGL0B02926g Chr2 complement(284897..286753) [1857 bp, 618 aa] {...   322   e-101
SAKL0H24090g Chr8 (2078621..2080357) [1737 bp, 578 aa] {ON} weak...   317   2e-99
CAGL0B02904g Chr2 complement(282093..283910) [1818 bp, 605 aa] {...   307   2e-95
TBLA0G00100 Chr7 (3376..5295) [1920 bp, 639 aa] {ON}                  290   2e-88
CAGL0K12980g Chr11 complement(1283966..1286134) [2169 bp, 722 aa...   170   4e-44
TBLA0G03700 Chr7 (979774..981945) [2172 bp, 723 aa] {ON}              135   2e-32
Kpol_1008.1 s1008 (1..225) [225 bp, 74 aa] {ON} (1..225) [225 nt...    88   1e-20
TBLA0D00130 Chr4 complement(25176..26126) [951 bp, 316 aa] {ON}        84   4e-17
CAGL0D06710g Chr4 complement(641982..643127) [1146 bp, 381 aa] {...    55   3e-07
CAGL0K05621g Chr11 complement(548043..550349) [2307 bp, 768 aa] ...    34   1.6  
KAFR0I02890 Chr9 complement(579777..581057) [1281 bp, 426 aa] {O...    33   1.9  
SAKL0A01650g Chr1 (149814..154898) [5085 bp, 1694 aa] {ON} simil...    33   2.9  
CAGL0D02310g Chr4 complement(237084..239213) [2130 bp, 709 aa] {...    32   4.7  
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...    32   6.8  

>NCAS0A14100 Chr1 (2772160..2774115) [1956 bp, 651 aa] {ON} 
          Length = 651

 Score = 1320 bits (3417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/651 (98%), Positives = 639/651 (98%)

Query: 1   MAAPLVSDSKRVLLFMMRKLSISLQTRKIYKLIVTXXXXXXXXXXXXQSRYSDNDSIRSI 60
           MAAPLVSDSKRVLLFMMRKLSISLQTRKIYKLIVT            QSRYSDNDSIRSI
Sbjct: 1   MAAPLVSDSKRVLLFMMRKLSISLQTRKIYKLIVTLLICLFIPLIIIQSRYSDNDSIRSI 60

Query: 61  KYKYNSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNLE 120
           KYKYNSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNLE
Sbjct: 61  KYKYNSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNLE 120

Query: 121 SQGGKDRATIGDYEREATCDTLQYINKVEYSKETKYLPLDLVRVRKELMTNPKFEFLRKQ 180
           SQGGKDRATIGDYEREATCDTLQYINKVEYSKETKYLPLDLVRVRKELMTNPKFEFLRKQ
Sbjct: 121 SQGGKDRATIGDYEREATCDTLQYINKVEYSKETKYLPLDLVRVRKELMTNPKFEFLRKQ 180

Query: 181 MHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSKIPRRNHPHFSLVA 240
           MHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSKIPRRNHPHFSLVA
Sbjct: 181 MHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSKIPRRNHPHFSLVA 240

Query: 241 AQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCDHLKAIGKDASFDKCVE 300
           AQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCDHLKAIGKDASFDKCVE
Sbjct: 241 AQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCDHLKAIGKDASFDKCVE 300

Query: 301 EQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDPHVIMKGGINGDGIEE 360
           EQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDPHVIMKGGINGDGIEE
Sbjct: 301 EQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDPHVIMKGGINGDGIEE 360

Query: 361 PLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFVKQSNTESA 420
           PLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFVKQSNTESA
Sbjct: 361 PLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFVKQSNTESA 420

Query: 421 FSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEFLSMRGSTQFYKLPSDL 480
           FSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEFLSMRGSTQFYKLPSDL
Sbjct: 421 FSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEFLSMRGSTQFYKLPSDL 480

Query: 481 PQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELVVPSLDFGINVLSWD 540
           PQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELVVPSLDFGINVLSWD
Sbjct: 481 PQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELVVPSLDFGINVLSWD 540

Query: 541 LKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSNTEIVVVKGLLNYVL 600
           LKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSNTEIVVVKGLLNYVL
Sbjct: 541 LKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSNTEIVVVKGLLNYVL 600

Query: 601 GIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKTHPESDKDS 651
           GIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKTHPESDKDS
Sbjct: 601 GIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKTHPESDKDS 651

>NDAI0H01220 Chr8 complement(290645..292507) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/606 (55%), Positives = 437/606 (72%), Gaps = 20/606 (3%)

Query: 50  RYSDNDSIRSIKYKYNSLQNIKT-VAQKKDLLNIDLTKTLRFK-DFNRSPVHIETLGQKY 107
           + ++N  I  I + Y +L+N +  +  KKD LN+D++  L+FK ++  SP+   T  Q+Y
Sbjct: 22  KLTNNLPIEQIGHHYYALKNSRNQIKSKKDFLNVDISNLLKFKKNWINSPIRSITRTQEY 81

Query: 108 TENQLLGYVSNLESQGGKDRATIGDYEREATCDTLQYINKVEYSKETKYLPLDLVRVRKE 167
           ++  L+GYVSNL+ +  K  +     E  A+C  L+YIN +EYS     LP DL  VR+E
Sbjct: 82  SKKSLVGYVSNLDLKDEKKGS-----EYSASCSDLEYINDIEYSYWVHTLPSDLKEVRRE 136

Query: 168 LMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSK 227
           L+T+P FEF+  Q+H+  D E +  + +I++K W TFGGVSVWS  Y  +FVYSRVI+S+
Sbjct: 137 LLTSPAFEFVEPQLHS--DLEINWDEEKILEKNWLTFGGVSVWSKRYNVYFVYSRVIYSR 194

Query: 228 IPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKC---- 283
             +RNHPH SLV  Q FDK+WNEI G KVP+ D+ +P D E EL+KLD DLGLY C    
Sbjct: 195 KAQRNHPHVSLVRGQVFDKDWNEIHGFKVPFNDIIVPKDDEVELQKLDEDLGLYDCKKQL 254

Query: 284 DHLKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPE 343
            H +       ++ C+ E  K+KLK EKRK EI+ KY+ +YP+VL I F S    Y GPE
Sbjct: 255 GHKEKELASNEYENCLVEVNKLKLKNEKRKKEILQKYYTIYPTVLNIPFISTGADYEGPE 314

Query: 344 DPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRI 403
           DPH+IM+        EEPL+FFNM DH +D  R+++ F PH+K++P+I   INGR +K  
Sbjct: 315 DPHIIMRETAE---FEEPLIFFNMQDH-NDGKRKLYGFLPHQKSDPLIEFHINGRGIKGK 370

Query: 404 EKNWAPFFVKQSN---TESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTK 460
           EKNW PFF   S+    ES FSRGT+H IYSF+PLEILKCSLNDG C+ VFE  TLE  K
Sbjct: 371 EKNWVPFFHADSSKGQAESQFSRGTIHFIYSFYPLEILKCSLNDGDCEFVFEGSTLELDK 430

Query: 461 ESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGV 520
           ++EF  MRGSTQF  LP+ +P + GKQ+WVGFPKFHLNGCGCG KYYRPM+SV+VE NGV
Sbjct: 431 DTEFSGMRGSTQFINLPNVIPTLAGKQLWVGFPKFHLNGCGCGVKYYRPMLSVIVESNGV 490

Query: 521 YNLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTV 580
           Y+ ELVVP+LDF I+VLSWDLKGHYCFDVNVLNPNSINYWE+V+Q+P T +++DYMSLTV
Sbjct: 491 YHQELVVPTLDFNIDVLSWDLKGHYCFDVNVLNPNSINYWEVVSQDPVTKKYEDYMSLTV 550

Query: 581 SEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEY 640
           SEAD NT++V+VKGLLNY+LGIY+DK +KEDF+I + +N II ++V C+ K T+ DCK Y
Sbjct: 551 SEADHNTKVVIVKGLLNYILGIYKDKNIKEDFQITEHANSIIAESVKCIDKDTKQDCKNY 610

Query: 641 GKTHPE 646
           GKTHPE
Sbjct: 611 GKTHPE 616

>NDAI0G00360 Chr7 complement(61916..64048) [2133 bp, 710 aa] {ON} 
          Length = 710

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/615 (48%), Positives = 432/615 (70%), Gaps = 37/615 (6%)

Query: 56  SIRSIKYKY-NSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLG 114
           SI+ + Y+Y N++   K V++K+DLLNID+T+ LRFK++  SP+  +   Q Y E++L+G
Sbjct: 105 SIQKVGYQYYNTIYGSKEVSRKEDLLNIDVTQKLRFKNWENSPITHQMRHQDYIEDELIG 164

Query: 115 YVSNLE------------------SQGGK--DRATIGDYEREATCDTLQYINKVEYSKET 154
           YVSNL+                    G K  +     DY+    C+ LQY N +E+S+  
Sbjct: 165 YVSNLDLKKLNIEKDNDDNDNNGHGHGSKKLENEFHKDYDTLVKCEDLQYTNIIEHSRWN 224

Query: 155 KYLPLDLVRVRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEY 214
           K L  DL+ +R++L  N KF  L K++ ++N  EKD S+ +I+ ++W  FGG SVW +  
Sbjct: 225 KILEDDLMELRRDLRKNDKF--LGKELSSDN--EKDWSEEKIINEHWMRFGGSSVWLERE 280

Query: 215 QCFFVYSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKL 274
           QC  ++SR+++++   R+HPH S++ AQAFDK+WNE+IG ++PY DL    D+E E++KL
Sbjct: 281 QCHVMFSRIVYTRNGVRDHPHVSMIRAQAFDKDWNELIGKRIPYNDLIPHKDIELEIQKL 340

Query: 275 DNDLGLYKCDHLKAIGKDAS-FDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFK 333
           D +LG++ CDHLK   KD + ++ CV + T+ +++A+KRK+EI+S+YF  YP+VL+I++ 
Sbjct: 341 DEELGMHSCDHLK---KDKTLYETCVVDNTRREMEAKKRKEEILSQYFITYPTVLDIKY- 396

Query: 334 SADKSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRM 393
           + +  + GPEDPHVI++     D +EEPLV FNM D   +  RR+F+F PHR+  P+I+ 
Sbjct: 397 NTNGDWKGPEDPHVILR---KTDNMEEPLVIFNMEDD-EEEKRRVFSFMPHRRNTPLIKF 452

Query: 394 TI--NGRKVKRIEKNWAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVF 451
           T+    RK K  EKNWAPFF  Q+++ESAFSRG ++ IYSF PLEILKCSLNDGIC+ VF
Sbjct: 453 TLPDASRKFKEKEKNWAPFF-HQTSSESAFSRGIIYFIYSFSPLEILKCSLNDGICEMVF 511

Query: 452 EADTLESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMI 511
           EA TL+ + +++F  MRG TQF  LP  LP VKGKQIWVGFPK H+  CGCG ++YRPM+
Sbjct: 512 EAKTLDLSDDNKFGGMRGGTQFVPLPELLPHVKGKQIWVGFPKLHIEHCGCGERFYRPML 571

Query: 512 SVLVEHNGVYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLE 571
           S+LVE NGVY+ EL VP +DF ++VLSWD KG +C   NVL+PNSI+ WE+ +Q      
Sbjct: 572 SLLVESNGVYHQELAVPDIDFDMDVLSWDQKGTHCGQHNVLSPNSIDSWEVASQTSHPKR 631

Query: 572 FDDYMSLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAK 631
           F+DYM+LT SEAD+NT +++++G+LNY+L +Y++K M E+FE++K S++IIG+T+ CV K
Sbjct: 632 FEDYMTLTFSEADANTRVIILRGILNYILNMYKEKDMMENFEVSKKSSIIIGQTLKCVVK 691

Query: 632 ATRDDCKEYGKTHPE 646
            +++DCK YG  HPE
Sbjct: 692 QSKEDCKVYGDAHPE 706

>NCAS0J00100 Chr10 (30..1943) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/617 (47%), Positives = 430/617 (69%), Gaps = 33/617 (5%)

Query: 55  DSIRSIKYKY-NSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLL 113
           +S++ + Y+Y NS    + V +K+DLL  D+T  LRFK++++SP++     Q++ +++L 
Sbjct: 33  ESLQMLGYQYYNSNYGAQVVNRKEDLLKTDITTKLRFKNWSQSPLNDRIRNQEFVKDKLT 92

Query: 114 GYVSNLESQ-----------------GGKDRATIG-DYEREATCDTLQYINKVEYSKETK 155
           GY+SNL  +                 GGK+ A    DY+    C+ LQY+N VE+S+  K
Sbjct: 93  GYISNLNLEKHHSKFASGGSHSHRQLGGKNEAEFHKDYDSLVKCEDLQYVNTVEHSEWNK 152

Query: 156 YLPLDLVRVRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQ 215
            L  DL+ +R++L+ N   +FL K +   + +EK+ S+ EI+ K+WF FGG SVW D+Y+
Sbjct: 153 VLDDDLLTLRRDLLKNN--DFLGKDI--TDPSEKNWSEEEIINKHWFRFGGSSVWLDKYE 208

Query: 216 CFFVYSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLD 275
           C  V+SRV++++   R+HPH S++ AQAFD++WNEI   ++PY D+  P D++ EL+KLD
Sbjct: 209 CHLVFSRVLYARKGVRDHPHVSMIRAQAFDRDWNEIKEKRIPYNDITHPKDLDLELKKLD 268

Query: 276 NDLGLYKCDHLKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSA 335
           ++LGL+ CD +K   ++  FD CV E TK K+  EKRK++I+S+YF  YP+VL+I +++A
Sbjct: 269 HELGLFPCDSIKHNTEE--FDACVVEHTKSKIVTEKRKEKIMSRYFLTYPTVLDIRYRAA 326

Query: 336 DKSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTI 395
              +LGPEDPHVI++       IEEP+V FNM D   +  RR+F+F P RK  P+++  I
Sbjct: 327 G-DWLGPEDPHVIVR---KTKDIEEPVVIFNMYDG-GEGARRVFSFMPSRKNTPLLKFNI 381

Query: 396 N--GRKVKRIEKNWAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEA 453
           N  GRK    EKNW PFF  Q   ESAFSRG++H IY+F PLEILKCSLNDG+C  VFEA
Sbjct: 382 NDSGRKFNSWEKNWTPFF-HQHLAESAFSRGSIHFIYTFSPLEILKCSLNDGVCSMVFEA 440

Query: 454 DTLESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISV 513
            TL+ +K+++F   RG TQ+  LP  LPQVK KQIWVGFPK H++ CGCG K+YRPM+S+
Sbjct: 441 KTLDLSKDNKFGGWRGGTQYIPLPEVLPQVKNKQIWVGFPKLHIDRCGCGLKFYRPMLSL 500

Query: 514 LVEHNGVYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFD 573
           LVE NG Y+ EL VP +DF ++VLSWD KG +C  +NVL+PN+I+YWE+ +Q   + +++
Sbjct: 501 LVESNGAYHQELAVPDIDFDMDVLSWDQKGTHCGQLNVLSPNAISYWEVASQAHHSKKYE 560

Query: 574 DYMSLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKAT 633
           DYM+L+ SEAD+NT ++V++G+LNY+L IY  K + EDFE++  S++IIG+T+ CV +  
Sbjct: 561 DYMALSFSEADANTRVIVLRGILNYILEIYEKKAIMEDFEVSSKSDLIIGRTLKCVVQKA 620

Query: 634 RDDCKEYGKTHPESDKD 650
           ++DCK YGK+HPE  KD
Sbjct: 621 KEDCKAYGKSHPEPKKD 637

>NCAS0G04080 Chr7 (762649..764736) [2088 bp, 695 aa] {ON} 
          Length = 695

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/607 (48%), Positives = 426/607 (70%), Gaps = 32/607 (5%)

Query: 64  YNSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNLE--- 120
           YNS    + V +K+DLL +D+   LRFK++++SP++ +   Q++ E++L GYVSNL+   
Sbjct: 101 YNSKYGARQVNEKEDLLKVDIIPKLRFKNWSQSPLNDQIRNQQFVEDELTGYVSNLDLKK 160

Query: 121 -----SQG---------GKDRATIG-DYEREATCDTLQYINKVEYSKETKYLPLDLVRVR 165
                +QG         GK  A    DY+    C  L+Y+NKVE+SK  K L  DL+ +R
Sbjct: 161 HRFKMAQGDSHDHHRFSGKGEAEFHKDYDSLVKCQDLEYVNKVEHSKWNKLLDDDLLTLR 220

Query: 166 KELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIF 225
           ++L+ N   +FL+K +   N  E D S+ +I+ K+WF FGG SVW ++YQC  V+SRVI+
Sbjct: 221 RDLLKND--DFLKKLITDRN--ENDWSEEDIINKHWFRFGGSSVWLNQYQCHLVFSRVIY 276

Query: 226 SKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCDH 285
           S +  R+HP  S+V  QAFD++WNE+   ++P+ D+  P +++ ELE+LD++LGLY CD 
Sbjct: 277 SSLGIRDHPRISMVRVQAFDRDWNELKEKRIPFNDITHPQELDLELERLDHELGLYPCDT 336

Query: 286 LKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDP 345
            K   ++  FD C+ E TK K+K E+RK++I+SKYF  YP+VL+I +K  +  + GPEDP
Sbjct: 337 FKHSPEE--FDACIVEHTKSKIKNERRKEKILSKYFITYPTVLDIRYK-PEGDWKGPEDP 393

Query: 346 HVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTING--RKVKRI 403
           HVI++     + IEEP+V FNM D   + +RRMF+F PHRK  P+++ ++N   RK+   
Sbjct: 394 HVIVR---RTNEIEEPVVVFNMYDD-DEEHRRMFSFMPHRKNSPLLKFSLNDGDRKLGDK 449

Query: 404 EKNWAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESE 463
           EKNW PFF  Q N ESAFSRG++H IY+F PLEILKCSLNDG+C  VFEA TL+ +++++
Sbjct: 450 EKNWTPFF-HQDNVESAFSRGSIHFIYTFSPLEILKCSLNDGVCTVVFEAKTLDLSEDNK 508

Query: 464 FLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNL 523
           F   RG TQ+  LP  LPQVK KQIW+GFPK H++ CGCG K+YRPM+S+L E NGVY+ 
Sbjct: 509 FGGWRGGTQYIPLPEVLPQVKNKQIWIGFPKLHIDHCGCGEKFYRPMLSLLAESNGVYHQ 568

Query: 524 ELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEA 583
           EL V ++DF ++VLSWD KG +C  +NVL+PN+I+YWE+ +Q P T +F+DY++L+ SEA
Sbjct: 569 ELAVTAIDFDMDVLSWDQKGTHCGQLNVLSPNAISYWEVASQGPHTKKFEDYLALSFSEA 628

Query: 584 DSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKT 643
           DSNT ++V++G+LNY+LGIY  K +  +FE++  S+ IIG+T+ CV + +++DCK YG++
Sbjct: 629 DSNTRVIVLRGVLNYILGIYEKKAIMPNFEVSSKSDSIIGQTLKCVVQKSKEDCKAYGES 688

Query: 644 HPESDKD 650
           HPE  KD
Sbjct: 689 HPEPKKD 695

>SAKL0E05346g Chr5 complement(439917..442172) [2256 bp, 751 aa] {ON}
           weakly similar to gnl|GLV|CAGL0B02926g Candida glabrata
           CAGL0B02926g
          Length = 751

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/613 (45%), Positives = 418/613 (68%), Gaps = 29/613 (4%)

Query: 55  DSIRSIKYKYNS-LQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLL 113
           D++   K +Y+S  +   TV++KKDLL++DL+KTLRFK    SP+    L Q Y  + ++
Sbjct: 106 DAVVKTKSQYHSSFKTYSTVSRKKDLLSVDLSKTLRFKTLKTSPITERVLNQDYRSDTVI 165

Query: 114 GYVSNLESQGGKDRATI-----------------GDYEREATCDTLQYINKVEYSKETKY 156
           GY+SNL++   K +  +                   Y+ + TC  L+Y  K+EYSK +K 
Sbjct: 166 GYISNLDTGSIKPQNPLRKRKDNEEGYSDVLTHHQSYDTQVTCHDLEYQGKIEYSKWSKV 225

Query: 157 LPLDLVRVRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQC 216
           L  DL++++ +++ N    + R      +++EK  SD +I+++ WF FGG SVW ++ QC
Sbjct: 226 LDDDLIQLKNDIIEN----WPRLAPEVQDESEKGWSDEKILKENWFRFGGSSVWLEKEQC 281

Query: 217 FFVYSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDN 276
           + + SRVI+S+   +++ H SL+  QAFDK WNEI G ++ Y D+  P +++KELEKLD 
Sbjct: 282 YLMVSRVIYSRRHWKSYAHISLLRVQAFDKEWNEIKGKRIAYNDILQPENLDKELEKLDE 341

Query: 277 DLGLYKCDHLKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSAD 336
            LGL  C+ L    + + +  CV +  +  L+A+KRK +I+S+Y   +P++L+++F+  +
Sbjct: 342 HLGLVDCEVLDP--ESSEYSSCVTKNNERYLEAQKRKKKIVSQYAITFPTILDVDFEIQE 399

Query: 337 KSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTIN 396
           + + GPEDP +I+K     DG E+P++ FNM D  S+  R M+ + PH+K + +++  I 
Sbjct: 400 Q-WSGPEDPRIILKR--EEDGTEDPVILFNMND-ASEGKRFMYGYFPHKKIDRLVKFRIR 455

Query: 397 GRKVKRIEKNWAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTL 456
           GR+ K  EKNW PFF + + T    +RG +H +Y+  PLEILKCSLNDG CD VFEA TL
Sbjct: 456 GREAKSKEKNWTPFFHRNTETH-IITRGFIHFVYNHSPLEILKCSLNDGFCDVVFEAKTL 514

Query: 457 ESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVE 516
           E +  S+   +RG TQ+  LP  LP V+GKQIWVGFPK H+NGCGCG ++YRPM+S+LVE
Sbjct: 515 EISDGSKVAGIRGGTQYVPLPDILPTVEGKQIWVGFPKVHINGCGCGKQFYRPMLSLLVE 574

Query: 517 HNGVYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYM 576
           H GVY+ EL+VP LDFG+++LSWDLKG YC+++N+L+PNSI+YWE+V Q+PKT++F+DY+
Sbjct: 575 HKGVYHQELMVPVLDFGMDILSWDLKGDYCWEINILSPNSISYWEVVGQDPKTMKFEDYL 634

Query: 577 SLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDD 636
           + TVSEADSNT +++++GLLNYVLGIY  K MKE FEI++ S+ I+GKT+ CV    +D+
Sbjct: 635 AFTVSEADSNTRVIILRGLLNYVLGIYHQKAMKESFEISEDSDAIVGKTLKCVMTGVKDN 694

Query: 637 CKEYGKTHPESDK 649
           CK YG++HP  D+
Sbjct: 695 CKAYGESHPTPDE 707

>SAKL0E05324g Chr5 (436428..438506) [2079 bp, 692 aa] {ON} weakly
           similar to gnl|GLV|CAGL0B02926g Candida glabrata
           CAGL0B02926g
          Length = 692

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/608 (46%), Positives = 401/608 (65%), Gaps = 29/608 (4%)

Query: 56  SIRSIKYKYNS-LQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLG 114
           ++ S +Y+Y+S L + K V+ KKDLLN+D+++ L+FK ++ SP+  + + Q +   +L+G
Sbjct: 92  ALNSARYRYHSSLSSKKEVSHKKDLLNVDISQMLKFKSWDDSPITHDVVSQDFETGKLVG 151

Query: 115 YVSNL-------------ESQGGKDRATIGD----YEREATCDTLQYINKVEYSKETKYL 157
           YVSNL              S   +D A + D    Y+   TC  L+Y N  EYSKE K L
Sbjct: 152 YVSNLAMGLTGKADSLARRSSSKEDFADVLDSHESYDTRVTCKDLEYTNTFEYSKEKKVL 211

Query: 158 PLDLVRVRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCF 217
             DL+++R++++ N     L      + +AEKD    +IV++ WF FG  +VW ++ +C+
Sbjct: 212 EDDLIQLRQDIIDN--MPHLASAF--DTEAEKDWPPAKIVKERWFRFGSSAVWLEKEKCY 267

Query: 218 FVYSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDND 277
            V SRV++S    +++P FSLV  QAFD++W EI G KV Y D+  P D+E EL+K++++
Sbjct: 268 LVVSRVMYSTRGIKDYPKFSLVRVQAFDRDWKEIKGKKVRYNDVRQPDDLEAELDKINSE 327

Query: 278 LGLYKCDHLKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADK 337
           +GL+ C   K    + S   C+ E TK  L A++RK +I SKY   YP++L+IEF + D 
Sbjct: 328 MGLHDCKKFKHGSSEHS--ACLVENTKRTLSAQRRKQKIASKYVITYPTLLDIEFPT-DG 384

Query: 338 SYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTING 397
           S  GPEDP +I+K G   D  EEP++ FNM D  S+  R M  + PHRKTEPMI+  I  
Sbjct: 385 SLRGPEDPRIIVKRG--NDVSEEPVILFNMKDE-SEGKRFMHAYLPHRKTEPMIKFRIQN 441

Query: 398 RKVKRIEKNWAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLE 457
           R  +  EKNW PFF      +S  SRG +H +YSF PLEILKCSL DG C+ VFEADTL+
Sbjct: 442 RSPRSSEKNWTPFF-HDDIEDSIISRGIIHFVYSFSPLEILKCSLTDGNCELVFEADTLD 500

Query: 458 STKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEH 517
            ++ ++F  +RG TQ+  LP  LP+VKGK +W GFPK HLN CGCG K+YRPM+++L+EH
Sbjct: 501 ISQNNKFGGIRGGTQYIPLPDVLPRVKGKHLWFGFPKLHLNDCGCGKKFYRPMLNLLLEH 560

Query: 518 NGVYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMS 577
           +GVY+ EL+VPSLDFG+++LSWD K   C  VN+L+PNSI YW +V Q   + EF+DYM 
Sbjct: 561 DGVYHEELLVPSLDFGMDILSWDEKNTECSGVNILSPNSITYWAVVGQKLGSKEFEDYME 620

Query: 578 LTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDC 637
           +TVSEADS ++ +V+KG+LNYVLGIY++K ++E F +++ SN I+G T+ CV K   D C
Sbjct: 621 ITVSEADSVSKQLVLKGVLNYVLGIYKEKDIRETFSVSEQSNTIVGHTLKCVVKGAEDSC 680

Query: 638 KEYGKTHP 645
           K YG+ HP
Sbjct: 681 KVYGEKHP 688

>TDEL0G00230 Chr7 complement(44234..46135) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/598 (44%), Positives = 400/598 (66%), Gaps = 32/598 (5%)

Query: 68  QNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNL-------- 119
           +N +TV +K DLLN D+++ L+ + ++ SP++     QKY + +++ + SNL        
Sbjct: 41  RNKQTVQRKTDLLNADISQALKRQPWDLSPINHRITKQKYEDEEVVAFASNLDVDKVLVK 100

Query: 120 --------ESQGGKDRATIG--DYEREATCDTLQYINKVEYSKETKYLPLDLVRVRKELM 169
                   E  G +   T G  DY+   TC+ L Y + +++S+E   L  DL  +R  LM
Sbjct: 101 KAKAAKKNEQDGNQLGLTFGSKDYKNSITCEDLAYRSVIQHSQEKAQLHDDLAELRHRLM 160

Query: 170 TNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSKIP 229
           + P F  L K++   +  E++++  EI++K W+ FG  +VW +  QC+ VYSRVI+S   
Sbjct: 161 SVPNF--LSKEVTGED--EEEMTVPEIIEKKWYQFGSSAVWLESEQCYVVYSRVIYSSNH 216

Query: 230 RRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCDHLKAI 289
            +NHPH SLV AQAFDK+WNEI G ++PYVD+  PAD++  L ++D ++G+  C   ++ 
Sbjct: 217 IKNHPHLSLVRAQAFDKDWNEIKGKRIPYVDVPRPADMQAALRQIDEEIGISDCSVHRS- 275

Query: 290 GKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDPHVIM 349
               ++D CV E T+  L A+KR++ I+SK++  YP++L I FK+ D  + GPEDPHV++
Sbjct: 276 -NQLAYDACVVENTRNGLTADKRRESILSKFYMTYPTILNIPFKT-DGDWKGPEDPHVVL 333

Query: 350 KGGINGDGIEEPLVFFNMLDHYSDSNRR-MFTFSPHRKTEPMIRMTINGRKVKRIEKNWA 408
           +   +G   EEP+V +N+ D   D +RR M  F PHRK EPM++ +I GR+ + IEKNW 
Sbjct: 334 RRTEHG---EEPVVIYNIRD--EDLDRRIMVAFLPHRKIEPMVKFSIGGREQREIEKNWT 388

Query: 409 PFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEFLSMR 468
           PFF +    ES  SRG +H IYSF PLEILKCSLNDG+C+ VFEADTL+ ++ ++F  +R
Sbjct: 389 PFFHRNVG-ESLISRGFIHFIYSFSPLEILKCSLNDGVCNLVFEADTLKISESNKFGGIR 447

Query: 469 GSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELVVP 528
           G TQF  LP  LPQV G Q+W+GFPK H++ CGCG  YYRPM SVLVE +GVY+ E++VP
Sbjct: 448 GGTQFIPLPDVLPQVDGAQVWIGFPKQHIDECGCGSVYYRPMFSVLVERDGVYSQEMMVP 507

Query: 529 SLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSNTE 588
           ++ F ++VL+WDLK   C + N+L+PNSI YW +  Q+P T +++DY+ +TVSEADS ++
Sbjct: 508 AMGFNMDVLAWDLKTTACKETNILSPNSIAYWGVAGQDPHTRKYEDYLIITVSEADSISK 567

Query: 589 IVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKTHPE 646
           ++ +KG+LNY+LGIYR+K + E F IN+ ++ IIG+T+ C+  +  D CK YG+ HPE
Sbjct: 568 VITLKGVLNYILGIYREKDIMEKFAINEQADEIIGQTLHCLISSAFDSCKAYGEAHPE 625

>TDEL0H00210 Chr8 complement(25089..27215) [2127 bp, 708 aa] {ON} 
          Length = 708

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/595 (44%), Positives = 393/595 (66%), Gaps = 26/595 (4%)

Query: 62  YKYNSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNL-- 119
           Y   SL+N   V +K +LL++D+++ L+ + ++ SP+    L Q+Y   ++ G+VSNL  
Sbjct: 81  YGSKSLRNTDFVERKPELLHVDISELLKRRQWSSSPITERMLNQEYLSEKVTGFVSNLDL 140

Query: 120 -------------ESQGGKDRATIGDYEREATCDTLQYINKVEYSKETKYLPLDLVRVRK 166
                        E Q  + +  +  Y+  ATC  L YI++V +SK+   L  DL   R+
Sbjct: 141 SKLLTKKGKKSEKERQKIESKLNLNQYKDLATCPDLAYISQVYHSKDKILLEDDLKECRR 200

Query: 167 ELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFS 226
           +L+  P F +   +   + + EKD+++ E+VQK WF FG  +VW +  QC+  YSRVI+S
Sbjct: 201 KLLETPSFLWTAVK---DEEDEKDMTENEVVQKRWFQFGTSAVWLESEQCYLAYSRVIYS 257

Query: 227 KIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCDHL 286
            I  R+ P  SLV  QAFDKNW EI G ++PYVD+ IP D+E+ L+K+D++LG+  C  L
Sbjct: 258 TIGVRSQPRVSLVRGQAFDKNWKEIKGKRIPYVDVPIPDDMEESLKKIDHELGIRDCSDL 317

Query: 287 KAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDPH 346
            +    ++ D CV E  K +L A+ RK+ I+SKY+  YP++++I F    + + GPEDPH
Sbjct: 318 PS--DSSAHDTCVVENAKNRLVAQSRKERILSKYYMTYPAIVDIPFAPVGE-WKGPEDPH 374

Query: 347 VIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKN 406
           VI++     +G EEP++ FN+ D    S R M T  P RK +P+++M+I GR+ + +EKN
Sbjct: 375 VILR---KANGYEEPVIVFNIWDD-ELSRRIMVTHMPQRKIDPLLKMSILGREQRGVEKN 430

Query: 407 WAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEFLS 466
           W PFF K    ES+ SRG +H IYSF PLEILKCSLNDG C+ VF A+TL   +E+ F  
Sbjct: 431 WTPFFHKNLG-ESSMSRGFIHFIYSFSPLEILKCSLNDGFCELVFGAETLRIKEENRFGG 489

Query: 467 MRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELV 526
            RG TQF  LP  LPQ+KG+QIWVGFPK H+ GCGC   +YRPM S+LVEH+GVY+ EL+
Sbjct: 490 FRGGTQFVSLPDVLPQIKGQQIWVGFPKQHIEGCGCADAFYRPMFSILVEHDGVYSQELL 549

Query: 527 VPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSN 586
           VP+L F I+VLSWDL   YC + NV++PNSI  W+++ Q+  T +++DY++LT+SE+D N
Sbjct: 550 VPALGFNIDVLSWDLTDTYCDEKNVISPNSIAQWDVIRQDTHTKQYEDYLTLTISESDIN 609

Query: 587 TEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYG 641
           T +V +KG+LNY+LG+Y++K ++E FEI+  +++IIG+T+ C+  +  D CK YG
Sbjct: 610 TRVVTLKGMLNYILGMYKEKELQEKFEISDEADVIIGQTLKCLKDSAFDYCKVYG 664

>KAFR0A03580 Chr1 complement(731876..733948) [2073 bp, 690 aa] {ON} 
          Length = 690

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/598 (46%), Positives = 403/598 (67%), Gaps = 22/598 (3%)

Query: 59  SIKYKYNSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSN 118
           ++K  Y +   +KTV  KKDLL ID+T  LR+KD +R+P+  + L   +T   + G+VSN
Sbjct: 84  NVKSYYYTSTALKTVRNKKDLLKIDITNQLRYKDLSRTPITPDILHYNFTAVNVTGFVSN 143

Query: 119 LE----------SQGGKDRATI-GDYEREATCDTLQYINKVEYSKETKYLPLDLVRVRKE 167
           L+          S G    A+   +Y+   +C+ LQY N +E S+    LP DLV +R+E
Sbjct: 144 LQLEKTANSEVNSNGIIPEASYHQEYDSLVSCNDLQYNNIMELSRWNILLPDDLVALRRE 203

Query: 168 LMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSK 227
           L TN K + L K++   +D EK +S+ EI+ K W  FGG +VW +   CF VY+RVI+S 
Sbjct: 204 L-TNDKTK-LSKELE--DDNEKMMSETEIIGKNWLRFGGAAVWLESELCFVVYTRVIYSP 259

Query: 228 IPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCDHLK 287
              +     SLV AQAFDK+WNEI G ++P+ D+ IP +V KEL  L+ +L    CD+LK
Sbjct: 260 EGFKGAAKLSLVRAQAFDKDWNEIKGKRIPFSDVPIPKEVTKELSNLEKNLDYSTCDNLK 319

Query: 288 AIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDPHV 347
            I     ++ C+ + TK KLK ++R DE++S+Y+  YPSV+ I     +  + GPEDPHV
Sbjct: 320 -ISDREYYNDCIVQITKKKLKFQQRYDELLSRYYLTYPSVINIPL-DLNGYFNGPEDPHV 377

Query: 348 IMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNW 407
           I++     D  EEP++ FNM D+  D  RR++ F PHRK + +++ +I GRK++  EKNW
Sbjct: 378 ILR---KNDKYEEPIIIFNMQDNDEDK-RRIYAFHPHRKIDALVKFSIEGRKLRDKEKNW 433

Query: 408 APFF-VKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEFLS 466
           APFF     N +S FSRG ++ IY++ PLEI+KCSLNDGIC+ VFEA T+E++ E+ +  
Sbjct: 434 APFFPYHDENKDSVFSRGFIYFIYTYAPLEIVKCSLNDGICEMVFEAATIEASGENAYDD 493

Query: 467 MRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELV 526
           MRG TQF KLP+D+PQV+GKQ+W+GFPK H +GCGCG  YYRPM+S+L+E +G Y+LEL+
Sbjct: 494 MRGGTQFVKLPADIPQVEGKQMWLGFPKSHSSGCGCGSTYYRPMLSLLIETHGAYHLELM 553

Query: 527 VPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSN 586
           VP++DF  +VLSWDLKG YC  V++++PNSI YWE+V+Q+ +  +F+DY+  T SE+D+ 
Sbjct: 554 VPTMDFERDVLSWDLKGTYCEGVSIMSPNSIAYWEVVDQDVENEKFEDYLGFTFSESDAT 613

Query: 587 TEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKTH 644
           +++VV++ +LNY+L IY++K +++ FEI+K S+ II  T+ CV     DDC +YG T 
Sbjct: 614 SKVVVLRNVLNYILEIYKEKRIRDQFEISKESDSIIRNTLKCVKDKQWDDCTKYGVTQ 671

>NCAS0D02410 Chr4 complement(458364..460649) [2286 bp, 761 aa] {ON} 
          Length = 761

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/605 (44%), Positives = 395/605 (65%), Gaps = 27/605 (4%)

Query: 58  RSIKYKYNSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVS 117
           + ++  Y++   ++ V+  KDL N+D++K LRFK +  SP+  ET  QKY   +L+ Y +
Sbjct: 100 KGMQIYYSNFHKLRPVSSIKDLNNVDISKMLRFKKWTSSPMTEETFNQKYETEELVAYAA 159

Query: 118 NLE--------SQGGKDRATIGD------YEREATCDTLQYINKVEYSKETKYLPLDLVR 163
           NL+        S+ GK      +      YE   TC+ L+Y   +E S E + +  DL++
Sbjct: 160 NLDLKRLNKQNSKKGKVEDKFANMRHNQNYESLVTCNELRYNTSLESSVEKRIIDDDLIQ 219

Query: 164 VRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRV 223
           +R++++   + + L K + +     KDL + EI++KYW  FG   +W ++ QC+ VYSRV
Sbjct: 220 MRRDILA--RKDQLSKAITSTR--HKDLPESEIIEKYWTRFGAAPLWMEQEQCYVVYSRV 275

Query: 224 IFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKC 283
            +S+   +     SL+ AQAFDK+WNEIIG ++P+ D+ IP D+E EL+KLD +LGL  C
Sbjct: 276 SYSEHGHKVVSKISLIRAQAFDKDWNEIIGKRIPFNDVAIPKDIEAELKKLDEELGLNTC 335

Query: 284 DHLKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPE 343
           DHL  I    + D C+ +  K KL AEK+K  I+SKY+  YP++L+I F S+ K   GPE
Sbjct: 336 DHL--IDDPVALDDCIVDAAKNKLAAEKKKANILSKYYMTYPTILDIPFDSS-KLMSGPE 392

Query: 344 DPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRI 403
           DPHVIM+       +EEP+VFFNM +   +++R+M+ F PHRK +PMI+  + GRK+  +
Sbjct: 393 DPHVIMRKTTT---VEEPIVFFNMQE--KENHRQMYGFFPHRKNDPMIKFNLEGRKLNDV 447

Query: 404 EKNWAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESE 463
           EKNW+PFF +Q+     FSRGT+  IYS+ PLEI++CSL+DG C  VFEA T      S+
Sbjct: 448 EKNWSPFF-RQNIEFRTFSRGTIQFIYSYAPLEIMRCSLDDGQCKMVFEATTNGVQDSSK 506

Query: 464 FLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNL 523
           F +MRGS+Q+  LP+  P VK KQIWVGFPK HL  CGCG  +YRPM+S+LVE  GVY L
Sbjct: 507 FGNMRGSSQYLPLPNVFPAVKDKQIWVGFPKVHLGYCGCGTSFYRPMLSILVESRGVYYL 566

Query: 524 ELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEA 583
              +P++DF I+VL+WD K   C   NVLN NSI +W++V+Q+P+T + +DYM ++VSEA
Sbjct: 567 SATIPAIDFNIDVLNWDEKTTNCVAENVLNLNSIAFWDVVSQDPETKKIEDYMIVSVSEA 626

Query: 584 DSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKT 643
           D  T+IV +KG++N+V+G+Y +KPMKE  ++N  + +II KT  C+   T D+CK YGK+
Sbjct: 627 DVLTKIVTIKGIMNFVMGVYDNKPMKESLDLNADTRVIIEKTTRCIIDETYDECKAYGKS 686

Query: 644 HPESD 648
           H   D
Sbjct: 687 HQGKD 691

>NDAI0I02510 Chr9 (579118..581292) [2175 bp, 724 aa] {ON} 
          Length = 724

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/673 (42%), Positives = 425/673 (63%), Gaps = 38/673 (5%)

Query: 2   AAPLVSDSKRVLLFMMRKLSISLQTRKIYKLIVTXXXXXXXXXXXXQSRYSDNDSIRSIK 61
           ++ +++  +R L + + +++ + +   IY++ VT            ++  S+  +++ + 
Sbjct: 47  SSRVINGLRRYLQYFITRITGATKKEIIYRVCVTLLIISIITISTRKAGTSE--TMKKLT 104

Query: 62  YKYNS-LQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNLE 120
           Y Y S + N K V   KDL NID+++TL +K +  +P+  +   Q+Y  N L  Y  NL+
Sbjct: 105 YNYYSKIYNQKNVDSIKDLNNIDVSQTLLYKPWADTPLTEDIFRQEYESNNLTAYAENLD 164

Query: 121 ---------SQGGKDRA--------------TIGDYEREATCDTLQYINKVEYSKETKYL 157
                       GK+                T   YE    C  L Y   +E SK  K L
Sbjct: 165 FDKFKKQYSKTKGKNHKNDDNEKDLTKLNLNTEETYESLIDCGDLAYNITIENSKLKKAL 224

Query: 158 PLDLVRVRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCF 217
             DL+++R++L+   K + + K + +N D  KD+S+ EI+ KYW  FGG  +W ++ QC+
Sbjct: 225 TDDLIQMRRDLIA--KNDHISKLIKSNKD--KDMSEEEIITKYWSKFGGAPLWLEKEQCY 280

Query: 218 FVYSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDND 277
            VYSRV +S    +     SL+ AQAFDKNWNE+ G K+P+VD+ +P + + EL KLD +
Sbjct: 281 VVYSRVFYSPSGHKTASRISLIRAQAFDKNWNELKGKKIPFVDIKVPKNFQSELNKLDKE 340

Query: 278 LGLYKCDHLKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADK 337
            GL +CDHLK   K  +F  C+ +  K KLKA++R+++++S Y+  YP+VL+IEF S+  
Sbjct: 341 FGLNQCDHLKNDEKAYNF--CILDNVKTKLKAKERREKVLSHYYITYPTVLDIEFDSSG- 397

Query: 338 SYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTING 397
              GPEDPHVI++   N   IEEP++FFNM DH ++ NR M+ + PHRKT PM++  +NG
Sbjct: 398 MLSGPEDPHVILRKTAN---IEEPIIFFNMQDHKAN-NRPMYAYLPHRKTSPMLKFNLNG 453

Query: 398 RKVKRIEKNWAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLE 457
           RK+  +EKNWAPFF  Q+  +++FSRG++H IYSF PLEI+KCSL+DG C   FEA T  
Sbjct: 454 RKLNDVEKNWAPFF-HQNVKDNSFSRGSIHFIYSFAPLEIMKCSLDDGECKMDFEAVTNG 512

Query: 458 STKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEH 517
           + +  +F +MRG+TQ+  LP+ LP+VK KQ+WVGFPK HL  CGCG  +YRPM+SVLVE 
Sbjct: 513 ANEGQKFGNMRGATQYVPLPAILPKVKNKQVWVGFPKVHLGFCGCGGGFYRPMLSVLVES 572

Query: 518 NGVYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMS 577
           NGVY    +VPS+DF I VLSW+ +G  C   N+LNPNSI++WE+ +Q+ +T +F+DYM 
Sbjct: 573 NGVYYQSAIVPSMDFNIEVLSWEEEGSNCDSGNILNPNSISFWEVTSQDLETKKFEDYMG 632

Query: 578 LTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDC 637
           + VSE+D  T+++ +KG+LN+VLGIY DKPM E+F+IN+ S  II KT  CV      +C
Sbjct: 633 IAVSESDVVTKVLTLKGVLNFVLGIYNDKPMNEEFDINEDSRSIIDKTTNCVVTGVLREC 692

Query: 638 KEYGKTHPESDKD 650
             YGK H ++ K+
Sbjct: 693 DRYGKEHDKNVKE 705

>KAFR0G01330 Chr7 (297931..299943) [2013 bp, 670 aa] {ON} 
          Length = 670

 Score =  526 bits (1354), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 268/606 (44%), Positives = 385/606 (63%), Gaps = 29/606 (4%)

Query: 51  YSDNDSIRSIKYKYNSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTEN 110
           ++  ++I+S  Y + +L   KTV  +KDLL ID+   L  KD ++SP+        +TE 
Sbjct: 79  FTHKNNIKSYYYTHTAL---KTVPNEKDLLKIDIANQLHIKDLSKSPIIPNIFQYNFTEV 135

Query: 111 QLLGYVSNLESQ----------GGKDRATIG-DYEREATCDTLQYINKVEYSKETKYLPL 159
            + G+VSNL+S+          G    A+   D+    TCD LQY N +E S     LP 
Sbjct: 136 NVTGFVSNLQSKKKLENEAHSNGTAPEASYHKDHHSSVTCDDLQYNNIIEISTWNTLLPD 195

Query: 160 DLVRVRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFV 219
           DLV +R+EL        L K++  +N  E+ ++++EIV K WF FGG +VW +  QCF V
Sbjct: 196 DLVTIRRELTHGGTT--LSKELQDHN--EEKMTEVEIVSKNWFRFGGAAVWLEREQCFVV 251

Query: 220 YSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLG 279
           YS +++     +  P  S++ AQAFDK+WNE+ G ++P+ D++IP DV KEL  L+  L 
Sbjct: 252 YSSIMYQPSGMKGIPKISVIGAQAFDKDWNELKGKRIPFHDISIPKDVTKELSHLEKKLS 311

Query: 280 LYKCDHLKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSY 339
              CD+LK  G +  +D C+ + TK KLK ++  +E++S+Y+  YPS+L I F       
Sbjct: 312 YSNCDNLKNSGINF-YDDCIAQMTKEKLKLQQTYEELLSRYYMTYPSILNIPFDIGSGRG 370

Query: 340 LGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRK 399
            G EDPHVI+K   NG   EEP+V FNM ++ ++ NRR++ F PHR+ +P+++  I   K
Sbjct: 371 KGAEDPHVILKQ--NGK-YEEPIVIFNMYNN-TEGNRRVYAFHPHRRIDPIVKFFIEDIK 426

Query: 400 VKRIEKNWAPFFVKQSNTE-SAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLES 458
           +   EKNW PFF  +  +E S FSRG ++ IY++ PL+I+KCSLNDGIC+ VFE      
Sbjct: 427 LSAKEKNWTPFFPYRDESEISVFSRGFIYFIYAYAPLKIVKCSLNDGICEVVFE-----D 481

Query: 459 TKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHN 518
             + E   MRG+TQF KLP+D+PQV+GKQ+W+GFPK HL+ CGCG  YYRPM+S+L E N
Sbjct: 482 LNKFEHAEMRGATQFVKLPTDIPQVEGKQMWIGFPKTHLSDCGCGVSYYRPMLSLLTETN 541

Query: 519 GVYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSL 578
           G Y+LEL+VP++DF  +VLSWDLKG YC   N+++PNSI YWE+V+Q+    +F+DY+  
Sbjct: 542 GSYHLELMVPTMDFNRDVLSWDLKGTYCGGTNIMSPNSIAYWEVVDQDAANGKFEDYLGF 601

Query: 579 TVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCK 638
           T SEAD  T +VV++ +LNY+L IY +K +   FEI K S+ IIG  + CV      +C 
Sbjct: 602 TFSEADETTRVVVLRNILNYILDIYDEKKISNQFEIGKESDTIIGSALQCVKDTQWTNCA 661

Query: 639 EYGKTH 644
           +YGKTH
Sbjct: 662 KYGKTH 667

>NCAS0A07470 Chr1 complement(1482301..1484322) [2022 bp, 673 aa]
           {ON} 
          Length = 673

 Score =  516 bits (1330), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 259/604 (42%), Positives = 393/604 (65%), Gaps = 24/604 (3%)

Query: 55  DSIR-SIKYKYNSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLL 113
           DSI  ++ Y   S  N   V  KKDLLN+D++K LRFK + +SPV      QK+T   + 
Sbjct: 80  DSITDTVGYYSASFSNPAVVEHKKDLLNVDVSKILRFKRWAKSPVSKNVQKQKFTSKLVT 139

Query: 114 GYVSNLE-----------SQGGKDRATIGDYEREATCDTLQYINKVEYSKETKYLPLDLV 162
           G+V+N++               +D      YE  A+C+   Y   +E++  +  L  DL+
Sbjct: 140 GFVNNIDITKQKLKRKNKKDHPQDSNVHEGYENLASCEDFAYTAPMEHADWSDILQDDLI 199

Query: 163 RVRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSR 222
             R+E++   K   + K++   +++EKD S+ +I+++++F FG  +VW +  +CF +Y+R
Sbjct: 200 TARREMIK--KGGLMAKEVQ--HESEKDWSEEKIIKEHFFRFGSSAVWLESEECFVMYTR 255

Query: 223 VIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYK 282
           V++S    +   HFS +  Q FD++WNEI G ++PY D+ IP D+E+E++ LD  L   +
Sbjct: 256 VMYSFKGSKRDDHFSFLRGQTFDRDWNEIKGKRIPYNDMQIPNDIEQEIKLLDAALDQNQ 315

Query: 283 CDHLKAIGKDAS-FDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLG 341
           CD LK   KD   F KC  E TK  LK  KRK+EI+S YF  YP+ + + F  +   + G
Sbjct: 316 CDSLK--NKDNEMFHKCQVEHTKNFLKNSKRKEEILSNYFITYPTNVNVPFDPSKNIHKG 373

Query: 342 PEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVK 401
           P+DP VI++     + +E+P++ FNM D   +  +RMF F PHR+ +P+I++ I G  ++
Sbjct: 374 PQDPRVIVR---KTNDMEDPIIVFNMYDE-DEKKKRMFAFHPHRRVDPLIKLMIEGHPMR 429

Query: 402 RIEKNWAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKE 461
             EKNWAPF + +   ESA SRGT+H +YS  PLEILKCSLNDG C+ VF ADTL   K+
Sbjct: 430 NDEKNWAPF-LHEHTKESALSRGTLHFVYSLKPLEILKCSLNDGKCEVVFGADTLGLEKD 488

Query: 462 SEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVY 521
           + +  MRG +Q+ KLP  LP VK KQIWVGFPK HL+   C   YYRPM+SVLVE NGVY
Sbjct: 489 NSYGEMRGGSQWIKLPDVLPTVKDKQIWVGFPKIHLSRSACRNHYYRPMLSVLVESNGVY 548

Query: 522 NLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVS 581
           N++L VP LDFG++V SWD+KG YC  +NVLNPN+I YW++VNQ+P T +++DY+++T+S
Sbjct: 549 NMDLEVPVLDFGLDVASWDMKGSYCDLLNVLNPNNIAYWDVVNQDPHTKKYEDYLAITMS 608

Query: 582 EADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYG 641
           E+D  + ++V++G+L+Y+LG Y++K +K++F++++ S +I+ KT+ C+A    +  KEY 
Sbjct: 609 ESDIFSRVMVIRGVLDYILGAYKEKEIKDNFQVDEESPIILRKTLKCIADYASEQAKEYS 668

Query: 642 KTHP 645
           ++HP
Sbjct: 669 ESHP 672

>NCAS0J00180 Chr10 complement(20130..22079) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score =  507 bits (1306), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 262/649 (40%), Positives = 412/649 (63%), Gaps = 38/649 (5%)

Query: 2   AAPLVSDSKRVLLFMMRKLSISLQTRKIYKLIVTXXXXXXXXXXXXQSRYSDNDSIRSIK 61
           A PL S + R+ L + R  + SL+  ++YKLI                        R+  
Sbjct: 34  AIPLESFTTRIRLLLNRIFA-SLKKNQVYKLIAILLLVTCVTVLSHG---------RNEP 83

Query: 62  YKYNSLQ-NIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNLE 120
           + +++   N  TV++KKDLLN+D++  LRF  +++ P+  ET  Q + E  + G+VSNL 
Sbjct: 84  FLFSTAAVNKNTVSKKKDLLNVDISNQLRFIPWSKLPLSKETTKQHFKEAGVTGFVSNLV 143

Query: 121 SQGGKDRATIGDYEREATCDTLQYINKVEYSKETKYLPLDLVRVRKELMTNPKFEFLRKQ 180
           +     R T         C+   Y N +EYS  ++ L  DL+ +R++++   +   L K+
Sbjct: 144 AT----RDTF-------KCEDCIYDNTIEYSDWSELLEDDLIALRRQMLK--RNNALSKE 190

Query: 181 MHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSKIPRRNHPHFSLVA 240
           +   +  E D S+ +I++++WF FGG  +W +  QCF V++R+ +++   + HPH SL+ 
Sbjct: 191 V--KDKKEDDWSEEKIIKEHWFRFGGAPIWLETEQCFLVFTRLGYTR-GNKGHPHVSLIR 247

Query: 241 AQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCDHLKAIGKDASFDKCVE 300
           AQAFD++W EI   ++P+ D+ +P+D++KEL+ LD +LG   CD L+  G+   +++C+ 
Sbjct: 248 AQAFDRDWKEIQNKRIPFSDVVMPSDLDKELQLLDRELGASSCDPLQ--GEPTMYEECIV 305

Query: 301 EQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDPHVIMKGGINGDGIEE 360
           E+TK  LK+ +R++EI+S+YF  +P+++++ F        GPEDPHVI++     + +EE
Sbjct: 306 EKTKNSLKSTQRREEILSRYFLTFPTIIDVPF-VFHGDLNGPEDPHVILR---KTESMEE 361

Query: 361 PLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFVKQSNTESA 420
           P++ FNMLD   +  RR+F+F P RK +P+++ T+   K+   EKNW PFF    +  S 
Sbjct: 362 PVLVFNMLDEV-EKKRRIFSFMPFRKIDPLVKFTVPSLKLNEKEKNWTPFFHNDFHN-SK 419

Query: 421 FSRGTVHLIYSFFPLEILKCSLNDGICDTVF---EADTLESTKESEFLSMRGSTQFYKLP 477
            SRGT+H IYSF PL IL+CSLNDGICD VF   E  + +      + SMRG TQFYKLP
Sbjct: 420 LSRGTIHFIYSFKPLRILQCSLNDGICDVVFGKTERSSDDDKDGETYGSMRGGTQFYKLP 479

Query: 478 SDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELVVPSLDFGINVL 537
           S LP ++ K +W+GFPK HL   GC   YYRPM+++LVE  G YNLEL VP LDFG++V 
Sbjct: 480 SVLPGIEDKTMWLGFPKLHLFNSGCNTHYYRPMMALLVEEKGTYNLELEVPVLDFGLDVK 539

Query: 538 SWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSNTEIVVVKGLLN 597
           SW+LKG+YC  +++L+PNSI YWE+VNQ+P T E++DY+++++SEAD+ + ++V+KG+LN
Sbjct: 540 SWNLKGYYCDHISILSPNSIAYWEVVNQDPVTKEYEDYLAVSMSEADTFSRVIVLKGVLN 599

Query: 598 YVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKTHPE 646
           Y+LGIYRDK + E F++   +++   KT+ C+ +  R    +Y K+HP+
Sbjct: 600 YILGIYRDKQINESFQLGDEASIASAKTLKCMDEFARQQSSKYDKSHPK 648

>NCAS0J00200 Chr10 complement(24719..26662) [1944 bp, 647 aa] {ON} 
          Length = 647

 Score =  506 bits (1302), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 248/581 (42%), Positives = 389/581 (66%), Gaps = 27/581 (4%)

Query: 69  NIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNLESQGGKDRA 128
           N  TV++KKDLLN+D++K LRF  +++ P++ ET  Q++ +  + G+VSNL         
Sbjct: 90  NKNTVSKKKDLLNVDISKQLRFIPWSKLPLNEETTNQQFKKAGVTGFVSNL--------V 141

Query: 129 TIGDYEREATCDTLQYINKVEYSKETKYLPLDLVRVRKELMTNPKFEFLRKQMHANNDAE 188
            I D  +   C+   Y N +EYS  ++ L  DL+ +R++++   +   L K++   +  E
Sbjct: 142 AIRDTFK---CEDCIYDNTIEYSDWSELLEDDLIALRRQMLK--RNNALSKEV--KDKKE 194

Query: 189 KDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSKIPRRNHPHFSLVAAQAFDKNW 248
            D S+ +I++++WF FGG  +W +  QCF V++R+ +++   + HPH SL+ AQAFD++W
Sbjct: 195 DDWSEEKIIKEHWFRFGGAPIWLETEQCFLVFTRLGYTR-GNKGHPHVSLIRAQAFDRDW 253

Query: 249 NEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCDHLKAIGKDASFDKCVEEQTKIKLK 308
            EI   ++P+ D+ +P+D++KEL+ LD +LG   CD L+  G+   +++C+ E+TK  LK
Sbjct: 254 KEIQNKRIPFSDVVMPSDLDKELQLLDRELGASSCDPLQ--GEPTMYEECIVEKTKNSLK 311

Query: 309 AEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDPHVIMKGGINGDGIEEPLVFFNML 368
           + +R++EI+S+YF  +P+++++ F        GPEDPHVI++     + +EEP++ FNML
Sbjct: 312 STQRREEILSRYFLTFPTIIDVPF-VFHGDLNGPEDPHVILR---KTESMEEPVLVFNML 367

Query: 369 DHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFVKQSNTESAFSRGTVHL 428
           D   +  RR+F+F P RK +P+++ T+   K+   EKNW PFF    +  S  SRGT+H 
Sbjct: 368 DEV-EKKRRIFSFMPFRKIDPLVKFTVPSLKLNEKEKNWTPFFHNDFHN-SKLSRGTIHF 425

Query: 429 IYSFFPLEILKCSLNDGICDTVFEADTLESTKESE---FLSMRGSTQFYKLPSDLPQVKG 485
           IYSF PL IL+CSLNDGICD VF      S  + +   + SMRG TQFYKLPS LP ++ 
Sbjct: 426 IYSFKPLRILQCSLNDGICDVVFGKTERSSDDDKDGETYGSMRGGTQFYKLPSVLPGIED 485

Query: 486 KQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELVVPSLDFGINVLSWDLKGHY 545
           K +W+GFPK HL   GC   YYRPM+++LVE  G YNLEL VP LDFG++V SW+LKG+Y
Sbjct: 486 KTMWLGFPKLHLFNSGCNTHYYRPMMALLVEEKGTYNLELEVPVLDFGLDVKSWNLKGYY 545

Query: 546 CFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSNTEIVVVKGLLNYVLGIYRD 605
           C  +++L+PNSI YWE+VNQ+P T E++DY+++++SEAD+ + ++V+KG+LNY+LGIYRD
Sbjct: 546 CDHISILSPNSIAYWEVVNQDPVTKEYEDYLAVSMSEADTFSRVIVLKGVLNYILGIYRD 605

Query: 606 KPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKTHPE 646
           K + E F++   +++   KT+ C+ +  R    +Y K+HP+
Sbjct: 606 KQINESFQLGDEASIASAKTLKCMDEFARQQSSKYDKSHPK 646

>NDAI0E02100 Chr5 complement(426032..427936) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  503 bits (1296), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 246/601 (40%), Positives = 390/601 (64%), Gaps = 21/601 (3%)

Query: 56  SIRSIKYKY---NSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQL 112
           + RS   KY   N   + +++  K DL N+D++K LRF+  N+SP+  + L Q Y    +
Sbjct: 41  ATRSDTSKYVVTNYFNSNESLPTKNDLPNVDVSKQLRFQKLNKSPITEKVLHQYYENFDV 100

Query: 113 LGYVSNLE--------SQGGKDRATIGDYEREATCDTLQYINKVEYSKETKYLPLDLVRV 164
            G V+NL+         + GK +       ++ +C+ L Y   + YS +   +  +L+++
Sbjct: 101 EGVVTNLDLSKHYSKDHKRGKQQQQEHKSYQDLSCNDLGYHANIGYSTDLIPIEDNLLKL 160

Query: 165 RKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVI 224
           R++L+ N   ++     H   ++EK+ S+ EI++K+W  FG   VW +  QCF  YSRV+
Sbjct: 161 RRQLLKNENKDYANFFRHE--ESEKNWSEEEIIEKHWSRFGPAPVWLESEQCFVSYSRVM 218

Query: 225 FSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCD 284
           +    ++N P  SL+ AQAFDK WNEI+G ++PY D+ IP+DV KELE L +    + CD
Sbjct: 219 YRHTDQKNQPLVSLIRAQAFDKEWNEIVGKRIPYSDVIIPSDVTKELEMLGDQFQEHACD 278

Query: 285 HLKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPED 344
            LK     + +++C+ +  K  L+ ++RK++I+++YF+ YPS++E+ F    +   GPED
Sbjct: 279 KLK---DSSEYEQCITKHNKSLLENKRRKEKILNRYFQSYPSLIEVPFNIKAEGCKGPED 335

Query: 345 PHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIE 404
           PHV++K    G   EEP++ FNMLD  +D  R+M+   PHRK +P++   ING++ K++E
Sbjct: 336 PHVVLKKTSKG---EEPVIIFNMLDD-TDKKRKMYAIMPHRKVDPIVTFRINGQEPKKVE 391

Query: 405 KNWAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEF 464
           KNW PFF   S   S  SRGT+H IYSF PLEILKCSL DG+CD VF+   L+  +E +F
Sbjct: 392 KNWTPFFNDDSEG-SGLSRGTIHFIYSFKPLEILKCSLTDGLCDIVFDKKFLDIGREDDF 450

Query: 465 LSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLE 524
             + G TQF  LP+ LP+V+ +++W+G PK HL    C + YYRPM+ +++E  G+Y++E
Sbjct: 451 QDIHGGTQFIPLPNILPEVQDQKMWLGLPKIHLKDTACSYHYYRPMVMLMIEDKGIYHIE 510

Query: 525 LVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEAD 584
           + VP LDFG++V SWD+KG YCF   +L+P+SI YWE+++Q+P+T E++DYM++T+SEAD
Sbjct: 511 MTVPILDFGLDVTSWDMKGTYCFFNQILSPHSIAYWEVISQDPQTKEYEDYMAITMSEAD 570

Query: 585 SNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKTH 644
           + ++++V+KG+LNY+LGIY++K +K  FE+N  +  I+ K++GCV    + + K+Y   H
Sbjct: 571 ALSKVMVIKGMLNYILGIYKEKALKPTFEVNGDTGTILKKSLGCVVDIAKKNSKQYNDKH 630

Query: 645 P 645
           P
Sbjct: 631 P 631

>NDAI0B04300 Chr2 (1081332..1083443) [2112 bp, 703 aa] {ON} 
          Length = 703

 Score =  503 bits (1295), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 256/618 (41%), Positives = 388/618 (62%), Gaps = 32/618 (5%)

Query: 56  SIRSIKYKYNSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGY 115
           +I+ I+   NSL   + VA    +++ ++    +FK +N+SPV   TL  KY +    G+
Sbjct: 83  TIQWIQDNTNSLA--QEVASADQIIDANIAPYFKFKKWNKSPVTNVTLSHKYIDYNTTGF 140

Query: 116 VSNLESQGG----KDRATIGD--------YEREATCDTLQYINKVEYSKETKYLPLDLVR 163
           V NL  Q      ++ +++ D        YE+   C +LQY N ++YS  TKY+  DLV 
Sbjct: 141 VWNLNVQPATKNEEEISSVSDFNVLNHDSYEKSTNCSSLQYTNTIKYSNWTKYIGDDLVE 200

Query: 164 VRKELMTNPKFEFLRKQMHANNDAEK-------DLSDLEIVQKYWFTFGGVSVWSDEYQC 216
            R+EL+   K +  ++    +  +EK       DLS+ EIV+KYW  FG  + W +  QC
Sbjct: 201 FRRELLA-LKNDLTKEVTSDDGASEKKKDPKAPDLSEEEIVKKYWSKFGAAAAWLESEQC 259

Query: 217 FFVYSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDN 276
           + VYSRV++     +  PH SLV AQAFD+NWNEI G ++PY+D+  P+ +EKEL  LD 
Sbjct: 260 YVVYSRVMYWHSGVKKMPHTSLVRAQAFDRNWNEIKGKQIPYIDVKAPSSLEKELASLDK 319

Query: 277 DLGLYKCDHLKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSAD 336
           +L L  CD    +  +A +D C     K  L A+KR++ I++K+F  YP++L++ F S  
Sbjct: 320 ELNLADCDAFLDVNPEA-YDDCKVSNAKGTLNAKKRRENILTKHFITYPTMLDVPFNSK- 377

Query: 337 KSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSN-RRMFTFSPHRKTEPMIRMTI 395
             + GPEDP VI +     DGI+EP+V FN+     D N RRM+   PHR+   +I   +
Sbjct: 378 VDWAGPEDPRVITR---KIDGIDEPIVVFNL--PIDDKNQRRMYGIFPHRRVNNIIEFKV 432

Query: 396 NGRKVKRIEKNWAPFFVK--QSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEA 453
              K++  EKNW PFF +  Q++  S+FSRG+++ IYSFFP+EI KCSL+DGIC+ VFE 
Sbjct: 433 PDHKMRYAEKNWTPFFEQSNQASGTSSFSRGSINFIYSFFPMEIFKCSLDDGICEVVFEG 492

Query: 454 DTLESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISV 513
             L  + ++ F  +RG TQF  LP  LP+V+GKQ W GFPK H+N CGCG K+YRPM+S+
Sbjct: 493 KDLGLSDDASFGGVRGGTQFLPLPDVLPKVEGKQFWFGFPKLHINSCGCGEKFYRPMLSL 552

Query: 514 LVEHNGVYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFD 573
           LVE NGVY+ +L+VP +DF + + +W+  G  C  +N+L+PNSI YWEI++QN +     
Sbjct: 553 LVEENGVYHQDLLVPFVDFDMTIPNWEEDGTKCDSINILSPNSIAYWEILDQNKEDSSIA 612

Query: 574 DYMSLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKAT 633
           DY++L+VS +DSN++I+++KG+ NY+LG+Y+   +K+ F+++K S+ II +++ CV    
Sbjct: 613 DYLALSVSTSDSNSQIIILKGVANYILGVYKKMDIKDTFDVSKESDSIIKQSLNCVIDNA 672

Query: 634 RDDCKEYGKTHPESDKDS 651
           + +CK YG  H ES +++
Sbjct: 673 KGECKAYGLLHGESAQET 690

>TBLA0B04760 Chr2 complement(1118043..1120508) [2466 bp, 821 aa]
           {ON} 
          Length = 821

 Score =  500 bits (1288), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 258/605 (42%), Positives = 375/605 (61%), Gaps = 44/605 (7%)

Query: 73  VAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNLE------------ 120
           VA KKD+  I++   L  K  N+ P +   +  +Y +  + G+VSNL+            
Sbjct: 161 VAFKKDMKEINVISYLNHKSLNKFPTNSRMILDEYEDFDITGFVSNLDINNLIAKKKEKL 220

Query: 121 -SQG---------GKDRAT---------IGDYEREATCDTLQYINKVEYSKETKYLPLDL 161
            SQG          K++             DY   ATC+ L+Y +++ YSK+ K++  DL
Sbjct: 221 DSQGYLTDNKKQDSKNKLMSVKEFELMLTNDYNSLATCEDLEYKSRIYYSKKQKFINDDL 280

Query: 162 VRVRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYS 221
           + +R+EL+   K + L K +    D  K  S+ E+++K WF FG  SVW +  QCF   +
Sbjct: 281 INLRRELLR--KDDELSKLIKDEEDITK-TSEEEVIKKKWFKFGSSSVWMESEQCFITVT 337

Query: 222 RVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLY 281
           RV++SK  +R  P  S + AQAFD++WNEI   ++P +DL +P D+  +L+K++ + GL 
Sbjct: 338 RVLYSKNGKREEPEVSFIRAQAFDRDWNEIKNKRIPLLDLRLPDDITADLKKINQEYGLT 397

Query: 282 -KCDHLKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYL 340
             C+++  I    ++DKC+ E TK  LK  KR+D+++ +YF  YP++  +  K     + 
Sbjct: 398 DSCENI--IDDPVTYDKCLVEHTKNYLKDSKRRDQLLERYFVTYPTIYSVPHKLG-GLFK 454

Query: 341 GPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSN-RRMFTFSPHRKTEPMIRMTINGRK 399
           GPEDP +I+K        EEP+V FNM  H  D N RRMF+ SPHR  E +++  I GRK
Sbjct: 455 GPEDPKIILK---RTSRYEEPIVIFNM--HDDDENKRRMFSLSPHRSFEKIVKFNIQGRK 509

Query: 400 VKRIEKNWAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLEST 459
            + +EKNW PFF K     S  SRG +H IYSF P E++KCSLNDG C+ VFE  TLE T
Sbjct: 510 QQTLEKNWTPFFTKDDLVFSTLSRGFIHFIYSFSPFEVVKCSLNDGYCELVFEKKTLELT 569

Query: 460 KESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNG 519
            +++F   RG TQF  LPS +P+V GKQIWVG PK H+  CGC  ++YRPM+S+LVE NG
Sbjct: 570 DQNKFDGQRGGTQFIPLPSIIPKVTGKQIWVGIPKLHIKKCGCSERFYRPMLSLLVESNG 629

Query: 520 VYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLT 579
           +Y+ EL+VPSLDF +++L+W   G  C   NV++PNSI +W+++ Q+PKT +FDDYM LT
Sbjct: 630 IYHQELIVPSLDFNLDILNWGNDGTDCDKFNVMSPNSIAFWDVIGQDPKTKQFDDYMILT 689

Query: 580 VSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKE 639
            SEADSN++I+ +KGLLNY+LG+Y  K + EDF  +++S+ I+GKT+ C+    +D CK 
Sbjct: 690 FSEADSNSKIITIKGLLNYILGMYSVKDIDEDFIPSRNSDQILGKTLNCLVNYAKDKCKS 749

Query: 640 YGKTH 644
           YG  H
Sbjct: 750 YGNLH 754

>Kpol_487.8 s487 (41650..43803) [2154 bp, 717 aa] {ON}
           (41650..43803) [2154 nt, 718 aa]
          Length = 717

 Score =  497 bits (1279), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 270/665 (40%), Positives = 395/665 (59%), Gaps = 46/665 (6%)

Query: 13  LLFMMRKLSISLQTRKIYKLIVTXXXXXXXXXXXXQSRYSDNDSIRSIKYKYNS-LQNIK 71
           L+F+ ++L +    +KI+ + +              +R   ++ I   K+ Y S L N+ 
Sbjct: 64  LIFLFKRLDLR---KKIFSITLFFIFLTISLFSIHPNR---DNIIEDAKFNYYSILNNLN 117

Query: 72  TVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQK-YTENQLLGYVSNLE---------- 120
            +  KKD  N+DLT  ++FK F   P+  +   +K Y +  + GYVSNL+          
Sbjct: 118 KLEFKKDYPNVDLTNVMKFKKFTTLPISNDITDKKLYAKYNVTGYVSNLDFNSVYNEYLK 177

Query: 121 ---SQGGKDRATI--GD----------YEREATCDTLQYINKVEYSKETKYLPLDLVRVR 165
              + G K    +  GD          YE    CD+L+Y N  E +  +K L  DL+ +R
Sbjct: 178 DNKNNGIKKNPNVEKGDFISEYDYHVGYENLVNCDSLKYTNHFEINNNSKILQDDLLNLR 237

Query: 166 KELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIF 225
           + L+       +       +  E   S+ +I+ K WF FGG +VW ++ QC+ VY+R+I+
Sbjct: 238 RNLLKKS----IPYSKAIKSKDEDRWSEEDIINKRWFRFGGSAVWLEDQQCYVVYTRIIY 293

Query: 226 SKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCDH 285
           S+   R++P  S++  QAFDK+WNEIIG K+PY D+ IP D+ +++  L  + G   C+ 
Sbjct: 294 SQRGERSYPKVSMLRGQAFDKDWNEIIGKKIPYNDVLIPNDMNQQINNLRKEFGEIDCNS 353

Query: 286 LKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDP 345
           +K      ++DKC  E T  ++K ++R + ++ KY+  YP++  I     +    G EDP
Sbjct: 354 IK---NKIAYDKCQAENTNNEIKIQERINAVLEKYYITYPTIFNIP-ADLNGDVKGQEDP 409

Query: 346 HVIMKGG---INGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKR 402
            VI+K     IN    +EPLVFFN LD   +  RRMF F PHRK + +++       +K+
Sbjct: 410 RVILKQNSININLKQTDEPLVFFNQLDD-VEGKRRMFAFWPHRKYDTLLKFKAKNFSLKK 468

Query: 403 IEKNWAPFFVKQSNT-ESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKE 461
            EKNW PFF     T +   SRG +H IY+F P+EI+KC+L+DG+C+ VF+A TL+  K+
Sbjct: 469 TEKNWTPFFSNNDLTADIKISRGFIHFIYNFLPIEIIKCNLDDGLCELVFKASTLDLPKD 528

Query: 462 SEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVY 521
           +++  MRG TQF KLPS+LP +K KQIWVGFPK H   CGCG  +YRPM+SVLVE  GVY
Sbjct: 529 AKYDGMRGGTQFVKLPSELPALKNKQIWVGFPKLHAKNCGCGTHFYRPMLSVLVESEGVY 588

Query: 522 NLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVS 581
           + EL+VP LDF   V+SWDLKG YC + N+++PNSI +W+I+ Q+PKT EF+DYM++TVS
Sbjct: 589 HQELIVPVLDFDFEVISWDLKGKYCQNNNIMSPNSIAFWDILGQDPKTKEFEDYMTITVS 648

Query: 582 EADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYG 641
           EAD  T  + +KGLLN++LGIY  K + EDF +N  S  I+ KT+ CV    +D CK YG
Sbjct: 649 EADRLTRTITLKGLLNFILGIYSQKSINEDFTVNDQSKFIVSKTLKCVVNHAKDQCKAYG 708

Query: 642 KTHPE 646
           KTHPE
Sbjct: 709 KTHPE 713

>NDAI0J00920 Chr10 complement(203498..205330) [1833 bp, 610 aa] {ON}
           
          Length = 610

 Score =  473 bits (1216), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 239/553 (43%), Positives = 355/553 (64%), Gaps = 26/553 (4%)

Query: 73  VAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSN--LESQGGKDRATI 130
           +  K DL+N+D++K L+ +  N+SP+  + L Q Y + ++   V N  LE  G K +   
Sbjct: 69  IPSKNDLVNVDISKKLKSQKLNKSPLSEKVLNQYYEKYKIKAIVPNIDLEKVGKKYKDNN 128

Query: 131 GD-----------YEREATCDTLQYINKVEYSKETKYLPLDLVRVRKELMTNPKFEFLRK 179
           G            YE+   C   +Y   +EYSK+   L  DL+ +R++++ +  F  + K
Sbjct: 129 GKNKLHNDQPSLTYEK-LPCSEFEYEGTIEYSKDVIELKDDLIDMRRKILKDGGF--MSK 185

Query: 180 QMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSKIPRRNHPHFSLV 239
            +  N   EK+ SD EIV+K W  FG   VW +  QC+  ++RV++S+I ++  P+ SL+
Sbjct: 186 LITVN--EEKNWSDEEIVEKSWKRFGESPVWLESEQCYISFTRVLYSRIHQKTFPYLSLI 243

Query: 240 AAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCDHLKAIGKDASFDKCV 299
            AQAFDK+WNEIIG K+P+ D++IP DVE+ELE L        CD +K     ++ ++C+
Sbjct: 244 KAQAFDKDWNEIIGKKIPFNDVSIPEDVERELESLSEQFQENVCDKIK---DSSAHEQCL 300

Query: 300 EEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDPHVIMKGGINGDGIE 359
            +  K  L+ ++RK++I+S+YF+ YP V EI FK       G EDPHVI+K    G   E
Sbjct: 301 VKHNKSLLEQQRRKEKILSRYFQTYPKVFEIPFKPERDYGNGAEDPHVILKKTDKG---E 357

Query: 360 EPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFVKQSNTES 419
           EP+V +N+ DH +D  R+M+   P +K +P+I   INGR+ K  EKNW PFF      ES
Sbjct: 358 EPVVIYNLFDH-NDKKRKMYALLPQKKVDPIIEFKINGREAKDTEKNWTPFF-NNDEGES 415

Query: 420 AFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEFLSMRGSTQFYKLPSD 479
            FS G++H IYSF PLEIL+CSL DG+CD V+E   L+  KE +F S+ G +QF  LP+ 
Sbjct: 416 EFSNGSIHFIYSFKPLEILRCSLTDGLCDVVYEKKFLDLDKEDDFSSVHGGSQFVPLPNV 475

Query: 480 LPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELVVPSLDFGINVLSW 539
           LP+VK + IWVGF K HL   GC   YYRPM+ +++E+ G+Y+LE+ VP  DF  +V SW
Sbjct: 476 LPKVKDQNIWVGFAKMHLQNSGCNPHYYRPMLMLMIENKGIYHLEMTVPIFDFNFDVPSW 535

Query: 540 DLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSNTEIVVVKGLLNYV 599
           D++G YC   N+L P+SI YWE+V+Q+P+T E++DYM+LT+SE+D+ ++++V+KG+LNYV
Sbjct: 536 DMQGTYCDRNNILAPHSIAYWEVVSQDPETKEYEDYMALTLSESDAVSKVIVLKGILNYV 595

Query: 600 LGIYRDKPMKEDF 612
           +G+Y DK +KE F
Sbjct: 596 IGMYEDKNVKETF 608

>TBLA0C07230 Chr3 (1755294..1757474) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score =  475 bits (1222), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 245/615 (39%), Positives = 368/615 (59%), Gaps = 45/615 (7%)

Query: 64  YNSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNLESQG 123
           Y +  + K V  KKDL++ID+   L+F++  +S ++   +   Y E ++ GYVSNL  + 
Sbjct: 108 YKAWTSTKEVTAKKDLMSIDMAPVLKFQNNEKSAINSRVINDDYKEFKIKGYVSNLNIKS 167

Query: 124 GKDRATI----------------------------GDYEREATCDTLQYINKVEYSKETK 155
             DR                                DY   ATC+ L+Y +K+ YSK++K
Sbjct: 168 LIDRKRSKLKKEDYSKDSKNSEKLLSIAGFEVMLNNDYSALATCEDLEYSSKILYSKKSK 227

Query: 156 YLPLDLVRVRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQ 215
            L  DL+++RKEL+ N  F  +   +H  ++ E D +D EI++K WF FG  S+W +  Q
Sbjct: 228 LLEDDLIKIRKELIANDPF--IGPLVH--DETENDWTDKEIMEKRWFRFGASSIWLESEQ 283

Query: 216 CFFVYSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLD 275
           C+   SR++FS+   +++P  SL+ AQAFDK+WNEI G ++P VDL    DVE EL  +D
Sbjct: 284 CYITVSRIVFSRAEEKSNPDVSLIRAQAFDKDWNEIQGKRIPKVDLPTLKDVENELNLID 343

Query: 276 NDLGLY-KCDHLKAIGKDA-SFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFK 333
            + GL  +CD L    KD+ ++D C+    +  L+ +KR+D  I++YF  YP+V    FK
Sbjct: 344 KEFGLNNECDKL---SKDSVAYDNCMVSHAQTFLEDQKRRDAFINRYFVTYPTVYSFPFK 400

Query: 334 SADKSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRM 393
           +  K   GPED  +I++     D +EEP+VFFNM    +D  R+ FT+ PHR   P+I  
Sbjct: 401 TNGK-LQGPEDARIILR---KTDTLEEPMVFFNM---DTDHGRKFFTYMPHRFINPLIEF 453

Query: 394 TINGRKVKRIEKNWAPFFVKQ-SNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFE 452
            I       +EKNWAPFF +  + T S  SRG +H +YSF P E++KCSLNDG+C+ VFE
Sbjct: 454 DIKVHGTHDVEKNWAPFFHEDDTKTISLLSRGFIHFVYSFSPFEVIKCSLNDGMCEKVFE 513

Query: 453 ADTLESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMIS 512
             TL  + ++ F  MRG TQ  +LPS +P+V GKQ+W+G  K H+  CGCG  +YRPM+S
Sbjct: 514 KKTLALSNKNNFGGMRGGTQIVQLPSIIPKVTGKQMWLGIAKSHIENCGCGRHFYRPMLS 573

Query: 513 VLVEHNGVYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEF 572
           + VE NG+Y+ EL+VPS+D    +L+W   G  C   NV++PNSI  WE++ Q+PKT +F
Sbjct: 574 LFVESNGIYHQELIVPSMDLNSEILNWKEDGKACDYKNVMSPNSIAAWEVLGQDPKTKKF 633

Query: 573 DDYMSLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKA 632
           DDY+  T SE+D  ++++ ++G+L+Y+L +Y +K + EDF  +  ++ I+G T+ C+   
Sbjct: 634 DDYLVFTYSESDILSKVITIRGILDYILRVYGEKDLLEDFIPSTDADSILGTTLDCMINY 693

Query: 633 TRDDCKEYGKTHPES 647
             D CK YG +   S
Sbjct: 694 ANDQCKNYGASRKTS 708

>TBLA0G03660 Chr7 complement(970121..972250) [2130 bp, 709 aa] {ON} 
          Length = 709

 Score =  466 bits (1199), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 226/597 (37%), Positives = 375/597 (62%), Gaps = 41/597 (6%)

Query: 73  VAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNLE------------ 120
           V  KKDL+N+DL   L ++  ++ P+  E   QKY   ++ G+V+NL             
Sbjct: 127 VQFKKDLVNLDLINYLNYRSTDKMPITPEIQNQKYKRFKIKGFVTNLNLNSITSKKKKKT 186

Query: 121 -----SQGGK-------DRATIGDYEREATCDTLQYINKVEYSKETKYLPLDLVRVRKEL 168
                 + GK       + +   DY     C+ L++ ++++YSKE K L  DL+ VRKE 
Sbjct: 187 SKDLIDENGKLIPVNEYELSQNNDYSSNVDCEDLEHSSEIQYSKERKILEDDLISVRKET 246

Query: 169 MTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSKI 228
           +     E+ +K      + EKD+++ EI++K W  FGG S+W +E+ C+   +R++++  
Sbjct: 247 LLKDD-EWAKK---VGEEEEKDMTNEEIIKKSWTRFGGSSIWLEEHHCYITVTRIMYAGN 302

Query: 229 PRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGL-YKCDHLK 287
             R  P  S++ AQAFDK+WNE+IG ++P +D+++P ++E+E++K+D + G+   C++L 
Sbjct: 303 GDRLRPDVSIIRAQAFDKDWNELIGKRIPKLDISLPDNIEEEIQKIDKEFGVSATCEYL- 361

Query: 288 AIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDPHV 347
            +   +S++ C+  Q    L   +R+D ++  YF  YP++    F S  + + G EDP +
Sbjct: 362 -VDTPSSYESCLARQANDFLDETRRRDSLLENYFVTYPTIYRFPFNSGGQ-FTGAEDPRI 419

Query: 348 IMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNW 407
           I++        +EP+V FNM D +    R+M+ F PHR T+ +++  + G    R+EKNW
Sbjct: 420 ILR---KTGQTQEPVVVFNMQDSWG---RQMYAFLPHRTTDRLVQFVLPGSN--RVEKNW 471

Query: 408 APFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEFLSM 467
           +PFF K+ +  S  SRGT+H +Y + PLEILKCSLNDG+C+ VFE  TL  ++ + +  +
Sbjct: 472 SPFFSKE-DVISDLSRGTIHFVYGYSPLEILKCSLNDGLCERVFEKRTLGLSEANNYNGI 530

Query: 468 RGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELVV 527
           RG TQ   LPS + ++ GKQ+W+ F K HL+ CGCG ++YRPM+++L+EHNG+Y+ ELVV
Sbjct: 531 RGGTQLVPLPSVIARISGKQMWLSFAKLHLDNCGCGRRFYRPMLNLLIEHNGIYHQELVV 590

Query: 528 PSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSNT 587
           PS+DF  +VL W  +G+ C DVNV++PNSI +W+++ Q+PKT +F+DY+  T SEAD+ +
Sbjct: 591 PSMDFDTDVLGWKHEGYTCEDVNVMSPNSIAFWDVIGQDPKTKKFEDYIIFTYSEADAIS 650

Query: 588 EIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKTH 644
           +++ ++G+L+Y++ +Y DK + EDF  +  S+ I+ KT+ C++K     CK+YG +H
Sbjct: 651 KVMTIRGILDYIVKMYSDKDIAEDFIPSDDSDHILSKTLKCMSKYADLKCKQYGASH 707

>TBLA0C07290 Chr3 (1775736..1777763) [2028 bp, 675 aa] {ON} 
          Length = 675

 Score =  460 bits (1183), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 239/599 (39%), Positives = 364/599 (60%), Gaps = 37/599 (6%)

Query: 73  VAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNLESQG--------- 123
           V  KKDL ++DL+  L     N+ P+  +    K+ + +  GY++NL  Q          
Sbjct: 74  VDTKKDLSHLDLSNVLSKTLVNKFPIPNDETFSKFDDFKFTGYITNLNIQNLIESKKDEL 133

Query: 124 ------GKDRATI----------GDYEREATCDTLQYINKVEYSKETKYLPLDLVRVRKE 167
                  KD + I           +Y+    C+ L Y +K+ YS E K +  DL+ +RKE
Sbjct: 134 DKHELKSKDGSPITVKEFELMLTNNYDSLVGCEDLAYSSKIHYSVERKIISDDLLSLRKE 193

Query: 168 LMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSK 227
           ++   + E  +  +H   D EK   D EIV+  WF FG  SVW ++ QC+   +R+++S 
Sbjct: 194 II-RAEDEIAKHMVH---DNEKGKDDAEIVKSNWFRFGSSSVWLEKEQCYITVTRLMYSS 249

Query: 228 IPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCDHLK 287
             R+  P  S+V AQAFD+NWNE+   ++P +DL IP ++E+EL+K+D + GL   D  K
Sbjct: 250 RGRKQGPDVSIVRAQAFDRNWNELFNKRIPKLDLKIPENLEEELKKIDIEYGL-SSDVCK 308

Query: 288 AIGKDAS-FDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDPH 346
           A  + +S +D C+  Q K  LK EKR++++++KYF  YP++ +   K   + + GPEDP 
Sbjct: 309 AFDETSSEYDSCIINQKKNYLKNEKRRNQLLNKYFITYPTIYKFPIKFGGR-FSGPEDPR 367

Query: 347 VIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKN 406
           +IMK   N    +EP+V FNM D  S   RRM+ F PHR  + +I+  I+   ++  EKN
Sbjct: 368 IIMKTTENHVA-DEPVVVFNMQDSGS---RRMYGFFPHRTVDSLIKFEIHNDGMRNQEKN 423

Query: 407 WAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEFLS 466
           WAP F   +++ + FSRG++H IY+F PLEILKCSLNDG C+ VF   TL  + ++ F  
Sbjct: 424 WAPIFT-DNDSSTEFSRGSIHFIYNFMPLEILKCSLNDGSCEKVFSKKTLGLSDKTNFGG 482

Query: 467 MRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELV 526
           +RG TQF  LPS +P++ GKQ+W+GF K H++ CGCG K+YRPM+++LVE  G+Y+ EL+
Sbjct: 483 VRGGTQFVPLPSVIPRIPGKQLWLGFSKLHIDKCGCGEKFYRPMLNILVEEKGIYHQELI 542

Query: 527 VPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSN 586
           VPS+DF   VL WD   + C   NV++PNSI +W++++Q+P   +FDD +  T SEAD  
Sbjct: 543 VPSMDFNTEVLDWDTTSYSCKYYNVMSPNSIAFWDVISQDPNNKKFDDLLVFTYSEADEI 602

Query: 587 TEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKTHP 645
           ++++ +KGLL+YVL +Y  K ++E+F  ++    I+  T+GCV +   + CKEYG  HP
Sbjct: 603 SKVMAIKGLLDYVLNLYSAKDLEEEFIPSRDVEAILATTLGCVKQYAENVCKEYGALHP 661

>TBLA0B00680 Chr2 (145277..147412) [2136 bp, 711 aa] {ON} 
          Length = 711

 Score =  457 bits (1177), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 235/617 (38%), Positives = 369/617 (59%), Gaps = 47/617 (7%)

Query: 66  SLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQ-KYTENQLLGYVSNL----- 119
           +L N K + +KKDL  +DLT  +  +     P+  E L +  Y   +  GY+SNL     
Sbjct: 108 NLTNAKVIERKKDLGRLDLTSIVNKRSLKNFPISDELLDEGNYDTYKFTGYISNLNVNNL 167

Query: 120 ---------------ESQGGKDRATI--------GDYEREATCDTLQYINKVEYSKETKY 156
                          E Q  +D  +I         DY +   C+ L+Y + V+YSKE  +
Sbjct: 168 INKKQNEKSDFIEKHEKQAAEDLVSINELELISSSDYNQIVECEDLEYTSSVKYSKEQTF 227

Query: 157 LPLDLVRVRKELMT---NPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDE 213
           +  DL+ +RK L+    + + +F+ +  H   + EKD +D+EIV++ W+ FG  SVW + 
Sbjct: 228 IEDDLIALRKYLLAKDFDAEDKFIAE--HVQQENEKDKTDIEIVKRSWYRFGSSSVWMES 285

Query: 214 YQCFFVYSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEK 273
            QC+   +R+++ K   + +P  SL+ AQ FDKNW EI G ++P VD+ +P D+EK++E+
Sbjct: 286 EQCYVTVTRLMYCKGGNKAYPDISLIRAQTFDKNWKEIKGKRIPKVDVKLPKDIEKQIEE 345

Query: 274 LDN--DLGLYKCDHLKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIE 331
           L+N  DL    CD  K +   A +  CV E+ K+ L+ +KR   +I +YF  YP+V +  
Sbjct: 346 LENEYDLNHKSCD--KYMNSPAQYGACVVEKNKVNLENKKRAQSLIDQYFVTYPTVYKFP 403

Query: 332 FKSADKSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMI 391
              A + Y GPEDP ++++   N    EEP+V FNM D   D  R+M  F PHR   P++
Sbjct: 404 I-VAHRIYTGPEDPRIVLRKFGNQ---EEPVVVFNM-DTIKD--RKMHAFLPHRALHPLV 456

Query: 392 RMTINGRKVKRIEKNWAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVF 451
            +   G  +K ++KNWAPFF+      S  SRG +H ++++ PLEIL CSLNDG C+ VF
Sbjct: 457 ELNFPG--MKGMQKNWAPFFLDSDFDSSELSRGYIHFVHNYNPLEILLCSLNDGNCEKVF 514

Query: 452 EADTLESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMI 511
              TL  T ++E+  +RG TQF +LPS + ++ GK I VGF K H+N CGCG ++YRPM+
Sbjct: 515 TKQTLGLTGKNEYGGIRGGTQFVQLPSVITRINGKTILVGFSKLHINNCGCGSRFYRPML 574

Query: 512 SVLVEHNGVYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLE 571
           +++VE  G+++ EL+VPS+DF I VL W  K H C   N+L+PNSI +W+++ Q+P T +
Sbjct: 575 NIIVEEKGIFHQELIVPSMDFNIEVLDWSTKSHTCKFYNILSPNSIAFWDVIRQDPHTKK 634

Query: 572 FDDYMSLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAK 631
           F+D +  T SEAD  ++ + V+GLL+Y++ +Y +K ++++F  +  +++ +GKT+ CV  
Sbjct: 635 FEDLLVFTFSEADEVSKAINVRGLLDYIINLYSEKDIEDNFVPSSDTDVALGKTLQCVKS 694

Query: 632 ATRDDCKEYGKTHPESD 648
              + C+EYG++HPE D
Sbjct: 695 KAENICREYGESHPEED 711

>TBLA0D00120 Chr4 complement(19863..21860) [1998 bp, 665 aa] {ON} 
          Length = 665

 Score =  451 bits (1161), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 239/608 (39%), Positives = 365/608 (60%), Gaps = 40/608 (6%)

Query: 64  YNSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNLESQG 123
           Y   QN K +  KK+L  +DLT  L  +  N+ P+  +     Y E +  G+++NL  + 
Sbjct: 64  YLGFQN-KKIHSKKELSKLDLTNILLGRPINKFPIPQDDDIANYDEFKFTGFITNLNVKN 122

Query: 124 ---------------GKDRATIGDYERE----------ATCDTLQYINKVEYSKETKYLP 158
                           KD   +   + E           TC+ L Y +KV YS E K + 
Sbjct: 123 LIASKKSDVNSKDLLSKDGRPVAVKDMEMMFSSYYGSIVTCEDLAYPSKVLYSSERKIIS 182

Query: 159 LDLVRVRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFF 218
            DLV +R+E+++  K   L K +  +N+  +D SD  IV+  W+ FG  SVW ++ QC+ 
Sbjct: 183 DDLVSLRQEIIS--KNNDLSKAVVNDNEKGRDESD--IVRSNWYRFGSSSVWLEKEQCYI 238

Query: 219 VYSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDL 278
             +R+++S   ++  P  S++ AQAFD+NWNE+   ++P +D  +P +VEKELEK+D +L
Sbjct: 239 TVTRLMYSYQGKKEGPDVSVIRAQAFDRNWNELYNKRIPKLDFKMPKNVEKELEKIDTEL 298

Query: 279 GLYK--CDHLKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSAD 336
           GL    C+ L  I     +DKC+ EQ    LK +K K+ I+ KYF  YP+V  I++K   
Sbjct: 299 GLSPDFCNQL--IKSPTEYDKCIIEQNNNLLKNQKTKERILDKYFVTYPTVYNIDYKLKG 356

Query: 337 KSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTIN 396
           + + G EDP +I+K G N +  +EP+V FNM D  S   RR++ + PHR  + +I+  I 
Sbjct: 357 R-FSGSEDPRIILKTGKNNEP-DEPIVIFNMHDQGS---RRLYGYFPHRSVDTVIKFEIQ 411

Query: 397 GRKVKRIEKNWAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTL 456
             ++K  EKNWAPFF  Q ++ S  SRG++H IY+F PLEILKCSLNDG C+ +F   TL
Sbjct: 412 NDEMKNREKNWAPFFTDQ-DSSSELSRGSIHFIYTFMPLEILKCSLNDGSCNKIFSKKTL 470

Query: 457 ESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVE 516
           E + ++ F  +RG TQF  LPS +P++ GKQIW+GF K H++ CGCG K+YRPM+++LVE
Sbjct: 471 ELSDKANFGGVRGGTQFVPLPSVIPRIPGKQIWLGFSKLHIDDCGCGKKFYRPMLNLLVE 530

Query: 517 HNGVYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYM 576
             G+Y+ EL+ PS+DF   VL W+   + C   NV++PNSI +W+I++Q+P+   F+D +
Sbjct: 531 EKGIYHQELIGPSMDFNTEVLDWNTTSYECSFYNVMSPNSIAFWDIISQDPENGTFNDLL 590

Query: 577 SLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDD 636
             T SEAD  +++V +KG+L+Y+L +Y  K ++EDF   K   +++GKT+ C+   +   
Sbjct: 591 VFTYSEADEISKVVNIKGILDYILNVYSQKDIEEDFTPTKDLEVVLGKTLDCIRDYSYKV 650

Query: 637 CKEYGKTH 644
           C  YG+ H
Sbjct: 651 CANYGEAH 658

>TBLA0B04770 Chr2 complement(1121182..1123311) [2130 bp, 709 aa]
           {ON} 
          Length = 709

 Score =  450 bits (1157), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 230/593 (38%), Positives = 361/593 (60%), Gaps = 31/593 (5%)

Query: 72  TVAQKKDLLNIDLTKTLRFKDFNRS-PVHIETLGQKYTENQLLGYVSN--------LESQ 122
           +V + K LL++DL+       +  + P++ + +  KY   +  GY  N        LE+ 
Sbjct: 127 SVDRIKGLLDLDLSSKFNSISYIENLPINSKIIDDKYQTFRFKGYTPNMRFDQLKMLENN 186

Query: 123 GGKDRATIGDYER--------EATCDTLQYINKVEYSKETKYLPLDLVRVRKELMTNPKF 174
              +   I  ++         +A+C+ L++  +V+YSKE   L  DL+ VRK ++T  K 
Sbjct: 187 KNTNNKDIVKFDNHIDEGTLVKASCEDLEHNGEVQYSKERTILKDDLIAVRKNILT--KD 244

Query: 175 EFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSKIPRRNHP 234
           +F+   +  + D+EKD+   +I++K WF FG  SVW ++ QC+   SR+++S    +  P
Sbjct: 245 DFITNIIKNHEDSEKDMKVEDIIRKKWFKFGTSSVWLEKEQCYLAISRILYSSEGIKTKP 304

Query: 235 HFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGL-YKCDHLKAIGKDA 293
             S++ AQ FDKNW EIIG ++P VD+++P ++E ELEK+D + G+ + C+HLK  G   
Sbjct: 305 VVSVLRAQTFDKNWKEIIGKRIPRVDVDLPQNLEVELEKVDREFGISFSCEHLK--GNPT 362

Query: 294 SFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDPHVIMKGGI 353
           ++DKC+ +Q    LK  +R+D+++ +YF  YP++    FKS D ++LG EDPH++++   
Sbjct: 363 AYDKCLVKQANGYLKDSQRRDKLLDRYFVTYPTIFRFPFKS-DGNFLGAEDPHIVLR--- 418

Query: 354 NGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFVK 413
             +G+EEP+V FNM + +    RRM  + PHR  + MI    N  ++K  EK WAPF+ +
Sbjct: 419 EKNGVEEPIVVFNMDNGHG---RRMHAYLPHRSFDQMIEFKFNDEEMKSTEKGWAPFYKR 475

Query: 414 QSNTES--AFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEFLSMRGST 471
           + N ES  + SRG++H IY+F PLEILKCSLNDG+C+ +F+  +L     S    + G T
Sbjct: 476 EYNEESISSLSRGSIHFIYNFQPLEILKCSLNDGLCEKIFQTQSLGLESGSLLKDVTGGT 535

Query: 472 QFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELVVPSLD 531
           QF  LPS LP ++ K IWVGF K+    C CG  +YRPM+ VL+E NGV+ ++L  PS+D
Sbjct: 536 QFRSLPSSLPLIENKNIWVGFSKYKATDCKCGHSFYRPMLQVLLESNGVFYMDLFSPSMD 595

Query: 532 FGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSNTEIVV 591
           F  ++LSWD K   C  +N + PNSI  WEI+ Q+  T ++ DYM+ T SE+D+ ++ +V
Sbjct: 596 FDSDILSWDEKNFNCGGINQMAPNSIASWEILKQDVATQKYYDYMTFTYSESDTLSKAMV 655

Query: 592 VKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKTH 644
           +KGLLNY+L  Y +K + E++ IN  ++ I+G  + CV     D C EY + H
Sbjct: 656 IKGLLNYILKTYTEKGIDEEYSINSHTDYIMGSALKCVEAQAHDRCTEYLQLH 708

>TBLA0C07240 Chr3 (1759547..1761610) [2064 bp, 687 aa] {ON} 
          Length = 687

 Score =  447 bits (1149), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 221/579 (38%), Positives = 364/579 (62%), Gaps = 43/579 (7%)

Query: 62  YKYNSLQNIKTVAQKKDLLNIDLTKTLRFKD-FNRSPVHIETLGQKYTENQLLGYVSNL- 119
           Y   + +++K V+ K++L  +DLT ++++ +   +S ++   + Q Y + ++ GY+SNL 
Sbjct: 111 YILQTFKSVKEVSSKRELAALDLTSSIKYNNNLEKSAINSRIINQHYDDFKIKGYISNLN 170

Query: 120 ------------ESQGGKDRATIG--------------DYEREATCDTLQYINKVEYSKE 153
                       E  G   + + G              DY   A+C+ L+Y +K+ YS E
Sbjct: 171 IDKLLNEKQSKVEKAGSTLKDSNGELVAVKDFELMLNNDYSSLASCEDLEYSSKISYSTE 230

Query: 154 TKYLPLDLVRVRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDE 213
            K +  DL+ +R+EL+   + + + K M   N+ EKDLSD EIV+K WF FG  SVW + 
Sbjct: 231 RKIIEDDLLALRRELIN--RNDLISKFM--TNEDEKDLSDEEIVKKRWFRFGSSSVWLES 286

Query: 214 YQCFFVYSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEK 273
            QC+   +R++++K   RN P  SL+ AQAFDK+WNEI G ++P +D+++P  +E+EL++
Sbjct: 287 QQCYITVTRLMYAKSGDRNKPDISLIRAQAFDKDWNEIKGKRIPKIDISLPKSIEEELQR 346

Query: 274 LDNDLGLYKCDHLKAIGKDA-SFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEF 332
           +D + G    D  + +  DA ++D+C  +     L  + RK+E + +YF  YP+V EI F
Sbjct: 347 IDKEFG--NVDACEELSSDAVAYDQCTIQHANAYLDGQARKEEFLKQYFVTYPTVYEIPF 404

Query: 333 KSADKSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIR 392
            +  + Y GPEDP +I++     D +EEP++ FNM +   +  RR +++ PHR  +P++ 
Sbjct: 405 YTEIR-YKGPEDPRIILR---KDDDLEEPVIVFNMEN---ERGRRFYSYLPHRNIKPLVE 457

Query: 393 MTINGRKVKRIEKNWAPFFVKQ-SNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVF 451
             I G + ++ EKNWAPFF +  + T S  SRG +H +YSF P E++KCSLNDG+C+ VF
Sbjct: 458 FDIKGHRARKKEKNWAPFFHEDDTKTISLLSRGFIHFVYSFSPFEVIKCSLNDGMCEKVF 517

Query: 452 EADTLESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMI 511
           + ++L+ + ++ +  MRG TQ  +LPS +P+V GKQ+W+G  K H+  CGCG  +YRPM+
Sbjct: 518 QKESLKLSNKNNYGGMRGGTQIVQLPSIIPKVTGKQMWLGIAKSHIEYCGCGRHFYRPML 577

Query: 512 SVLVEHNGVYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLE 571
           S+ VE NGVY+ ELVVP LDF   V+ W+ + + C  +N+++PNSI+ WE++ Q+P T +
Sbjct: 578 SLFVESNGVYHQELVVPYLDFNTEVIGWNNQENKCDYINIMSPNSISAWEVLGQDPLTKK 637

Query: 572 FDDYMSLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKE 610
           FDDY+ +T SE+D  ++++ V+G+L+Y+L +Y +K ++E
Sbjct: 638 FDDYLVITYSESDILSKVITVRGMLDYILRLYGEKDIEE 676

>TBLA0B00700 Chr2 (152367..154511) [2145 bp, 714 aa] {ON} 
          Length = 714

 Score =  443 bits (1140), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 236/598 (39%), Positives = 357/598 (59%), Gaps = 42/598 (7%)

Query: 76  KKDLLNIDLTKTLRFKDFNRSPVHIETLG-QKYTENQLLGYVSNLE---------SQGGK 125
           K +L  +DL      +D +  P+    L  + Y   Q+ GY++NL+         S+  +
Sbjct: 122 KTELSGVDLISLANKRDVSAFPISESILNDENYESYQVKGYITNLKLEGLISKKNSEAPQ 181

Query: 126 DRATIG--------------DYEREATCDTLQYINKVEYSKETKYLPLDLVRVRKELMT- 170
            + T G              DY+    CD L+Y  K+ YSKE K +  DL+ VRK L++ 
Sbjct: 182 KQDTKGKLVTVKDLELLSSKDYKDLVECDDLEYEAKIFYSKEQKMIKDDLIGVRKYLLSK 241

Query: 171 --NPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSKI 228
             + +  F+ +  H   + EKD SD EIV+K WF FG  SVW +  QC+   +R+++S  
Sbjct: 242 DFDVEDRFIAE--HVQQENEKDKSDYEIVKKSWFRFGSSSVWMESEQCYITVTRLMYSSH 299

Query: 229 PRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCDHLKA 288
             +  P  SL+ AQAFD+NW EI   ++P  D+ IP +++ E+EKL++D  L K D  K 
Sbjct: 300 GSKAGPDISLIRAQAFDRNWEEIKDKRIPKHDIQIPQNIDLEIEKLESDYSLTK-DTCKI 358

Query: 289 IGKDAS-FDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKS-YLGPEDPH 346
              D + +D C+ E+ KI  + ++R   II +YF  YP+V +  F   +K+ + G EDP 
Sbjct: 359 FIYDPTKYDTCIAEKNKIYFENKRRMQNIIDQYFVTYPTVYK--FPMLEKTQFAGSEDPR 416

Query: 347 VIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKN 406
           ++++   N    EEP+V FNM    +  NR+M    PHRK  P++ +   G  +  +EKN
Sbjct: 417 IVLRKFHNQ---EEPVVVFNM---DTKQNRKMHALFPHRKLNPLLELNFEG--MNHMEKN 468

Query: 407 WAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEFLS 466
           WAPFF       S FSRG++H +Y + PLEI+KCSL+DGIC+ +F   TL  TK++ F  
Sbjct: 469 WAPFFTDSDINTSMFSRGSIHFMYHYTPLEIVKCSLDDGICEKIFTKQTLGLTKKNHFGG 528

Query: 467 MRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELV 526
           +RG TQF +LPS +P++ GKQI+VGF K H++ CGCG K+YRPM+ V++E +G+Y+ EL+
Sbjct: 529 IRGGTQFVQLPSIIPRIHGKQIFVGFSKLHIDDCGCGSKFYRPMLDVIIEEDGIYHQELI 588

Query: 527 VPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSN 586
           VPSLDF I VL W  K H C   N+L+PNSI +W+++ Q+PKT +F+D +  T SEAD  
Sbjct: 589 VPSLDFNIEVLDWSTKSHTCNFYNILSPNSIAFWDVIKQDPKTKKFEDLLVFTFSEADEV 648

Query: 587 TEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKTH 644
           ++++ +KGLL Y+L +Y  K ++E+F  + +S+ I+G+T+ CV       CK YG  H
Sbjct: 649 SKVINIKGLLEYILNLYSTKQIEENFIPSFNSDTILGETLQCVKSNAEQICKNYGLIH 706

>TBLA0H03920 Chr8 (950326..952200) [1875 bp, 624 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 624

 Score =  433 bits (1114), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 231/602 (38%), Positives = 364/602 (60%), Gaps = 39/602 (6%)

Query: 68  QNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLG-QKYTENQLLGYVSNLESQGGKD 126
            N+K +  KK+L  +DL+  L  +  N+ P+ +E L    Y      GY++N+ S+    
Sbjct: 5   SNLKLLNNKKELSTLDLSTFLNKRPINKFPITLELLDYSNYNPFNFKGYITNINSRNLSR 64

Query: 127 RATIG--------------------DYEREATCDTLQYINKVEYSKETKYLPLDLVRVRK 166
             T                      DY    +C+ L+Y +++ YSK+ K +  DL+ + +
Sbjct: 65  YETTDYQPKSGELVPIKTFELSSSTDYASLVSCEDLEYPSRIYYSKDRKVIKDDLISLCQ 124

Query: 167 ELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFS 226
           +L++    +F+ K ++ N D +K+ +D EI++K WF FG  S+W +  QC+   +RV++S
Sbjct: 125 DLIS--ANDFITKNIY-NKDEDKEKTDFEIIKKSWFRFGSSSIWLESEQCYITVTRVMYS 181

Query: 227 KIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYK--CD 284
               +  P  SL+ A+AFD+NWNEI   ++P +D+ +P ++E EL  +D + G+ +  CD
Sbjct: 182 ATGAKTGPDVSLLRAEAFDRNWNEIKNKRIPKLDITMPKNIEHELRNIDIEYGISENSCD 241

Query: 285 HLKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPED 344
             K+   D  ++ C+ E+TKI L+ +KRK+ ++++YF  YP+V +  F S D+ + G ED
Sbjct: 242 KFKSNIVD--YENCIVEKTKIFLENKKRKEFLLNQYFVTYPTVYKFPFIS-DRQFSGAED 298

Query: 345 PHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIE 404
           P +I++     +G  EP+V FNM    + ++RRM  + PHR   P+I ++     +K  E
Sbjct: 299 PRIILRN----NGKVEPVVVFNM---ETGTSRRMHVYFPHRTLNPVIELSF-PDGMKNTE 350

Query: 405 KNWAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEF 464
           KNWAPFF   ++  S FSRG +H +Y+F PLEILKCSLNDG C  VF   TL  T ++EF
Sbjct: 351 KNWAPFF-SNNDDGSDFSRGYIHFVYNFSPLEILKCSLNDGRCKKVFTKQTLGLTGKNEF 409

Query: 465 LSMRGSTQFYKLPSDL-PQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNL 523
             +RG TQF  LP  + P++  KQIWVGF K H+N CGC   +YRPM++++VE  GVY+ 
Sbjct: 410 GGVRGVTQFVALPXXIIPKIADKQIWVGFSKLHINDCGCAENFYRPMLNIIVEEKGVYDQ 469

Query: 524 ELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEA 583
           EL+VPS++F   VL W  K + C   NV++PNSI +W+ VNQ+P T +F+D +  T SEA
Sbjct: 470 ELIVPSMNFEPEVLDWSTKSYACNCYNVMSPNSIVFWDAVNQDPITKKFEDLLVFTYSEA 529

Query: 584 DSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKT 643
           D  ++++ ++G+L+YVL +Y  K ++E F  +K+S+ I+GKT+ CV       CK+YG  
Sbjct: 530 DKVSKVINIRGILDYVLKLYEVKDIEETFIPSKNSDAILGKTLSCVKDYAMKVCKDYGLE 589

Query: 644 HP 645
           HP
Sbjct: 590 HP 591

>TBLA0C07250 Chr3 complement(1761923..1764001) [2079 bp, 692 aa]
           {ON} 
          Length = 692

 Score =  412 bits (1060), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 216/601 (35%), Positives = 362/601 (60%), Gaps = 29/601 (4%)

Query: 56  SIRSIKYKYNSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGY 115
           SI++  Y ++S   +K V  KKDLL+ D +  L+ K F   P++     +K+ E     Y
Sbjct: 107 SIKNTTYFFSSNNRLKPVTSKKDLLSSDFSSILKVKSFKNRPINNIMRNRKFEEYSFNSY 166

Query: 116 VSNLESQGGKDRATIG----------DYEREATCDTLQYINKVEYSKETKYLPLDLVRVR 165
           ++NL+     D  +            D E++  CD+L+Y +K+ YS +   +  D++ +R
Sbjct: 167 LTNLDPDFLIDNHSKKFQNLAEGEKKDIEKKLDCDSLKYSSKISYSSDRTIISDDIISIR 226

Query: 166 KELM-TNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVI 224
           K+L+  N +F    + + A ++ +K+L   EI++K WF FG  SVW +  QC+   SR++
Sbjct: 227 KQLLDANDEFS---RAIVATDEKDKELD--EIIKKRWFQFGASSVWLESEQCYLTISRIL 281

Query: 225 FSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYK-C 283
           ++    ++ P  S + AQ FD+NWNE+ G ++  +D+  PA++EKEL+K+D++ GL   C
Sbjct: 282 YTPKEDKSQPKISFLRAQTFDRNWNELTGKRIAKIDVVAPANIEKELKKIDDEYGLSNGC 341

Query: 284 DHLKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPE 343
           + +  +     ++KC+ +Q   +L+A++RK+ ++ KYF  YP++ +I F + D  + GPE
Sbjct: 342 ESI--VSDPNVYEKCISKQNNQRLEAQERKNLLLDKYFVTYPTIYKIPFDT-DGKFRGPE 398

Query: 344 DPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRI 403
           DP +I++   N    EEP++ FNM    ++  R + TF PHR  E + ++ ++  KV + 
Sbjct: 399 DPRIILRKIHNN---EEPVIIFNM---GNEEGRGIHTFLPHRAIEQLQKLKVSNFKVLKK 452

Query: 404 EKNWAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESE 463
           EKNW PFF +     S   RG +H +YSF P +ILKCSL+DG CD +     + S K   
Sbjct: 453 EKNWTPFFTEDDIPASILLRGFIHFVYSFSPFQILKCSLDDGYCDMI---TGVNSEKFKS 509

Query: 464 FLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNL 523
           F ++RG++QF  LP  +PQV+  QIW+GFPK H +GCGCG  +YRP++ +++EHNG+++ 
Sbjct: 510 FHAIRGASQFVPLPEPIPQVRDTQIWLGFPKTHSSGCGCGSHFYRPLMMLMIEHNGLFHQ 569

Query: 524 ELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEA 583
           E + P+++F +NV SWD     C   NV+ PNSI  W+IV  + K+ + +DY+ LT SEA
Sbjct: 570 EFIAPNINFNVNVQSWDHGDARCDWNNVMTPNSIAAWDIVEHDHKSNKIEDYLVLTYSEA 629

Query: 584 DSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKT 643
           D  +++V+++GL+N++L +Y  K + E +  +  +  ++ KTV C     RDDC +Y + 
Sbjct: 630 DEVSKVVIIRGLVNHILQMYHKKDVSEKYTPSPFTRNMMKKTVSCAINQLRDDCAKYAEI 689

Query: 644 H 644
           H
Sbjct: 690 H 690

>KNAG0E03160 Chr5 complement(630192..632051) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score =  398 bits (1023), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 218/583 (37%), Positives = 344/583 (59%), Gaps = 32/583 (5%)

Query: 69  NIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNLESQGGKDRA 128
           N K + Q  DLL++D++K L+ ++  R+        + +++  + GY+S L      D +
Sbjct: 61  NRKQLPQYSDLLSVDISKELKGQNLTRNGFDASLTEKHFSKKNVEGYMS-LPLDFVDDSS 119

Query: 129 TIGDYEREATCDTLQYINKVEYSKETKYLPLDLVRVRKELM--TNPKFEFLRKQMHANND 186
                         +Y+N ++Y      + +D+++VR+ ++   +P    L++       
Sbjct: 120 LFS-----------KYVNVLDYYIWDYNIDVDVLKVREAVLDRQSPLGTLLKQS------ 162

Query: 187 AEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSKIPRRNHPHFSLVAAQAFDK 246
            EKD  D E +QK WF FG V+VW +  Q + VY+R  +SK   RN P+ SL+  QAFD+
Sbjct: 163 DEKDWDD-EKIQKRWFAFGTVAVWLEREQVYLVYTRTFYSKQSIRNAPYISLIYGQAFDR 221

Query: 247 NWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCDHLKAIGKDASFDKCVEEQTKIK 306
           NW E+   +VPY D+++PA+VE++L +L + + +  CD  K   + + +D C++   K  
Sbjct: 222 NWKELQDFRVPYEDVDVPAEVEEKLVELQDKIEMNSCDD-KINEEKSVYDTCMKSAQKKN 280

Query: 307 LKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDPHVIMKGGINGDGIEEPLVFFN 366
            K E+R D+I+ KY   YPSV+EI F   D ++ GPEDP +++K      G EEP++ FN
Sbjct: 281 SKIEERIDKILDKYSVRYPSVMEIPFVIHD-NWNGPEDPRIVLK---KTRGHEEPVIVFN 336

Query: 367 MLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFVKQSNTES-AFSRGT 425
           M    S  NR+ + F PHRK  PM++  I    ++ +EKNW+ FF ++  +ES   S G+
Sbjct: 337 M---ESRVNRKFYAFQPHRKFNPMVQFDIENHDLRSVEKNWSAFFHEEDVSESNPDSPGS 393

Query: 426 VHLIYSFFPLEILKCSLNDGICDTVFEA-DTLESTKESEFLSMRGSTQFYKLPSDLPQVK 484
           +H +YSF PLEILKCSL DG+C+  ++  +T       +F ++RG TQF  LP+ LP V 
Sbjct: 394 IHFVYSFEPLEILKCSLFDGMCNVTYKGTETGGERANKKFTAIRGGTQFVSLPAVLPGVA 453

Query: 485 GKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELVVPSLDFGINVLSWDLKGH 544
            + IWV   K ++  CGCG ++YR  ++V+VE  G Y ++++ P++DFG   LSWDLK H
Sbjct: 454 NRNIWVAMAKTNVENCGCGSRFYRAALAVMVETAGEYKIDMIAPNVDFGTEPLSWDLKSH 513

Query: 545 YCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSNTEIVVVKGLLNYVLGIY- 603
            C  +NVL+PN I  WEIV+Q+P+T  FDDYM+LT SEAD+ +  V V+G+LNYVLGIY 
Sbjct: 514 LCGGLNVLSPNGITSWEIVSQDPQTKSFDDYMTLTFSEADAVSRFVTVRGVLNYVLGIYA 573

Query: 604 RDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKTHPE 646
           +D+   +      ++ +++ +    VA++    C  YG  H E
Sbjct: 574 KDRNNHQGDASTSNTTVLLEQMFKDVAESALRFCSIYGLGHKE 616

>KAFR0G00110 Chr7 (27758..28786) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score =  388 bits (996), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 184/344 (53%), Positives = 254/344 (73%), Gaps = 10/344 (2%)

Query: 304 KIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYL-GPEDPHVIMKGGINGDGIEEPL 362
           K KLK +KR DE++S+Y+  YPS++ + F+     +L GPEDPHVI+K        EEP+
Sbjct: 3   KKKLKFQKRYDELLSRYYLTYPSIINVPFELG--GFLKGPEDPHVILK---KKKKYEEPI 57

Query: 363 VFFNMLDHYS-DSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFVKQSNTE-SA 420
           + FNM  H S D  RR++ F PHRK +P+++ +I  RKV+  EKNWAPFF     +E S 
Sbjct: 58  IIFNM--HASEDGKRRIYAFHPHRKIDPLVKFSIEDRKVRHKEKNWAPFFSYHDESENSV 115

Query: 421 FSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEFLSMRGSTQFYKLPSDL 480
           FSRG +H IY++ PLEILKCSLND IC+ VFEA T+E++ ++++  MRG TQF KLP+D+
Sbjct: 116 FSRGFIHFIYTYAPLEILKCSLNDRICEMVFEASTIEASDKNKYGDMRGGTQFVKLPTDI 175

Query: 481 PQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELVVPSLDFGINVLSWD 540
           PQV GKQ+W+GFPK H +GCGCG  YYRPM+S+LVE +G Y+LELVVP++DF  +VLSWD
Sbjct: 176 PQVNGKQMWLGFPKSHSSGCGCGRHYYRPMLSLLVETHGAYHLELVVPTMDFERDVLSWD 235

Query: 541 LKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSNTEIVVVKGLLNYVL 600
           LKG YC  V++++PNSI YWE+V Q+ +  +FDDY+  T SE+D+ T++VV+K +LNY+L
Sbjct: 236 LKGSYCEGVSIMSPNSIAYWEVVEQDVENEKFDDYLGFTFSESDATTKVVVLKNVLNYIL 295

Query: 601 GIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKTH 644
            IY++K +++ FEI+K S+ IIG T+ CV     DDC +Y KTH
Sbjct: 296 DIYKEKRIRDHFEISKESDNIIGNTLQCVKDKLWDDCAKYDKTH 339

>TBLA0C07280 Chr3 complement(1770359..1772623) [2265 bp, 754 aa]
           {ON} 
          Length = 754

 Score =  394 bits (1012), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 220/629 (34%), Positives = 349/629 (55%), Gaps = 72/629 (11%)

Query: 72  TVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNLE----------- 120
            V  K+DLLN+D+   L+FKDF  SP+  +   ++Y +  + GYVSN++           
Sbjct: 140 NVYSKRDLLNVDINPFLKFKDFKNSPISNKIRKEQYLKMDVNGYVSNIKLPAPIDSKNQN 199

Query: 121 SQGGKDRATI---------GDYEREAT---------------------------CDTLQY 144
             G K  + I          DY R  T                           CDTL+Y
Sbjct: 200 HHGIKQNSIIDENENINNKNDYGRLDTLFYNNFFLNGKYSTSLASILNDSKLIDCDTLRY 259

Query: 145 INKVEYSKETKYLPLDLVRVRKELMTN----PKFEFLRKQMHANNDAEKDLSDLEIVQKY 200
            N++ YSKE   +   L  +R++++       K+ F        +D EKD S  E+V+ +
Sbjct: 260 ENEISYSKERILIQDSLFDIREQVLGRDDPLSKWTF--------HDNEKDKSVDEVVRTH 311

Query: 201 WFTFGGVSVWSDEYQCFFVYSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVD 260
           W  FG  ++W +  QC+   +RV++S    ++ P  S++ AQAFDK W+EI G K+  +D
Sbjct: 312 WGKFGSATIWLETEQCYITVTRVMYSSRGLKSAPDVSMIRAQAFDKYWHEIKGKKIRKID 371

Query: 261 LNIPADVEKELEKLDNDLG-LYKCDHLKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISK 319
           + +P D+E +L  +D +   L  C+ L        +  C+ +  +I      RK++I   
Sbjct: 372 VELPDDIEIQLANIDKEFDQLISCESLFE-NDSNQYKSCIAKNKEITDNINDRKNKITDS 430

Query: 320 YFRMYPSVLEIEFKSADKSYL-GPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRM 378
           Y+  YP+V +  F    + YL GPEDP +I++   NGD  +EP+V FNM +      RRM
Sbjct: 431 YYITYPTVYQFPFNP--RGYLRGPEDPRIILRK--NGDK-QEPVVVFNMDNG---DGRRM 482

Query: 379 FTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFVKQS-NTESAFSRGTVHLIYSFFPLEI 437
           + F PHR  +  +   +   K   ++KNW PFF ++   T S  S GT+H I  F P E+
Sbjct: 483 YGFLPHRAFDNFVHFYLREDK-NSVQKNWTPFFTEEDIETVSDVSPGTIHFIRRFAPFEV 541

Query: 438 LKCSLNDGICDTVFEADTLESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHL 497
           ++CSL DG+CD V++++ L       F  +RG TQ   LP  +P++ GKQ+W+GF K HL
Sbjct: 542 VQCSLLDGVCDMVYKSEFLNDPAGHNFGIVRGGTQMVPLPDIIPKIFGKQMWIGFTKLHL 601

Query: 498 NGCGCGFKYYRPMISVLVEHNGVYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSI 557
           + CGCG ++YRPM+++LVE +GVYN +L+VPS+DF  +VLSWD     C + NV++PNSI
Sbjct: 602 DKCGCGERFYRPMLTLLVEKDGVYNQDLIVPSMDFQTDVLSWDRVSTECKEYNVMSPNSI 661

Query: 558 NYWEIVNQNPKTLEFDDYMSLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKS 617
             W++V Q+PKT +FDD++  + SEAD+ ++++ V+G+L+Y+L IY  K ++EDF  +  
Sbjct: 662 AAWDVVGQDPKTRKFDDFLIFSYSEADAVSKVITVRGILDYILNIYSQKDIEEDFIQSDD 721

Query: 618 SNMIIGKTVGCVAKATRDDCKEYGKTHPE 646
           ++ I   +  C+ +  ++ CK YG+ H +
Sbjct: 722 TDFIFMNSFECLHEEAKNICKAYGEKHKQ 750

>TBLA0B00690 Chr2 (149162..151186) [2025 bp, 674 aa] {ON} 
          Length = 674

 Score =  384 bits (987), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 215/587 (36%), Positives = 334/587 (56%), Gaps = 34/587 (5%)

Query: 65  NSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETL-GQKYTENQLLGYVSNLESQG 123
           +SL N+  +  K  L NIDLT  +  +  +  P+  E +    Y   +  G + N +S  
Sbjct: 117 SSLDNV-LIKSKNQLTNIDLTNIVNQRSISDFPLSKELMKDSSYGTYKFSGIIFNPKSSN 175

Query: 124 GKDRATIGDYEREATCDTLQYINKVEYSKETKYLPLDLVRVRKELMTNPKFE---FLRKQ 180
                      ++  C  L+Y +++  SK++  L   L  +RK L++  K E   F+ KQ
Sbjct: 176 LSIEQNHKSDTKDIECKYLEYTSEIFVSKKSITLGEKLGPIRKHLLSQDKDEIDKFIAKQ 235

Query: 181 MHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSKIPRRNHPHFSLVA 240
           +      EK LS+  I +K WF FG  SVW +  QCF   SR+++S    +  P+ SL+ 
Sbjct: 236 I--TKKEEKGLSNDAIAKKNWFMFGSSSVWMESEQCFLTVSRLMYSPDGSKKVPNISLIR 293

Query: 241 AQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCDHLKAIGKDASFDKCVE 300
           AQ FDKNW EI G ++P ++  IP + +  L  LD     Y C        D ++++C  
Sbjct: 294 AQTFDKNWKEIKGKRIPILETAIPIEDQTILNNLD-----YNC----CKESDLNYEEC-- 342

Query: 301 EQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDPHVIMKGGINGDGIEE 360
                 LK +  + E+I KY+  YP+V +       K Y+GPEDP +I+K   N   IEE
Sbjct: 343 ------LKNKNTRQELIDKYYVTYPTVYKFPMLEK-KVYMGPEDPKIILKKTGN---IEE 392

Query: 361 PLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFVKQSNTESA 420
           PL+ FNM   ++   RRM  FSPHR+   ++ +   G  ++ +EKNWAPF   +      
Sbjct: 393 PLIVFNMATTHA---RRMHVFSPHREINRIVELNFKG--IRGMEKNWAPFLTSKDLEPVT 447

Query: 421 FSRGTVHLIYSFFPLEILKCSLNDGICDT-VFEADTLESTKESEFLSMRGSTQFYKLPSD 479
            SRGT+H +Y++ PLEILKCSL+DG C+   F +   + + +S F  +RG TQF +LPS 
Sbjct: 448 GSRGTIHFVYNYEPLEILKCSLDDGYCEKEYFSSKHSKRSNKSNFGHIRGGTQFVQLPSA 507

Query: 480 LPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELVVPSLDFGINVLSW 539
           +P +K KQI+VG  K HLN CGCG ++YRP++ ++VE  G Y  EL+VPS+DF I VL+W
Sbjct: 508 IPNLKDKQIFVGLAKTHLNDCGCGSRFYRPILDIIVEEKGTYYHELMVPSMDFNIKVLNW 567

Query: 540 DLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSNTEIVVVKGLLNYV 599
           DL    C   N+L+PNSI +W+I+ Q+PKT  F+D +  T SEAD  ++++ +KGLLNY+
Sbjct: 568 DLDSDKCKFYNILSPNSIAFWDIIRQDPKTKNFEDVLVFTFSEADELSKVINIKGLLNYI 627

Query: 600 LGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKTHPE 646
           L +Y    + E   ++ ++++ +  ++ CV   +++ CK+YG+ + +
Sbjct: 628 LQMYAKNDISESKTVSANNDIELQNSMKCVRSYSQNSCKKYGELYAQ 674

>TBLA0F01560 Chr6 complement(387571..389697) [2127 bp, 708 aa] {ON} 
          Length = 708

 Score =  385 bits (989), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 213/617 (34%), Positives = 346/617 (56%), Gaps = 65/617 (10%)

Query: 70  IKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNLESQG------ 123
           I+ V  K+ L+++D++K + +   N SP++   + +KY++ ++ G+VSNL S+       
Sbjct: 115 IEYVDTKRALVDLDISKNIHYNP-NSSPINSRIINEKYSKYEVKGFVSNLNSEKLKAKKH 173

Query: 124 --------------GKDRATIG----------DYEREATCDTLQYINKVEYSKETKYLPL 159
                           D   I           DY    TC+ L + + + YS     +  
Sbjct: 174 KKSHKDKLDINNFKNSDGEIISVKNFETLLSDDYSSLTTCEDLAFTSSISYSDNRTVIGE 233

Query: 160 DLVRVRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFV 219
           ++  +R+E++ +  F  L++ ++ N++ E++  + EIV K W  FG   VW +  QC+  
Sbjct: 234 NIFSLREEILNSTSF--LKEILYENDELERE--NEEIVNKRWNQFGTSGVWLEGEQCYIT 289

Query: 220 YSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEI-----IGLKVPYVDLNIPADVEKELEKL 274
            SR+++SK   ++ P  S +  QAFD++WNEI     +    P +  N     EKEL K 
Sbjct: 290 ASRIMYSKSESKSDPTVSFIRLQAFDRDWNEIKNKSILKFDAPDIIQNTLRKFEKELSKE 349

Query: 275 DNDLGLYKCDHLKAIGKDASFDKCVE-----EQTKIKLKAEKRKDEIISKYFRMYPSVLE 329
            +   +Y+   +     +  +++C+E     EQ K+      RK+ ++ +Y+  YP+  +
Sbjct: 350 VDCEQIYREKDVS----NTEYEQCIENKDYFEQLKV------RKNTLLRRYYVTYPTNYD 399

Query: 330 IEFKSADKSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEP 389
           + F   +K + GPEDP +I++   N   +EEP++ FNM D  S   R+M  + PHR    
Sbjct: 400 VPFNLPEK-FAGPEDPRIILRRTKN---VEEPIIIFNMNDGES---RKMHAYLPHRNVNK 452

Query: 390 MIRMTINGRKVKRIEKNWAPFFVKQS-NTESAFSRGTVHLIYSFFPLEILKCSLNDGICD 448
           +++           EKNWAPFF +Q    +S  S G++HL+Y   PLEI +CSL+DG+C+
Sbjct: 453 VVKFRFENMN-HDTEKNWAPFFTEQDLQLDSILSHGSIHLVYRLNPLEIARCSLDDGLCE 511

Query: 449 TVFEADTLESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYR 508
            VFE  TLE +K+S    +RG TQF  LPS +P++ GKQIWVGF K HL GCGC   YYR
Sbjct: 512 KVFEKSTLELSKQSVNTDIRGGTQFIPLPSSIPKINGKQIWVGFTKIHLRGCGCSEHYYR 571

Query: 509 PMISVLVEHNGVYNLELVVPSLDFGINVLSWDLKGHYC-FDVNVLNPNSINYWEIVNQNP 567
           PM+SV+VE +GVY+ +LVVP+L F  +V++W   G  C    N+++PNSI  WE+V Q+P
Sbjct: 572 PMLSVMVEKHGVYHQDLVVPNLSFETDVINWQADGTKCNRGNNIMSPNSIAAWEVVGQDP 631

Query: 568 KTLEFDDYMSLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVG 627
            T + DDYM  T SE+D  + ++ ++G+L Y++ +Y +  + EDF  ++ S+ I+GK++ 
Sbjct: 632 FTKKIDDYMVFTYSESDKVSSVITIRGVLEYIIRVYGETDVDEDFIPSQESDTILGKSLN 691

Query: 628 CVAKATRDDCKEYGKTH 644
           C    +   CK+YGK H
Sbjct: 692 CFVDFSVHLCKQYGKAH 708

>KNAG0D03060 Chr4 (549174..551069) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  369 bits (948), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 201/584 (34%), Positives = 340/584 (58%), Gaps = 29/584 (4%)

Query: 72  TVAQKKDLLNIDLTKTLRF--KDFNRSPVHIETLGQKYTENQLLGYVSNLESQGGKDRAT 129
            V +K+ L N+DLT+TL    K +  S  + E L +++ +  ++GYVSN++    +  A 
Sbjct: 66  VVTEKEFLSNLDLTETLSKMKKKWLMSRFNNELLTKRFRKENVVGYVSNIDLSKTQAYAR 125

Query: 130 IGDYEREA------TCDTLQYINKVEYSKETKYLPLDLVRVRKELMT--NPKFEFLRKQM 181
           +   +R +       C  +Q  + +E     + + +D+  VR  L++  +P   +L    
Sbjct: 126 LKPDDRNSWIEDSLGCKEMQQPHVLESYVWDQKIKIDIYNVRNMLISQNHPLRTYLI--- 182

Query: 182 HANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSKIPRRNHPHFSLVAA 241
              ++ EK +S  +I+++ W+ FG  +VW ++  C+ VY+R+++SK  +RN P  SL+  
Sbjct: 183 ---SEEEKHMSTKDILRENWYAFGSSAVWLEKENCYLVYTRLMYSKEHKRNIPFMSLIYG 239

Query: 242 QAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCDHLKAIGKDASFDKCVEE 301
           QA+D++WN + G  + Y D+ +P  V++E+EKL  +     CDH+K   K   F++C+  
Sbjct: 240 QAYDRDWNLLPGKMIRYNDIAMPDVVKQEVEKLKYERENTSCDHVKHDAK--QFEECLTI 297

Query: 302 QTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDPHVIMKGGINGDGIEEP 361
              +    + R   +  +Y+  YP+V++I     +  Y GPEDP  I+     G   EEP
Sbjct: 298 YKDMMQDIDVRLAALQDRYYISYPTVIDIPM-VINHVYNGPEDPRSILHKNQRG---EEP 353

Query: 362 LVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFVKQSNTESAF 421
           L+ FNM    ++  RR+ +F PHRK   ++R       + R EKNWAPF    ++    F
Sbjct: 354 LLLFNM---ETEGYRRIHSFYPHRKINSLVRFESTDMSLSRTEKNWAPFLTDPASENDRF 410

Query: 422 SRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEFLSMRGSTQFYKLPSDLP 481
              ++H +Y+  PL I +CSL DG C TVF+   +E   ++    +RG TQF KLPS +P
Sbjct: 411 PEESIHFVYNLMPLIIFRCSLFDGKCRTVFKDHNIE---DASVGLIRGGTQFVKLPSVIP 467

Query: 482 QVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELVVPSLDFGINVLSWDL 541
           +V+G+ +WV F K H+  CGC   +YRPM++V+VE +G +N+E + P +DF ++VL+W L
Sbjct: 468 EVEGRAMWVAFTKSHVKECGCTGAFYRPMLTVMVEKDGAFNIETITPVVDFKMDVLNWSL 527

Query: 542 KGHYCFDV-NVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSNTEIVVVKGLLNYVL 600
            G  C  + NVL+PNSI+ W++++Q+ +T +++DYM++ VSE+D N+++VVVKG+LN+V+
Sbjct: 528 DGTSCVGLNNVLSPNSISSWDVISQDAETGQYEDYMTVIVSESDVNSKLVVVKGVLNFVI 587

Query: 601 GIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKTH 644
            IYR   +++ +  ++ S +I  K   C  +  RD C  Y  TH
Sbjct: 588 DIYRKFQVRDTYTADEESALINKKQFKCTEQDLRDFCALYSDTH 631

>KNAG0E04230 Chr5 (841386..843179) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  366 bits (940), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 194/507 (38%), Positives = 306/507 (60%), Gaps = 17/507 (3%)

Query: 139 CDTLQYINKVEYSKETKYLPLDLVRVRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQ 198
           C  +QY N +E   E   + +DL +VR+ L++  K ++  K   A++  E+  S   +V+
Sbjct: 107 CAEVQYNNLIESHVEDSDVQIDLAKVRQMLIS--KSDYWHKLFTASD--EEQWSVNHVVR 162

Query: 199 KYWFTFGGVSVWSDEYQCFFVYSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPY 258
           K WF FG  +VW  E  C+ VY+RVI+S    ++ P+ S+V AQA+DK+WNE+IG K  Y
Sbjct: 163 KRWFAFGTSAVWYPEGDCYLVYTRVIYSDAGIKDKPNISVVYAQAYDKDWNELIGKKFNY 222

Query: 259 VDLNIPADVEKELEKLDNDLGLYKCDHLKAIGKDASFDKCVEE-QTKIKLKAEKRKDEII 317
            D+ +P  V++EL+ L   +   +C+  K       +++C +E Q +IK + + R +EI 
Sbjct: 223 YDVKMPEYVQEELDSLWGFIADLQCEEYK--NNPEQYNRCSKENQPRIK-ETQLRINEIE 279

Query: 318 SKYFRMYPSVLEIEFKSADKSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRR 377
           + Y   YP+VL+I+F      + GPEDP   + G      I+EP++ FNM    +  +RR
Sbjct: 280 AHYSITYPTVLDIDF-IVHGLFSGPEDPRAFLMGAPGK--IQEPILVFNMQ---ATEHRR 333

Query: 378 MFTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFVKQSNTESAFSRGTVHLIYSFFPLEI 437
           M +F PHR+   +I  +    +++  EKNWAPFF  + + +  F    ++ I+ F P+ +
Sbjct: 334 MHSFRPHRRNNALIEYSRTDGELRNQEKNWAPFFHYRQDEKIDFPDEQIYFIHDFTPMNV 393

Query: 438 LKCSLNDGICDTVFEADTLESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHL 497
           L+CSL DG C   F+    E  K+ +   +RG TQ+ + PS +P+VK  Q+WVGF K H+
Sbjct: 394 LRCSLFDGSCVVAFDE---EPAKKDKLSLIRGGTQYIRFPSIIPEVKDWQMWVGFAKSHI 450

Query: 498 NGCGCGFKYYRPMISVLVEHNGVYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSI 557
             CGCG  +YRP +S+LVE  G Y+LE + P+LDFGI+VL+W   G  C   NVLNPN+I
Sbjct: 451 PPCGCGGNFYRPQLSLLVESEGKYHLEFLTPTLDFGIDVLNWSGDGSKCDGHNVLNPNTI 510

Query: 558 NYWEIVNQNPKTLEFDDYMSLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKS 617
           + WE+V Q+  T  ++DY++LT+SEAD  +  V V+G+LNYVLG+Y  K +K+ + ++  
Sbjct: 511 SNWEVVGQDEATGLYEDYLTLTISEADIKSSFVTVRGVLNYVLGVYGKKEIKDTYNVDSK 570

Query: 618 SNMIIGKTVGCVAKATRDDCKEYGKTH 644
           +  +   T  C+  + +  CKEYG++H
Sbjct: 571 TLEVNKFTASCIGVSAQLFCKEYGESH 597

>TBLA0B04780 Chr2 complement(1124158..1126200) [2043 bp, 680 aa]
           {ON} 
          Length = 680

 Score =  365 bits (936), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 212/607 (34%), Positives = 326/607 (53%), Gaps = 50/607 (8%)

Query: 68  QNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNLESQGGKDR 127
           +N   V  K +L N+D+   +R  +  RS + +  L Q Y    + G+ S L        
Sbjct: 88  RNSNIVYSKNELANVDINSRVRNTNTERSSISLPNLRQPYKSLTISGFASQLNLAKSSIF 147

Query: 128 ATIG-----------------DYEREATCDTLQYINKVEYSKETKYLPLDLVRVRKELMT 170
             IG                   E   TCD L Y N++ YS E + +  D +++ K+ + 
Sbjct: 148 KKIGLKINDPSDPANLERIRFSSENLLTCDDLAYSNQILYSTE-RIIIKDNIKMIKDEIL 206

Query: 171 NPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSKIPR 230
            P  ++L  +  +  D+   L++ +++ + W  FG  SVW +  Q +   SR+ +S   +
Sbjct: 207 KPS-DWLSDKFTSPEDST--LTEEDLLSQKWGRFGTSSVWVESLQYYITVSRITYSADGK 263

Query: 231 RNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCDHLKA-- 288
           ++ P  SLV  Q FD+NWNE+ G  +P            +L    ND   +     KA  
Sbjct: 264 KSEPDVSLVRGQLFDRNWNEVKGKYIP------------KLHTYSNDRERHNNPRHKACE 311

Query: 289 --IGKDASFDKCVEEQTK-IKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDP 345
             I    S+  C+  ++   K + EK  ++ + K + +YP     EF +  K   G EDP
Sbjct: 312 EVINDPLSYYNCLNAKSSNSKPQDEKEWNKFLIKNYIVYPKTFHFEFNAVGKGK-GMEDP 370

Query: 346 HVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEK 405
            +I++      G EEP+V FN+ + +    R+MF+  PHR    +++   +      ++K
Sbjct: 371 RIILRKTA---GFEEPMVVFNLDNGHG---RKMFSLFPHRSERDLLQFNYH-EDGNTVQK 423

Query: 406 NWAPFFVKQSNTE-SAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEF 464
           NW PFF K+  T  + F  G VH I    PLEIL+CSL DG C  V+++     + E   
Sbjct: 424 NWTPFFSKEDLTGLTDFYSGYVHFIKRMHPLEILRCSLVDGSCKMVYKSRI---SSEKNI 480

Query: 465 LSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLE 524
             +RG TQ+  LP+ LP+V GKQIW+GFPK H+N CGCG ++YRPM+S+LVE NGV+N E
Sbjct: 481 DIIRGGTQYVPLPTILPEVYGKQIWIGFPKLHINKCGCGERFYRPMLSILVEENGVFNQE 540

Query: 525 LVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEAD 584
           ++VPSLDF  +VLSWD K   C   NV++PNSI+ WE++ Q+PKT  FDDY++LT  E+D
Sbjct: 541 MLVPSLDFETDVLSWDEKNSACGGFNVMSPNSISAWEVLAQDPKTKRFDDYLTLTYGESD 600

Query: 585 SNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKTH 644
           S + ++ V+G+L+YVL IY+ K +++ ++     + II  +  CVA +    CKEYG TH
Sbjct: 601 SRSSVITVRGILDYVLNIYKQKNLQDTYKDTLLDDFIIKTSFKCVADSAARTCKEYGLTH 660

Query: 645 PESDKDS 651
           PE   D+
Sbjct: 661 PEKTTDT 667

>Kpol_457.16 s457 (47317..48939) [1623 bp, 541 aa] {ON}
           (47317..48939) [1623 nt, 541 aa]
          Length = 541

 Score =  348 bits (892), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 176/462 (38%), Positives = 274/462 (59%), Gaps = 31/462 (6%)

Query: 57  IRSIKYKY-NSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGY 115
           ++++ Y+Y +++ +I+++  KKDLLN+++   L++K +   P+  + L   YT   + GY
Sbjct: 89  LQNVNYQYYSAINSIRSIKSKKDLLNVNIRNLLKYKRYESLPLTDKILNDDYTRYNITGY 148

Query: 116 VSNLE----------SQGGKDRATIGD----------YEREATCDTLQYINKVEYSKETK 155
           VSNL+           +   +    G+          YE   +CD L+Y + +EYS  TK
Sbjct: 149 VSNLDLAKHLANHKPEKKKNENVQKGEMLSEGNYHEGYENMVSCDDLEYNSYIEYSNFTK 208

Query: 156 YLPLDLVRVRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQ 215
            L  DL+  R+ ++        +     N   ++D  + +I+ K WF FG  +VW +++Q
Sbjct: 209 ILEDDLIEARRAIIKQGN----KASSVVNPKDQQDKKEEDIINKKWFRFGASAVWLEKHQ 264

Query: 216 CFFVYSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLD 275
           CF VYSRVI+S++ RRNHP  S +  Q FDKNW EI G ++PY D+ IP D+  ++E L 
Sbjct: 265 CFVVYSRVIYSQLDRRNHPKTSFLRGQTFDKNWREIKGKRIPYDDVTIPTDMINQIENLR 324

Query: 276 NDLGLYKCDHLKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSA 335
           N+ G   C+ +K      ++DKC+  Q   +LK  K  + ++SKY+  YP V ++ F + 
Sbjct: 325 NEFGETDCESIKKKNGKNAYDKCITNQANDRLKINKEIETVLSKYYVTYPIVFDLPFDT- 383

Query: 336 DKSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRMTI 395
           +  + GPEDP VI +      G EEP+V FN  D Y +  RRM+ F PHRK +P+++   
Sbjct: 384 NGDFKGPEDPRVIKRS---NSGFEEPIVLFNKHDDY-EGKRRMYAFFPHRKNDPLVKFKS 439

Query: 396 NGRKVKRIEKNWAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADT 455
           +   ++  EKNW PFF K+    S  SRG +H IY F P E+LKC+LNDG+C+ VF+A T
Sbjct: 440 DTFGLRHNEKNWTPFFHKEY-YRSKISRGYIHFIYQFMPFEVLKCNLNDGLCEKVFQAST 498

Query: 456 LESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHL 497
           L+ + +++   MRG TQF +LP+++P+VKGKQIWVGFPK H+
Sbjct: 499 LDLSSKNKHDGMRGGTQFVQLPAEIPEVKGKQIWVGFPKLHI 540

>CAGL0B02948g Chr2 complement(288006..289799) [1794 bp, 597 aa] {ON}
           weakly similar to DEHA0D05027g Debaryomyces hansenii and
           CA4636|IPF1520 Candida albicans
          Length = 597

 Score =  350 bits (897), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 178/454 (39%), Positives = 271/454 (59%), Gaps = 15/454 (3%)

Query: 201 WFTFGGVSVWSDEYQCFFVYSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVD 260
           WF FG    W ++ QC+  YSR+I S+   R HP  SL+AAQAFDK+WNE+IG ++ YVD
Sbjct: 151 WFMFGSSIEWLEDEQCYVAYSRLIISERKSRGHPSVSLIAAQAFDKDWNELIGKRIKYVD 210

Query: 261 LNIPADVEKELEKLDNDLGLY-KCDHLKA-IGKDAS----FDKCVEEQTKIKLKAEKRKD 314
           ++IP D + +L+ +D     + KC    A +  D +    +DKC  +  + +  AE  K 
Sbjct: 211 IDIPEDFDDQLKAIDEKYNAFAKCVEKSAEVHSDQANSENYDKCASQHKENQKLAEVEKQ 270

Query: 315 EIISKYFRMYPSVLEIEFKS-ADKSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSD 373
           E+I++YFR+YP+VL+I FK+  D  ++GPEDP VI++   N DG  EPLVF+N+ D   D
Sbjct: 271 ELINRYFRVYPTVLDIPFKTTGDLQFMGPEDPKVIIRR--NLDGTLEPLVFYNLEDDNYD 328

Query: 374 SNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFVKQSNTESAFSRGTVHLIYSFF 433
             R MF   PHRK  P++ +      + RI+KNW+PF +   + +   SRG VH+I    
Sbjct: 329 -RRLMFIVMPHRKINPIMPLVDEEFTITRIQKNWSPFIMDGDSVKGG-SRGFVHIIQHIV 386

Query: 434 PLEILKCSLNDGICDTVFEADTLESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFP 493
           P  +LKCSL+DG C  VF A  +E ++  E   +RG T F +LP  +P+  G+ IW+G  
Sbjct: 387 PTTVLKCSLDDGKCSFVFNASAIEGSQSIESRDIRGGTAFIRLPQGIPEFSGRNIWIGVI 446

Query: 494 KFHLNGCGCGFKYYRPMISVLVEHNGVYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLN 553
           K H+  CG   ++YRP ++++ E NG Y+   +  ++ F  +VL WDL+    F VN+++
Sbjct: 447 KVHIKDCGGTSQFYRPHLALMEERNGEYSFLSISSAIHFNRDVLGWDLESTSMFFVNIMS 506

Query: 554 PNSINYWEIVNQNPKTLEFDDYMSLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFE 613
           PNSI  W +V+ + +T  ++DYM L+ SEAD N+ I+ +KG+++YV  + RD        
Sbjct: 507 PNSIVSWNVVSHDQETDTYEDYMELSFSEADFNSHILTLKGVIDYVRQVLRDSDSTNQVS 566

Query: 614 -INKSSNMIIGKTVGCVAKATRDDCKEYGKTHPE 646
            +   S++ I K   CV    R+ C+ YGK H +
Sbjct: 567 ALEPHSSLAISK---CVCSHLREYCEGYGKLHEQ 597

>CAGL0B02882g Chr2 complement(279334..281184) [1851 bp, 616 aa] {ON}
           weakly similar to DEHA0A06369g Debaryomyces hansenii and
           CA4539|CaIFQ4 Candida albicans
          Length = 616

 Score =  331 bits (849), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 168/449 (37%), Positives = 269/449 (59%), Gaps = 12/449 (2%)

Query: 201 WFTFGGVSVWSDEYQCFFVYSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVD 260
           WF FG  + W ++ QC+  +SR+I SK   R HP  SL+ AQAFDK+WNE+ G ++ Y+D
Sbjct: 159 WFMFGTTAEWLEQEQCYVAFSRLIISKGRNRAHPSVSLITAQAFDKDWNELYGKRIKYLD 218

Query: 261 LNIPADVEKELEKLDNDLGLYK-C-DHLKAIG----KDASFDKCVEEQTKIKLKAEKRKD 314
           +  P D E++L+ +D    + + C  +++  G    ++A  + C++ + +  + AE+ K 
Sbjct: 219 VETPEDFEEQLKAIDEKYNVEEDCYTNVEEGGIESNQEADTNSCIKNREERAMLAEEEKQ 278

Query: 315 EIISKYFRMYPSVLEIEFKS-ADKSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSD 373
           E+  KYFR+YP++L+I FK+  +  ++GPEDP VI++   N DG +EPLV +NM D   D
Sbjct: 279 ELTDKYFRVYPTILDIPFKNKGNLDFMGPEDPKVIVR--TNTDGKQEPLVAYNMNDKNYD 336

Query: 374 SNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFVKQSNTESAFSRGTVHLIYSFF 433
             R MF   PHRK  P++ +      +   +KNW PFF  + +  S  SRG VH+I    
Sbjct: 337 -RRLMFVILPHRKINPIVPLVDKTFSISGTQKNWTPFF-HEGDASSDGSRGFVHVIQYMI 394

Query: 434 PLEILKCSLNDGICDTVFEADTLESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFP 493
           P  IL+CSL+DG C  VF+A+ ++S K+ EF  +RG + F ++P  +P++ G+++WVG  
Sbjct: 395 PTTILRCSLDDGRCIFVFKANEIDSLKKVEFKDLRGGSSFIRVPQGIPELDGRKLWVGMI 454

Query: 494 KFHLNGCGCGFKYYRPMISVLVEHNGVYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLN 553
           K H+  CG    +YRP + ++ E +G YNL  +  +L F   VL WD +  +   VNV++
Sbjct: 455 KSHIKKCGGATDFYRPHLVIMEEKDGKYNLLSLSSALHFDREVLGWDRETSFMVHVNVMS 514

Query: 554 PNSINYWEIVNQNPKTLEFDDYMSLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFE 613
           PNSI+ W I++ + +   ++DYM L+ SE+D  + I+ V+G+L+Y+L I RD    +  +
Sbjct: 515 PNSISSWNIISHDHENDSYEDYMELSFSESDCTSYILTVRGVLDYILKILRDGSDAKFLD 574

Query: 614 INKSS-NMIIGKTVGCVAKATRDDCKEYG 641
            N       +GK   CV    R+ C +YG
Sbjct: 575 WNADDLAAKVGKPPKCVCSHLREHCDKYG 603

>CAGL0B02970g Chr2 complement(291248..293137) [1890 bp, 629 aa] {ON}
           weakly similar to DEHA0A06369g Debaryomyces hansenii and
           CA4636|IPF1520 Candida albicans
          Length = 629

 Score =  330 bits (846), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/554 (32%), Positives = 313/554 (56%), Gaps = 32/554 (5%)

Query: 106 KYTENQLLGYVSNLESQGGKDRATIGDYEREATCDTLQYINKVEYSKETKYLPLDLVRVR 165
           +YT  + + Y+ N     G   A          C+ + + +K+EY+  TK++  +   + 
Sbjct: 87  EYTPFKFVNYLGNRNIPAGLKEAD--------ACNYISHESKLEYANVTKFIRPNFKVLS 138

Query: 166 KELM-TNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVI 224
           + +  T+P++    K +        D S  + + K WF FG  + W +E QC+ VYSR+I
Sbjct: 139 ESVKKTDPRWHDFLKGIAG------DKSIDDTLDKKWFMFGSSAEWLEEEQCYVVYSRLI 192

Query: 225 FSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYK-C 283
            SK   R HP  SLVAAQAFDK+W EI G ++ Y+D+  P +++++ + ++    L + C
Sbjct: 193 ISKEENREHPSISLVAAQAFDKDWKEIYGKRIKYIDVETPENLDEQFKAIEMKYNLTESC 252

Query: 284 DHLKAI-----GKDASFDK---CVEE-QTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKS 334
              K+       KD  FD+   C+++ + + K+ A++ K+E+I+KY+R+YP+VL+I FK+
Sbjct: 253 MPGKSAKTLPKNKDPQFDEQEHCLKQLEARFKM-AKEEKEELIAKYYRVYPTVLDIPFKA 311

Query: 335 -ADKSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIRM 393
             +  Y+GPEDP ++++   N DG +EP+V +NM D+  +  R MF   PHRK  P++ +
Sbjct: 312 TGNLDYMGPEDPKILIRR--NHDGQQEPIVVYNMQDNNYE-QRLMFVVLPHRKINPIVPL 368

Query: 394 TINGRKVKRIEKNWAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEA 453
                K+   +KNW PF + + +  S  SRG +H++    P  ILKCSL++G C  +F+A
Sbjct: 369 VDKEYKIGGTQKNWTPF-IHEGDATSDGSRGFMHVVQHMSPTSILKCSLDNGKCKYIFDA 427

Query: 454 DTLESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISV 513
             + S K+     +RG + F K+P  +P++ G+ +W+   K H   CG  FK+YRP +++
Sbjct: 428 AKIPSLKDVGVKELRGGSAFVKIPHGIPELDGRNLWIAMIKSHQGHCGISFKFYRPHLAI 487

Query: 514 LVEHNGVYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFD 573
           + E +G +++     +L F  +VLSWD    Y   +N+++PNSI  W I++ N +   ++
Sbjct: 488 MEEKDGKFSMLSYSSALHFDRDVLSWDGNSTYAGYINIMSPNSIVSWNIISHNHENDTYE 547

Query: 574 DYMSLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFE-INKSSNMIIGKTVGCVAKA 632
           DYM L+ SE+D  + +V V+G+L+Y+L + RD   ++  +  +K    ++G    CV   
Sbjct: 548 DYMELSFSESDYMSYVVTVRGVLDYILQVLRDGSDRKFLDWTSKDLATMVGTPPKCVRSN 607

Query: 633 TRDDCKEYGKTHPE 646
            +  C  YG  H E
Sbjct: 608 LKQHCSVYGNAHKE 621

>CAGL0D00286g Chr4 (37583..39784) [2202 bp, 733 aa] {ON} weakly
           similar to DEHA0D08195g Debaryomyces hansenii and
           CA4636|IPF1520 Candida albicans
          Length = 733

 Score =  327 bits (837), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 196/583 (33%), Positives = 318/583 (54%), Gaps = 25/583 (4%)

Query: 67  LQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNLESQGGKD 126
           LQ +  V  K ++   D +K ++ + F+            +   +L  Y SN+ +  G +
Sbjct: 170 LQGVPQVNDKSEMSQYDTSKFIKMQRFDLMATANGFPNNTFLPFELTSYQSNMYNLTGSE 229

Query: 127 RATIGDYEREATCDTLQYINKVEYSKETKYLPLDLVRVRKELMTNPKFEFLRKQMHANND 186
                       CD + + +++ YS+E   +  DLV  R + +   K   L K +   ++
Sbjct: 230 ---------SNKCDAISWKSRIHYSQERLPIEEDLVAARIKFVKEDKH--LGKIVEELHN 278

Query: 187 AEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSKIPRRNHPHFSLVAAQAFDK 246
           A K  +  E V+K W  FG  + W +++QC+ V+SR+I ++   +     SLV+AQAFDK
Sbjct: 279 ASKKETIEESVKKQWLRFGSSAQWLEDHQCYLVFSRIIVTEGGFKGAGKMSLVSAQAFDK 338

Query: 247 NWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYK-CDHLKAIGKDASFDKCVEEQTKI 305
           +WNEI G ++P++D  IP D+E++L  +D    L+K CD          +  CV+ +  +
Sbjct: 339 DWNEIKGKRIPFIDTEIPDDLEQQLIAIDKKYDLFKNCDEEDKT--TYQYQVCVQSKQYM 396

Query: 306 KLKAEKRKDEIISKYFRMYPSVLEIEFKSADKS-YLGPEDPHVIMKGGINGDGIEEPLVF 364
           K KAE+ KDE++  Y+R+YP++L+I F    K  Y GPEDP +I++   N DGI+EP+V 
Sbjct: 397 KEKAEEEKDELLGNYYRVYPTILKIPFAMEKKWFYKGPEDPKLILR--TNKDGIQEPIVV 454

Query: 365 FNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFVKQSNTESAFSRG 424
           +N+ D  +   R M    PHRK  P+I +      V   +KNW PF +K  +     SRG
Sbjct: 455 YNIYDP-THQERMMQVVLPHRKISPVIPLIEQDAIVVGRQKNWTPF-IKDEDAGGQISRG 512

Query: 425 TVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEFLSMRGSTQFYKLPSDLPQVK 484
           ++H+     PL+I+KCSL+ G C  VF+A    S K+ E   +RG T   KLP  +PQ+K
Sbjct: 513 SLHMFSRAAPLQIVKCSLDTGYCKFVFDAAEY-SKKDFEPNEIRGGTPLIKLPPVVPQLK 571

Query: 485 GKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELVVPSLDFGINVLSWDLKGH 544
           G+ +W G  K H+  CG   + YRP +++L E NG Y   L+  +L F   VL W  K  
Sbjct: 572 GRNLWFGLMKGHIKECGISDRLYRPSLAILEEENGKYFFNLITDTLHFNTEVLGWSEKNF 631

Query: 545 YCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSNTEIVVVKGLLNYVLGIYR 604
                NVL+PNS+  W++++QNP+T  +DDYM ++VS++D  + ++ +KG+L+++L  Y 
Sbjct: 632 KADGYNVLSPNSVISWDVLSQNPETKSYDDYMQISVSQSDKGSYVIKMKGVLDFILQSYT 691

Query: 605 DKPMKEDFEINKSS---NMIIGKTVGCVAKATRDDCKEYGKTH 644
            + +  + +   S     + +G    C  K  R+ C+EY K+H
Sbjct: 692 KEGLNNNMDWESSGLEDRIELGGV--CFRKHLRNYCEEYSKSH 732

>TBLA0C07270 Chr3 complement(1767045..1769273) [2229 bp, 742 aa]
           {ON} 
          Length = 742

 Score =  325 bits (834), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/626 (30%), Positives = 329/626 (52%), Gaps = 52/626 (8%)

Query: 50  RYSDNDSIRSIKYKYNSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTE 109
           R S+N   R + +++ +  +   V  KKDL  +D+   LR    + SP+  +     Y+ 
Sbjct: 59  RASNNQ--RLLTFQFQTTNDDDLVLNKKDLDMVDIRHKLRHSFQDSSPISKKITFDNYSR 116

Query: 110 NQLLGYVSN---LESQGGKDR--------------------ATIGDYEREATCDTLQYIN 146
            ++ GY+SN      Q  K                       T+G       C+ L Y  
Sbjct: 117 IRIPGYISNYNPFSHQNTKKEENQINSILPDINPRNLNTNIGTVG-------CNQLAYTE 169

Query: 147 KVEYSKETKYLPLDLVRVRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGG 206
            +EYS+   ++   L  +R++++     +FL  ++   ++    + + EIV+K W   G 
Sbjct: 170 DIEYSRNRPFIDDSLFNIRRQIVAFK--DFLSDRVVKQDER---MGENEIVRKRWQKMGT 224

Query: 207 VSVWSDEYQCFFVYSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPAD 266
            SVW +  QC+ V + V +S       P  S++ AQA+DK+WNEI G ++  +D+N P +
Sbjct: 225 SSVWLESEQCYIVLTSVRYSSEEELFEPDVSVIRAQAYDKDWNEIKGKRILKLDVNEPNN 284

Query: 267 VEKELEKLDNDLGLYKCDHLKAIGKD-ASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYP 325
           +++EL K++ DL +   D+     +D  +++ C+ +     +KA+KRK +++ +Y   YP
Sbjct: 285 LKEELSKIERDLKVK--DNCDKYNEDFDAYEDCLSKYKDSNMKAKKRKQKLLDRYSVTYP 342

Query: 326 SVLEIEFKSADKSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHR 385
           +V    F +  +   GP +P +I+K       +EEP++ F+M   +++ +RRM+ F PHR
Sbjct: 343 TVYRFPFNTNGR-LRGPTNPQIILK---KSQKLEEPVIVFDM---HNNDDRRMYAFLPHR 395

Query: 386 KTEPMIRMTINGRKVKRIEKNWAPFFVKQ-SNTESAFSRGTVHLIYSFFPLEILKCSLND 444
               +I   +     ++ E NW PFF +  S+ +S+ S G +H I  + P ++LKCSL D
Sbjct: 396 SINNLIPFYLKESN-RKPETNWTPFFTENDSSVDSSISLGYIHFIRKYNPFQVLKCSLTD 454

Query: 445 GICDTVFEADTLESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGF 504
           G C+ VFE   ++         +R  T F  LP+++P++K KQ+WV F K  L+ CGCG 
Sbjct: 455 GKCEIVFEKPPIKVEDGVFTDVIREGTPFVPLPNEMPKIKDKQLWVAFTKIRLDDCGCGK 514

Query: 505 KYYRPMISVLVEHNGVYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVN 564
           +YYRPM++V+ E +G +  E+  P++ F  +VL WD K   C   N++ PNSI  W+I+ 
Sbjct: 515 RYYRPMLTVMAESSGNFTFEMFAPNVSFDTDVLGWDGKSTNCTGYNMMIPNSIASWDILG 574

Query: 565 QNPKTLEFDDYMSLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGK 624
           Q+PKT   +DYM+   +E    + I+ +KG+LNYVL +Y    + E++  ++  +    +
Sbjct: 575 QDPKTKIIEDYMAFMYTEGGRVSRIITLKGVLNYVLHMYSGNKINENYFFSRDLDY---E 631

Query: 625 TVGCVAKATRDDCKEYGKTHPESDKD 650
              C+   +  +C+ YG  HP  D D
Sbjct: 632 ATKCIVSHSLSECRIYGNKHPGLDID 657

>CAGL0B02926g Chr2 complement(284897..286753) [1857 bp, 618 aa] {ON}
           weakly similar to DEHA0D04994g Debaryomyces hansenii and
           CA4636|IPF1520 Candida albicans
          Length = 618

 Score =  322 bits (825), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/564 (32%), Positives = 307/564 (54%), Gaps = 46/564 (8%)

Query: 106 KYTENQLLGYVSNLESQGGKDRATIGDYEREATCDTLQYINKVEYSKETKYLPL-DLVRV 164
           +Y +  L+ YV N        RA     +   +C  +++  K+EY   T  +P+    +V
Sbjct: 81  EYKQFDLVNYVGN--------RAIPEGLDMVESCKHIEHDAKLEYGNIT--IPIIPNYKV 130

Query: 165 RKELMTNPKFEF--LRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSR 222
             + M  P   F    K++      E         +K W+ FG  + W +E QC+ VYSR
Sbjct: 131 FSDSMNQPSSRFYNFLKKLAKGKPIESTF------KKKWYMFGSSAEWLEEEQCYVVYSR 184

Query: 223 VIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYK 282
           +I S+   R+    SL+AAQAFDK+WNE+ G ++ Y+D+  P D E++L+ +D    + +
Sbjct: 185 LILSEANARDQASISLIAAQAFDKDWNELYGKRIRYLDVETPDDFEEQLKSIDTKYNITE 244

Query: 283 CDHLKAIGKDASFDKCVEEQT--------------KIKLKAEKRKDEIISKYFRMYPSVL 328
               + +GK   +   +E Q+               I+L A+  K E+I  YFR YP+V+
Sbjct: 245 ----ECLGKREDYSSYLEPQSDPDGSESCILVSEESIRL-ADMEKQELIDMYFRTYPTVI 299

Query: 329 EIEFKS-ADKSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKT 387
           +I FK+  D  ++GPEDP VI++   N +  +EPLV +NM D   D  R MF   PHRK 
Sbjct: 300 DIPFKTTGDLRFMGPEDPKVIIRRNANRE--QEPLVIYNMNDKNFD-RRLMFMVMPHRKV 356

Query: 388 EPMIRMTINGRKVKRIEKNWAPFFVKQSNTESAFSRGTVHLIYSFFPLEILKCSLNDGIC 447
            P++ +      +   +KNW PF ++  +  +  SRG VH++    P+ +LKCSL+DG C
Sbjct: 357 NPIVPLVDKEFSISETQKNWTPF-IRDEDAVADGSRGFVHIVQHIMPITVLKCSLDDGKC 415

Query: 448 DTVFEADTLESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYY 507
              F AD ++  K+S+F  +RG T F ++P  +P++ G+++W+G  K H+ GCG    +Y
Sbjct: 416 TYEFRADKIDKLKKSQFKDLRGGTSFVRVPQGIPELDGRKLWLGVIKSHIIGCGGATHFY 475

Query: 508 RPMISVLVEHNGVYN-LELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQN 566
           RP + ++ E +G Y+ + L  PS  F  +VLSWD+K      +N+++PNSI  W +V+ +
Sbjct: 476 RPHLVLMEERDGKYSFISLSSPS-HFHRDVLSWDMKTTSMKYINIMSPNSIVSWNVVSHD 534

Query: 567 PKTLEFDDYMSLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSS-NMIIGKT 625
            +   ++DY+ ++ SE+D  + ++ V+G+LNY+L + RD    +  + + +  ++ +G  
Sbjct: 535 HENDSYEDYIEMSFSESDCKSYVLAVRGMLNYILQVLRDSSDAKYLDWDSNDLDIRVGTA 594

Query: 626 VGCVAKATRDDCKEYGKTHPESDK 649
             CV    ++ CKEYG  H E  K
Sbjct: 595 PKCVISKLKEHCKEYGALHKEPSK 618

>SAKL0H24090g Chr8 (2078621..2080357) [1737 bp, 578 aa] {ON} weakly
           similar to gnl|GLV|CAGL0D00286g Candida glabrata
           CAGL0D00286g
          Length = 578

 Score =  317 bits (812), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 202/612 (33%), Positives = 318/612 (51%), Gaps = 91/612 (14%)

Query: 60  IKYKYNSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVSNL 119
           + + Y SLQN   + Q          K+L F   N +   +E+L         +G + + 
Sbjct: 24  LAFFYESLQNYSVLFQPYGF------KSLGFHHPNPT-FEVESLTDLLQRRVSVGNIDDK 76

Query: 120 ESQGGKDRATIGDYEREAT------------------CDTLQYINKVEYSKETKYLPLDL 161
            S   +  A  G Y+ E +                  C+  Q+  KV  S+  K L + L
Sbjct: 77  NSMFSEHDAAQGFYDHEISSYLSYGQIGSQEQSQRVPCNPFQHSVKV--SRWNKNLDVSL 134

Query: 162 VRVRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYS 221
           V VR+ +  N     L++ + + +DA K  S+ +IV++ WF FGG SVW ++ QC+ V +
Sbjct: 135 VEVRRHIFEN--HPDLKQYLESPDDANK--SEEDIVEQQWFQFGGSSVWLEKEQCYLVVT 190

Query: 222 RVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVD-----LNIP-ADVEKELEKLD 275
           R++ S    +N P  SL+  +A D+NW EI G  V Y+D     ++ P  D E+ L K  
Sbjct: 191 RIMHSPTGHKNTPRTSLMWVRALDRNWEEIKGKNVSYLDQALFDVDAPVGDKEESLGKRK 250

Query: 276 NDLGLYKCDHLKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSA 335
           +D     C+  K    D  +  C+ +                      YP + EI F+  
Sbjct: 251 SDFAT-NCELFKHNSSD--YGSCMMKNA-------------------TYPKLAEIRFE-I 287

Query: 336 DKSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMF-TFSPHRKTEPMIRMT 394
           DK Y GPEDP V+++     +G+EEP++ FNM  H  +  RRM   +  HR T  +I+  
Sbjct: 288 DKVYNGPEDPKVVLR---EYNGVEEPVIVFNMNVHKDEEQRRMMHAYLLHRATNNVIQFE 344

Query: 395 INGRKVKRIEKNWAPFFVK-QSNTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEA 453
           I  ++  +IEKNWAPFF + QSN         ++ +Y + PLEIL CSL+ G C T +  
Sbjct: 345 IEDKEPLKIEKNWAPFFARNQSN---------INFVYQYDPLEILTCSLDTGKCRTEYSE 395

Query: 454 DTLESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISV 513
              +   E     +RG TQ+  LP  LP +K KQ W+GFPK H++ CGCG  +YRPM SV
Sbjct: 396 ---KEQSEKGIGYIRGGTQYVPLPGVLPHIKDKQFWIGFPKLHIDACGCGDNFYRPMSSV 452

Query: 514 LVEH-NGVYNLELVVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEF 572
           L  +  GVY+ E+   ++ FG++VLSWD K   C   NVL+PNSI+YWE+V ++ +T + 
Sbjct: 453 LTRNLEGVYSREISSGAITFGLDVLSWDQKSSACGGSNVLSPNSISYWEVVGKDARTGKI 512

Query: 573 DDYMSLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKA 632
           DD+++L +SE+DS ++++V+KG+L+Y+L +Y  + M +               + C+++ 
Sbjct: 513 DDHLALAMSESDSTSKVIVLKGVLDYILKMYVQEKMSD-------------YPIACLSEQ 559

Query: 633 TRDDCKEYGKTH 644
           +++ C  YG+ H
Sbjct: 560 SKETCMVYGEKH 571

>CAGL0B02904g Chr2 complement(282093..283910) [1818 bp, 605 aa] {ON}
           weakly similar to DEHA0C03091g Debaryomyces hansenii and
           CA4636|IPF1520 Candida albicans
          Length = 605

 Score =  307 bits (787), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 166/463 (35%), Positives = 260/463 (56%), Gaps = 29/463 (6%)

Query: 199 KYWFTFGGVSVWSDEYQCFFVYSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPY 258
           K WF FG  + W +E QC+  YSR+I S    R     SL+AAQAFDK+WNE+   ++ Y
Sbjct: 158 KKWFMFGSSAEWLEEEQCYVSYSRLIISDWDTRTRASVSLIAAQAFDKDWNELYNKRIKY 217

Query: 259 VDLNIPADVEKELEKL-------------DNDLGLYKCDHLKAIGKDASFDKCVEEQTKI 305
           VD+  P D +++L+ +             + D G  K D    I  + +  KC      +
Sbjct: 218 VDIETPEDFDEQLKAINAKYNIVEECLGREEDGGYTKSD----INSEGT-SKCTPISDDV 272

Query: 306 KLKAEKRKDEIISKYFRMYPSVLEIEFK-SADKSYLGPEDPHVIMKGGINGDGIEEPLVF 364
           K  AE  K  +I +YFR+YP+VL+I FK + + SY GPEDP VI++   N DG  EP+V 
Sbjct: 273 KELAETEKRMLIDRYFRVYPTVLDIPFKLTGEVSYRGPEDPKVIIRR--NADGRHEPVVV 330

Query: 365 FNMLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFVKQSNTESAFSRG 424
           +NM D   D  R MF   PHRK  P++ +  +   +   +KNW PF +   +     SRG
Sbjct: 331 YNMDDDNYD-RRIMFAVMPHRKINPIVPLIDDEFSISGPQKNWTPF-INDGDVTKDGSRG 388

Query: 425 TVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEFLSMRGSTQFYKLPSDLPQVK 484
            +H+     P  IL+CSL+DG+C  VF  + +   ++ E   +RG T F ++P ++P++ 
Sbjct: 389 FIHVALHIIPTTILRCSLDDGVCMYVFRGEKINKLQK-ELKDLRGGTSFRRVP-EIPELN 446

Query: 485 GKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELVVPSLDFGINVLSWDLKGH 544
           G+++W+   K HLN CG   ++YRP + ++ E +G +N+     ++ F   VLSWD+   
Sbjct: 447 GRKVWISIIKSHLNNCGGASQFYRPHVVLMEETDGKFNILSYSSAIHFDREVLSWDMHSS 506

Query: 545 YCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSNTEIVVVKGLLNYVLGIYR 604
             + VN+++PNSI  W IV+      +++DYM ++ SEAD N+ ++VV+G+LNY+L +  
Sbjct: 507 AMYHVNIMSPNSIASWHIVSHVHS--KYEDYMEISFSEADCNSSVIVVRGMLNYILQVLG 564

Query: 605 DKPMKEDFEINKSSNMIIGKTVGCVAKATRDDCKEYGKTHPES 647
           D     D+E +K   + +G    CV    R+ C+ YGK  P++
Sbjct: 565 DSE-SVDWE-SKDLGLRLGTAPACVLTHLREHCEAYGKLRPKT 605

>TBLA0G00100 Chr7 (3376..5295) [1920 bp, 639 aa] {ON} 
          Length = 639

 Score =  290 bits (742), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 185/601 (30%), Positives = 309/601 (51%), Gaps = 60/601 (9%)

Query: 63  KYNSLQNIKTVAQKKDLLNIDLTKTLRFKD-----FNRSPVHIETLGQKYTENQLLGYV- 116
           K+N   N KT  +     NIDL+  LR+K+     F RS +  + L   Y    L  Y+ 
Sbjct: 74  KFNIFSNSKTQFK-----NIDLSFYLRYKNMDTSYFERSAISKKILNNNYNRFDLQSYIP 128

Query: 117 -SNLESQGGKDRATIGDYEREATCDTLQYINKVEYSKETKYLPLDLVRVRKELMTNPKFE 175
            SN+      D   I D + +       Y N + YSK   ++   +  +++EL++     
Sbjct: 129 YSNISESSHTDN--IDDLQLQI------YDNFIYYSKHFHHIKSSIKDIKEELLS----- 175

Query: 176 FLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIFSKIPRRNHPH 235
           F   Q H          D++  +  W      S+W  E QC+   SR+ +      ++ +
Sbjct: 176 FEETQNHH---------DIKFSKNDWKKTSTSSIWLKEEQCYLTVSRLTYLGTNGDSNSN 226

Query: 236 FSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYKCDHLKAIGKDASF 295
             ++ +Q FDKNW E+   ++P  +  +P D++ +L++++N+     C     +     F
Sbjct: 227 TIIIHSQLFDKNWKELKDKRIPKSNSTLPEDLDYQLKQIENNFTHENCHLFSTLT--GLF 284

Query: 296 DKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDPHVIMKGGING 355
             C +E  +I  +    K +++ +Y+ +YP    I +    K+ +  ED  +I+K   + 
Sbjct: 285 RSCTKENHRINKEIANLKQKLLDEYYVIYPITYTIPYT---KTNINSEDIKLILKQ--DN 339

Query: 356 DGIEEPLVFFNMLDHY---SDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFV 412
           DG EEP++ FN+  +    S++   +++FSPHRK+  +I+    G  +  + +NW PFF 
Sbjct: 340 DGKEEPIIIFNVNTNNGENSNTQNDVYSFSPHRKSSNIIQFNYPGSTL--LNENWTPFFT 397

Query: 413 KQS-------NTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEFL 465
           K+         TES   + ++H I  FFPL+ILKCSL+DG C   FE  T  +  ++ F 
Sbjct: 398 KEDLDNNKKIETES---QNSIHFITGFFPLQILKCSLDDGTCFKEFE--TKSNKNDNTFK 452

Query: 466 SMRGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLEL 525
            ++  TQF   P  +P +    IW+GFP++ L  CGCG ++ RPM+++++E NG Y LEL
Sbjct: 453 MIQSGTQFVPFPEPIPTLYSSNIWLGFPEYQLQECGCGSQFVRPMMTLMIETNGTYYLEL 512

Query: 526 VVPSLDFGINVLSWDLKGHYCFDVNVLNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADS 585
           +  +LDF   VLS    G  C   N ++P+SI  WE++ Q+PKT   +DY+ LT +EADS
Sbjct: 513 ISDTLDFKTPVLSGKGIGMDCSGNNKMSPDSIASWELIGQDPKTKLLEDYLVLTYTEADS 572

Query: 586 NTEIVVVKGLLNYVLGIYRDKPMKEDFE--INKSSNMIIGKTVGCVAKATRDDCKEYGKT 643
            + ++V+KGLLNY+L +Y+  P+ ED E  I +         +G +       C+EYG+ 
Sbjct: 573 RSSMIVLKGLLNYILNMYQTLPITEDKESVIVEHHVNRFTTALGYLFMGFNSYCQEYGQN 632

Query: 644 H 644
           H
Sbjct: 633 H 633

>CAGL0K12980g Chr11 complement(1283966..1286134) [2169 bp, 722 aa]
           {ON} no similarity
          Length = 722

 Score =  170 bits (430), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 134/550 (24%), Positives = 253/550 (46%), Gaps = 51/550 (9%)

Query: 109 ENQLLGYVSNLESQ-GGKDRATIGDYEREATCDTLQYINKVEYSKETKYLPLDLVRVRKE 167
           +N+ + Y   L S  G  D     D   E  CD  ++  K+ Y    + +  +L +VR+ 
Sbjct: 170 QNRTIFYDKTLSSYYGNIDTDKFVDTNDEKNCDLYKFEEKISYMNRRRNISPNLKKVRQL 229

Query: 168 LM--TNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYSRVIF 225
           L+   +P+ +F+++        +K  +D   V++ +FT     +W +++ C+  ++ V+ 
Sbjct: 230 LLDENSPRSKFIKQIAQ-----KKGYNDTMAVERQFFTTTTSILWLEQHVCYISFTGVVI 284

Query: 226 SKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPADVEKELEKLDNDLGLYK-CD 284
           S+    N P  +++++QAFD  W EI    + ++D  IP  + +  ++++++    K CD
Sbjct: 285 SEAEDVNKPSLTVISSQAFDDQWKEI-EKDIGFIDEKIPDSLSEAFKRIESEYDANKNCD 343

Query: 285 ------------------------------HLKAIGKDASFDK--CVEEQTKIKLKAEKR 312
                                         H KA  K     K  C    +K K  A++ 
Sbjct: 344 DEANNVEKDCLNNMKCDIKDKEKKKECENNHKKACDKKKEDKKSACKLLVSKNKKLADEE 403

Query: 313 KDEIISKYFRMYPSVLEIEFKSADKSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYS 372
           K  I + ++ +YP +L++  ++ + +  G +     ++     DG+ EPL+ +   +  +
Sbjct: 404 KKAIKTNFYALYPMILDVPTET-NTAPTGFKRLSATLRE--TDDGVIEPLLTYQFEETLT 460

Query: 373 DSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNWAPFFVKQSNTESAFSRGTVHLIYSF 432
            +   ++   PHRK      + +    ++     W PF  K  +  +  + G VHLI + 
Sbjct: 461 SN---IYYALPHRKYTSSGTLKVEMPSLRSRNGYWIPF-TKAIDMGTKQTVGHVHLISNK 516

Query: 433 FPLEILKCSLNDGICDTVFEA-DTLESTKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVG 491
            PL   KCS + G C  ++ + DT ++   SE   +   T F ++PS +P+VK + IWVG
Sbjct: 517 LPLVTAKCSFDKGECFVLYNSRDTDKNDDNSEINLLDAGTNFIEIPSVVPRVKNRHIWVG 576

Query: 492 FPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLELVVPSLDFGINVLSWDLKGHYCFDVNV 551
             + H+       +  RP+ISVL E  G +N+      L F + +   +   +     ++
Sbjct: 577 MNEIHIPLSEHNKEVRRPVISVLEEQEGTFNIFSYSNPLSFSL-MEPIEFHNNSTLTHDI 635

Query: 552 LNPNSINYWEIVNQNPKTLEFDDYMSLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKED 611
             P SI  W + NQ   TL+F+DYM +       NT +V +KG LN++L  +R + ++ED
Sbjct: 636 WTPYSIISWSVRNQTADTLDFEDYMQIAFGHNTKNTSVVTLKGYLNFLLKSFRSEKVEED 695

Query: 612 FEINKSSNMI 621
               K+ N +
Sbjct: 696 LISYKNQNQL 705

>TBLA0G03700 Chr7 (979774..981945) [2172 bp, 723 aa] {ON} 
          Length = 723

 Score =  135 bits (339), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 111/446 (24%), Positives = 209/446 (46%), Gaps = 33/446 (7%)

Query: 162 VRVRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYWFTFGGVSVWSDEYQCFFVYS 221
           + ++ ++ T   +E  +     N  +E    D EI++K W T    S+W   YQC    +
Sbjct: 246 ILIKNDINTYNAYEMSKTSSFFNTPSELGHLDSEIIKKNWRTKILNSIWLSAYQCHLTLN 305

Query: 222 RVIFSKIPRRNHPHFSLVAAQAFDKNWNEIIGLKVPYVDLNIPA---DVEKELEKLDNDL 278
            + +     +   +F + + + FD NW E+     P+VD N P    D+++EL K+D   
Sbjct: 306 EITYYNDELQ--KYFKVYSIKIFDHNWLEMKNSYAPFVDSNFPQKKMDLQEELRKIDKYF 363

Query: 279 GLYK-CDHLKAIGKDASFDKCVEEQTKIKLKAEKRKDEIISKYFRMYPSVLEIEFKS--- 334
           G+   C HL+    D  +  C+ +++K  ++ + R+DE +   F  YP V +  F S   
Sbjct: 364 GVINSCTHLEKGTND--YKDCLIKESKNFIENKNRRDEFLRSSFISYPMVFDSSFGSILN 421

Query: 335 --ADKSYLGPEDPHVIMKGGINGDGIEEPLVFFNMLDHYSDSNRRMFTFSPHRKTEPMIR 392
              D       +P ++ +    GD +EEP+V FN ++  S +    F   PHR +     
Sbjct: 422 INKDMDMNEILNPRLLKRKL--GD-VEEPVVIFNKINQLSQT-LDTFAIFPHRFSTKKAP 477

Query: 393 MTINGRK--VKRIEKNWAPFFVKQS-NTESAFSRGTVHLIYSFFPLEILKCSLNDGICDT 449
           + +N  K  +K  +    PFF  ++   +  F   +++ I S  PL+I+KC+   G C+ 
Sbjct: 478 IKLNTSKFGIKIDDPQLIPFFTNENLKNDKFFDMDSINFIQSMNPLKIVKCNFTLGNCEI 537

Query: 450 VFEADTLESTKESEFLSM-----RGSTQFYKLPSDLPQVKGKQIWVGFPKFHLNGCGCGF 504
            ++     +T   +   +     + + Q    P  LP +KG+Q W+    ++        
Sbjct: 538 DYQDLPFGTTLTDDINQLLSNYKQTNVQVISTPKYLPLIKGQQFWLVKSTWNKYSEEDSL 597

Query: 505 KYYRPMISVLVEHNGVYNLELVVP-SLDFGINV-LSWDLKGHYCFDVNVLNPNSINYWEI 562
              + ++S+L   + +Y  EL++P   D  +NV ++ +L  +Y  D   ++      W+I
Sbjct: 598 IKSKTILSILYTSDSLYRQELIIPLDTDKLLNVNINDNLSNNYLVDSEFIS------WDI 651

Query: 563 VNQNPKTLEFDDYMSLTVSEADSNTE 588
             Q+ KT +FDD++ L+V+  +SN +
Sbjct: 652 YQQDSKTNKFDDFLQLSVTSENSNEQ 677

>Kpol_1008.1 s1008 (1..225) [225 bp, 74 aa] {ON} (1..225) [225 nt,
           75 aa]
          Length = 74

 Score = 87.8 bits (216), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 54/74 (72%)

Query: 577 SLTVSEADSNTEIVVVKGLLNYVLGIYRDKPMKEDFEINKSSNMIIGKTVGCVAKATRDD 636
           ++TVSEADS T  + +KG+LN++LGIY++K ++EDFEIN  S+ +I +T  C+     D 
Sbjct: 1   TITVSEADSLTRTITLKGMLNFILGIYKEKQLREDFEINTESDAVIFRTRNCIGDLANDI 60

Query: 637 CKEYGKTHPESDKD 650
           CK YGKTHPE  K+
Sbjct: 61  CKAYGKTHPEPKKN 74

>TBLA0D00130 Chr4 complement(25176..26126) [951 bp, 316 aa] {ON} 
          Length = 316

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 118/249 (47%), Gaps = 30/249 (12%)

Query: 358 IEEPLVFFNMLDHYSDSNRRMFTFSPHR---KTEPMIRMTINGRKVKRIEKNWAPFFVKQ 414
           +EEP++ FN ++  S S    F   P+R   K  P I++  +   +K  ++   PFF ++
Sbjct: 35  VEEPIILFNKMNELS-STLNSFAVFPYRQLNKNTP-IKLHTSEFNIKIYDEPSVPFFTEE 92

Query: 415 S-NTESAFSRGTVHLIYSFFPLEILKCSLNDGICDTVFEADTLESTKESEFLSMRGSTQF 473
           +   +  F  G+++ I S  PL+I+KCS     C+T+++    +STK     ++  S   
Sbjct: 93  NLENDRFFELGSINFIQSMNPLKIVKCSFKLRECETIYQDLPFDSTKNDHIDNVDSSVIN 152

Query: 474 YK--------LPSDLPQVKGKQIWVGFPKFHLNGCGCGFKYYRPMISVLVEHNGVYNLEL 525
           YK         P  LP VKG+Q W+  P F+       F   R ++S+L     +Y  EL
Sbjct: 153 YKQTNVKIISTPKYLPMVKGQQFWLVKPTFYKYYEDRSFIEARSILSILYTSGSLYRQEL 212

Query: 526 VVPSLDFGINVLSWDLKGHYCFDVNVLN----PNSINYWEIVNQNPKTLEFDDYMSLTVS 581
           ++P        L  D     C + N  N       IN W+I +Q+ +T  F+D++ L+++
Sbjct: 213 IIP--------LDNDQLSKACTNENFANQLVDSEFIN-WDIYHQDSQTNIFEDFLQLSIT 263

Query: 582 EA---DSNT 587
                D NT
Sbjct: 264 SENKDDQNT 272

>CAGL0D06710g Chr4 complement(641982..643127) [1146 bp, 381 aa] {ON}
           no similarity
          Length = 381

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 97/221 (43%), Gaps = 15/221 (6%)

Query: 193 DLEIVQKYWFTFGGVSV-WSDEYQCFFVYSRV-IFSKIPRRNHPHFSLVAAQAFDKNWNE 250
           DLE +    +    +SV W  + QC+ +YS + I+ +  + N     +V  + FD+ WNE
Sbjct: 119 DLESID---YNVNHISVRWLSKRQCYILYSVLSIYRRNEQPNDFRHDIVIGRLFDEGWNE 175

Query: 251 IIGLKVPYVDLNIPADVEKELEKLDNDLGLYKC----DHLKAIGKDASFDKCVEEQTKIK 306
           + G  + + D+ +P + +  LE L  +  L +     D    I  +   ++C+ +   + 
Sbjct: 176 LHGRIITHTDVGLPENFKSRLELLYREFNLSELCFWRDDGNQINLENDVNECILKLRNLD 235

Query: 307 LKAEKRKDEIISKYFRMYPSVLEIEFKSADKSYLGPEDPHVIMKGGINGDGIEEPLVFFN 366
               +  + +IS  F  +P+++    K    SY G    ++     +     +EP++ ++
Sbjct: 236 PSRSEELNTLISDVFIAFPNII----KPMTLSYWGKN--YIDQMMFLIAKKKDEPILVYS 289

Query: 367 MLDHYSDSNRRMFTFSPHRKTEPMIRMTINGRKVKRIEKNW 407
                ++SN+R F   P  K    + + I       I+ NW
Sbjct: 290 ERPDSANSNKRFFLAMPFHKRFTTLELFIPKMFANIIDDNW 330

>CAGL0K05621g Chr11 complement(548043..550349) [2307 bp, 768 aa]
           {ON} similar to uniprot|P36165 Saccharomyces cerevisiae
           YKR089c
          Length = 768

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 136 EATCDTLQYINKVEYSKETKYLP-LDLVRVRKELMTNPKFEFLRKQ 180
           E  C+ L+ +   +YS +   LP LD++    EL++NP  EFL K+
Sbjct: 521 ETLCNKLRSVISQKYSGDVTILPKLDMISCVNELLSNPSQEFLLKE 566

>KAFR0I02890 Chr9 complement(579777..581057) [1281 bp, 426 aa] {ON}
           Anc_3.17 YOL140W
          Length = 426

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 438 LKCSLNDGICDTVFEADTLES-TKESEFLSMRGSTQFYKLPSDLPQVKGKQIWVG 491
           L C++   + DT+ +   L+S TK+ EFL+ R +    K P  + +V+GK + +G
Sbjct: 314 LGCAIGAYVIDTIADEAFLKSVTKKGEFLTNRLTQIAAKYPGQIKEVRGKGLILG 368

>SAKL0A01650g Chr1 (149814..154898) [5085 bp, 1694 aa] {ON} similar
           to uniprot|P38631 Saccharomyces cerevisiae YLR342W FKS1
          Length = 1694

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 206 GVSVWSDEYQCFFVYSRVIFSKIPRRNHPHFSLVAAQAFDKNWNEII 252
           G+S+W+     F    + IFSKI   N  H      Q   K WNEII
Sbjct: 550 GISIWTPWRNVFSKLPKRIFSKIIFSNQCHHYSCGQQQVAKVWNEII 596

>CAGL0D02310g Chr4 complement(237084..239213) [2130 bp, 709 aa] {ON}
           weakly similar to uniprot|Q08818 Saccharomyces
           cerevisiae YOR354c
          Length = 709

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 38/89 (42%), Gaps = 3/89 (3%)

Query: 57  IRSIKYKYNSLQNIKTVAQKKDLLNIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYV 116
           IR  K  Y+ +QN     +   L ++DL + +  K FN +P   +     Y +N L  + 
Sbjct: 409 IRRTKITYSQIQNRIDATKFGKLKSVDLAEAIALKIFNENPNDSKVFDDFYQQNSLDSFG 468

Query: 117 SNLESQGGKDRATIGDYEREATCDTLQYI 145
           SN      K   T GDY  +   D   Y+
Sbjct: 469 SNTSILALK---TYGDYIYKTKTDDETYV 494

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
           Ashbya gossypii ACR006C
          Length = 1079

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 63  KYNSLQNIKTVAQKKDLL--NIDLTKTLRFKDFNRSPVHIETLGQKYTENQLLGYVS 117
           KYN ++NI+ + + K L+   I   +TL+  D+ ++P+ +  +G    +N L G +S
Sbjct: 661 KYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKNSLYGLLS 717

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,760,997
Number of extensions: 3435029
Number of successful extensions: 10241
Number of sequences better than 10.0: 75
Number of HSP's gapped: 10222
Number of HSP's successfully gapped: 75
Length of query: 651
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 535
Effective length of database: 40,180,143
Effective search space: 21496376505
Effective search space used: 21496376505
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)