Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0A14090singletonON86786742430.0
NCAS0A09860singletonON86786742330.0
NCAS0A10860singletonON86786742330.0
NCAS0A03790singletonON86786742290.0
NCAS0A04080singletonON86786742290.0
NCAS0B02890singletonON86686740700.0
NCAS0A07480singletonON86786740350.0
NCAS0B07990singletonON86686738430.0
NCAS0C04620singletonON82782435800.0
NCAS0D04560singletonON86686734460.0
NCAS0G04270singletonON54554526320.0
NCAS0E04230singletonON53353325270.0
NCAS0D01210singletonON87687324320.0
NCAS0F00700singletonON46045723370.0
NCAS0G04250singletonON36633316230.0
NCAS0A06420singletonON77172911451e-144
NCAS0C03910singletonON84080411101e-138
NCAS0A10520singletonON80781511041e-137
NCAS0B02340singletonON7143984269e-43
TPHA0N01980singletonON6121771121e-04
Kpol_387.6singletonON925299910.034
Kpol_1030.35singletonON909199900.050
SAKL0H03916g4.221ON880307870.12
NDAI0D045204.221ON986341800.68
KAFR0A061304.221ON96170752.8
NCAS0A09880singletonON87295735.5
ZYRO0D11836gna 1ON146245727.0
KLTH0G09240gna 2ON478194717.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0A14090
         (867 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0A14090 Chr1 complement(2769048..2771651) [2604 bp, 867 aa] ...  1639   0.0  
NCAS0A09860 Chr1 (1971145..1973748) [2604 bp, 867 aa] {ON}           1635   0.0  
NCAS0A10860 Chr1 (2161841..2164444) [2604 bp, 867 aa] {ON}           1635   0.0  
NCAS0A03790 Chr1 complement(766240..768843) [2604 bp, 867 aa] {O...  1633   0.0  
NCAS0A04080 Chr1 (822284..824887) [2604 bp, 867 aa] {ON}             1633   0.0  
NCAS0B02890 Chr2 (495184..497784) [2601 bp, 866 aa] {ON}             1572   0.0  
NCAS0A07480 Chr1 (1484806..1487409) [2604 bp, 867 aa] {ON}           1558   0.0  
NCAS0B07990 Chr2 (1514105..1516705) [2601 bp, 866 aa] {ON}           1484   0.0  
NCAS0C04620 Chr3 complement(944804..947287) [2484 bp, 827 aa] {O...  1383   0.0  
NCAS0D04560 Chr4 (866980..869580) [2601 bp, 866 aa] {ON}             1332   0.0  
NCAS0G04270 Chr7 complement(793572..795209) [1638 bp, 545 aa] {O...  1018   0.0  
NCAS0E04230 Chr5 complement(834106..835707) [1602 bp, 533 aa] {ON}    978   0.0  
NCAS0D01210 Chr4 (220793..223423) [2631 bp, 876 aa] {ON}              941   0.0  
NCAS0F00700 Chr6 complement(136532..137914) [1383 bp, 460 aa] {O...   904   0.0  
NCAS0G04250 Chr7 complement(791694..792794) [1101 bp, 366 aa] {O...   629   0.0  
NCAS0A06420 Chr1 complement(1264842..1267157) [2316 bp, 771 aa] ...   445   e-144
NCAS0C03910 Chr3 (792605..795127) [2523 bp, 840 aa] {ON}              432   e-138
NCAS0A10520 Chr1 complement(2091961..2094384) [2424 bp, 807 aa] ...   429   e-137
NCAS0B02340 Chr2 complement(391384..393528) [2145 bp, 714 aa] {O...   168   9e-43
TPHA0N01980 Chr14 (426263..428101) [1839 bp, 612 aa] {ON}              48   1e-04
Kpol_387.6 s387 complement(11669..14446) [2778 bp, 925 aa] {ON} ...    40   0.034
Kpol_1030.35 s1030 complement(74264..76993) [2730 bp, 909 aa] {O...    39   0.050
SAKL0H03916g Chr8 (362450..365092) [2643 bp, 880 aa] {ON} simila...    38   0.12 
NDAI0D04520 Chr4 (1060889..1063849) [2961 bp, 986 aa] {ON} Anc_4...    35   0.68 
KAFR0A06130 Chr1 (1241576..1244461) [2886 bp, 961 aa] {ON} Anc_4...    33   2.8  
NCAS0A09880 Chr1 complement(1975537..1978155) [2619 bp, 872 aa] ...    33   5.5  
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    32   7.0  
KLTH0G09240g Chr7 complement(764752..766188) [1437 bp, 478 aa] {...    32   7.2  

>NCAS0A14090 Chr1 complement(2769048..2771651) [2604 bp, 867 aa]
           {ON} 
          Length = 867

 Score = 1639 bits (4243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 808/867 (93%), Positives = 808/867 (93%)

Query: 1   MNNNIPDSPPSNTCSSEILVRQISFRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDY 60
           MNNNIPDSPPSNTCSSEILVRQISFRD                              QDY
Sbjct: 1   MNNNIPDSPPSNTCSSEILVRQISFRDTTTPNTSVSSNNNSTPTPKRRKVLKKFVLVQDY 60

Query: 61  PSQSEDSEWTRIDSKGNNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120
           PSQSEDSEWTRIDSKGNNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH
Sbjct: 61  PSQSEDSEWTRIDSKGNNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120

Query: 121 LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI 180
           LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI
Sbjct: 121 LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI 180

Query: 181 NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA 240
           NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA
Sbjct: 181 NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA 240

Query: 241 HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 300
           HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK
Sbjct: 241 HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 300

Query: 301 QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360
           QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL
Sbjct: 301 QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360

Query: 361 LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 420
           LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN
Sbjct: 361 LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 420

Query: 421 EILKQDIFTEYXXXXXXXXXXXXADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 480
           EILKQDIFTEY            ADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR
Sbjct: 421 EILKQDIFTEYLLSNNSQLSSESADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 480

Query: 481 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 540
           ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF
Sbjct: 481 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 540

Query: 541 VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 600
           VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP
Sbjct: 541 VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 600

Query: 601 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS 660
           VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS
Sbjct: 601 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS 660

Query: 661 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSXXXXXXXXXXXXXXXX 720
           QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSS                
Sbjct: 661 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSEGQEEKNLEFEEEFDE 720

Query: 721 XSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS 780
            SIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS
Sbjct: 721 FSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS 780

Query: 781 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL 840
           RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL
Sbjct: 781 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL 840

Query: 841 RIKLGSINITDCTLNDALRLTKELNLE 867
           RIKLGSINITDCTLNDALRLTKELNLE
Sbjct: 841 RIKLGSINITDCTLNDALRLTKELNLE 867

>NCAS0A09860 Chr1 (1971145..1973748) [2604 bp, 867 aa] {ON} 
          Length = 867

 Score = 1635 bits (4233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 806/867 (92%), Positives = 806/867 (92%)

Query: 1   MNNNIPDSPPSNTCSSEILVRQISFRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDY 60
           MNNNIPDSPPSNTCSSEILVRQISFRD                              QDY
Sbjct: 1   MNNNIPDSPPSNTCSSEILVRQISFRDTTTPNTSVSSNNNSTPTPKRRKVLKKFVLVQDY 60

Query: 61  PSQSEDSEWTRIDSKGNNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120
           PSQSEDSEWTRIDSKG NSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH
Sbjct: 61  PSQSEDSEWTRIDSKGKNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120

Query: 121 LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI 180
           LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI
Sbjct: 121 LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI 180

Query: 181 NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA 240
           NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA
Sbjct: 181 NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA 240

Query: 241 HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 300
           HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK
Sbjct: 241 HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 300

Query: 301 QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360
           QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL
Sbjct: 301 QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360

Query: 361 LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 420
           LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN
Sbjct: 361 LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 420

Query: 421 EILKQDIFTEYXXXXXXXXXXXXADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 480
           EILKQDIFTEY            ADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR
Sbjct: 421 EILKQDIFTEYLLSNNSQLSSESADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 480

Query: 481 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 540
           ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF
Sbjct: 481 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 540

Query: 541 VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 600
           VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP
Sbjct: 541 VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 600

Query: 601 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS 660
           VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVIS VS
Sbjct: 601 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISFVS 660

Query: 661 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSXXXXXXXXXXXXXXXX 720
           QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSS                
Sbjct: 661 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSEGQEEKNLEFEEEFDE 720

Query: 721 XSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS 780
            SIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS
Sbjct: 721 FSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS 780

Query: 781 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL 840
           RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL
Sbjct: 781 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL 840

Query: 841 RIKLGSINITDCTLNDALRLTKELNLE 867
           RIKLGSINITDCTLNDALRLTKELNLE
Sbjct: 841 RIKLGSINITDCTLNDALRLTKELNLE 867

>NCAS0A10860 Chr1 (2161841..2164444) [2604 bp, 867 aa] {ON} 
          Length = 867

 Score = 1635 bits (4233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 806/867 (92%), Positives = 806/867 (92%)

Query: 1   MNNNIPDSPPSNTCSSEILVRQISFRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDY 60
           MNNNIPDSPPSNTCSSEILVRQISFRD                              QDY
Sbjct: 1   MNNNIPDSPPSNTCSSEILVRQISFRDTTTPNTSVSSNNNSTPTPKRRKVLKKFVLVQDY 60

Query: 61  PSQSEDSEWTRIDSKGNNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120
           PSQSEDSEWTRIDSKG NSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH
Sbjct: 61  PSQSEDSEWTRIDSKGKNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120

Query: 121 LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI 180
           LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI
Sbjct: 121 LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI 180

Query: 181 NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA 240
           NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA
Sbjct: 181 NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA 240

Query: 241 HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 300
           HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK
Sbjct: 241 HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 300

Query: 301 QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360
           QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL
Sbjct: 301 QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360

Query: 361 LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 420
           LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN
Sbjct: 361 LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 420

Query: 421 EILKQDIFTEYXXXXXXXXXXXXADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 480
           EILKQDIFTEY            ADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR
Sbjct: 421 EILKQDIFTEYLLSNNSQLSSESADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 480

Query: 481 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 540
           ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF
Sbjct: 481 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 540

Query: 541 VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 600
           VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP
Sbjct: 541 VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 600

Query: 601 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS 660
           VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVIS VS
Sbjct: 601 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISFVS 660

Query: 661 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSXXXXXXXXXXXXXXXX 720
           QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSS                
Sbjct: 661 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSEGQEEKNLEFEEEFDE 720

Query: 721 XSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS 780
            SIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS
Sbjct: 721 FSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS 780

Query: 781 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL 840
           RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL
Sbjct: 781 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL 840

Query: 841 RIKLGSINITDCTLNDALRLTKELNLE 867
           RIKLGSINITDCTLNDALRLTKELNLE
Sbjct: 841 RIKLGSINITDCTLNDALRLTKELNLE 867

>NCAS0A03790 Chr1 complement(766240..768843) [2604 bp, 867 aa] {ON} 
          Length = 867

 Score = 1633 bits (4229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 805/867 (92%), Positives = 807/867 (93%)

Query: 1   MNNNIPDSPPSNTCSSEILVRQISFRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDY 60
           MNNNIPDSPPSNTCSSEILVRQISFRD                              QDY
Sbjct: 1   MNNNIPDSPPSNTCSSEILVRQISFRDTTTPNTSVSSNNNSTPTPKRRKVLKKFVLVQDY 60

Query: 61  PSQSEDSEWTRIDSKGNNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120
           PSQSEDSEWTRIDSKG NSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH
Sbjct: 61  PSQSEDSEWTRIDSKGKNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120

Query: 121 LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI 180
           LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI
Sbjct: 121 LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI 180

Query: 181 NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA 240
           NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA
Sbjct: 181 NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA 240

Query: 241 HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 300
           HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK
Sbjct: 241 HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 300

Query: 301 QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360
           QIPFLVKMDRSDSHKTIDIS+QLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL
Sbjct: 301 QIPFLVKMDRSDSHKTIDISRQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360

Query: 361 LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 420
           LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN
Sbjct: 361 LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 420

Query: 421 EILKQDIFTEYXXXXXXXXXXXXADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 480
           EILKQDIFTEY            ADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR
Sbjct: 421 EILKQDIFTEYLLSNNSQLSSESADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 480

Query: 481 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 540
           ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF
Sbjct: 481 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 540

Query: 541 VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 600
           VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP
Sbjct: 541 VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 600

Query: 601 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS 660
           VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS
Sbjct: 601 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS 660

Query: 661 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSXXXXXXXXXXXXXXXX 720
           QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSS                
Sbjct: 661 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSEGQEEKNLEFEEEFDE 720

Query: 721 XSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS 780
            SIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGAD+IFWS
Sbjct: 721 FSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADDIFWS 780

Query: 781 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL 840
           RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL
Sbjct: 781 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL 840

Query: 841 RIKLGSINITDCTLNDALRLTKELNLE 867
           RIKLGSINITDCTLNDALRLTKELNLE
Sbjct: 841 RIKLGSINITDCTLNDALRLTKELNLE 867

>NCAS0A04080 Chr1 (822284..824887) [2604 bp, 867 aa] {ON} 
          Length = 867

 Score = 1633 bits (4229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 805/867 (92%), Positives = 807/867 (93%)

Query: 1   MNNNIPDSPPSNTCSSEILVRQISFRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDY 60
           MNNNIPDSPPSNTCSSEILVRQISFRD                              QDY
Sbjct: 1   MNNNIPDSPPSNTCSSEILVRQISFRDTTTPNTSVSSNNNSTPTPKRRKVLKKFVLVQDY 60

Query: 61  PSQSEDSEWTRIDSKGNNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120
           PSQSEDSEWTRIDSKG NSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH
Sbjct: 61  PSQSEDSEWTRIDSKGKNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120

Query: 121 LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI 180
           LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI
Sbjct: 121 LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI 180

Query: 181 NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA 240
           NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA
Sbjct: 181 NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA 240

Query: 241 HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 300
           HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK
Sbjct: 241 HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 300

Query: 301 QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360
           QIPFLVKMDRSDSHKTIDIS+QLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL
Sbjct: 301 QIPFLVKMDRSDSHKTIDISRQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360

Query: 361 LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 420
           LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN
Sbjct: 361 LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 420

Query: 421 EILKQDIFTEYXXXXXXXXXXXXADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 480
           EILKQDIFTEY            ADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR
Sbjct: 421 EILKQDIFTEYLLSNNSQLSSESADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 480

Query: 481 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 540
           ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF
Sbjct: 481 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 540

Query: 541 VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 600
           VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP
Sbjct: 541 VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 600

Query: 601 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS 660
           VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS
Sbjct: 601 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS 660

Query: 661 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSXXXXXXXXXXXXXXXX 720
           QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSS                
Sbjct: 661 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSEGQEEKNLEFEEEFDE 720

Query: 721 XSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS 780
            SIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGAD+IFWS
Sbjct: 721 FSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADDIFWS 780

Query: 781 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL 840
           RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL
Sbjct: 781 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL 840

Query: 841 RIKLGSINITDCTLNDALRLTKELNLE 867
           RIKLGSINITDCTLNDALRLTKELNLE
Sbjct: 841 RIKLGSINITDCTLNDALRLTKELNLE 867

>NCAS0B02890 Chr2 (495184..497784) [2601 bp, 866 aa] {ON} 
          Length = 866

 Score = 1572 bits (4070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 778/867 (89%), Positives = 791/867 (91%), Gaps = 1/867 (0%)

Query: 1   MNNNIPDSPPSNTCSSEILVRQISFRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDY 60
           MNNNIPDSPPSNTCSSEILVRQISFRD                              QDY
Sbjct: 1   MNNNIPDSPPSNTCSSEILVRQISFRDTTTPNTSVSSNNNSTPTPKRRKVLKKFVLVQDY 60

Query: 61  PSQSEDSEWTRIDSKGNNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120
           PSQSEDSEWTRIDSKG NSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH
Sbjct: 61  PSQSEDSEWTRIDSKGKNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120

Query: 121 LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI 180
           LRDDCT+P DYFHGNLKDERIIKEIC+KK +KYR+LKQYIKTQSFFD+AV LILESRLSI
Sbjct: 121 LRDDCTDP-DYFHGNLKDERIIKEICEKKQNKYRNLKQYIKTQSFFDLAVELILESRLSI 179

Query: 181 NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA 240
           NWVES  AK LW+TMALIP +N SKPEQ+ KPNKSN++NFI TKSKDINYFW+SEIASSA
Sbjct: 180 NWVESSVAKNLWATMALIPIDNTSKPEQVLKPNKSNITNFICTKSKDINYFWKSEIASSA 239

Query: 241 HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 300
           +ILNEKTFT R   LVSLTKRL AL+NVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK
Sbjct: 240 YILNEKTFTKRNKFLVSLTKRLCALENVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 299

Query: 301 QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360
           QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL
Sbjct: 300 QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 359

Query: 361 LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 420
           LGTRFLGHVPCLLHSANIMNSTMFD VEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN
Sbjct: 360 LGTRFLGHVPCLLHSANIMNSTMFDTVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 419

Query: 421 EILKQDIFTEYXXXXXXXXXXXXADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 480
           EILKQDIFTEY            ADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR
Sbjct: 420 EILKQDIFTEYLLSNNSQLSSESADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 479

Query: 481 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 540
           ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF
Sbjct: 480 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 539

Query: 541 VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 600
           VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP
Sbjct: 540 VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 599

Query: 601 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS 660
           VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS
Sbjct: 600 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS 659

Query: 661 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSXXXXXXXXXXXXXXXX 720
           QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSS                
Sbjct: 660 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSEGQEEKNLEFEEEFDE 719

Query: 721 XSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS 780
            SIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS
Sbjct: 720 FSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS 779

Query: 781 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL 840
           RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL
Sbjct: 780 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL 839

Query: 841 RIKLGSINITDCTLNDALRLTKELNLE 867
           RIKLGSINITDCTLNDALRLTKELNLE
Sbjct: 840 RIKLGSINITDCTLNDALRLTKELNLE 866

>NCAS0A07480 Chr1 (1484806..1487409) [2604 bp, 867 aa] {ON} 
          Length = 867

 Score = 1558 bits (4035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 772/867 (89%), Positives = 787/867 (90%)

Query: 1   MNNNIPDSPPSNTCSSEILVRQISFRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDY 60
           MNNNIPDSPPSNTCSSEILVRQISFRD                              QDY
Sbjct: 1   MNNNIPDSPPSNTCSSEILVRQISFRDTTTPNTSVSSNNNSTPTPKRRKVLKKFVLVQDY 60

Query: 61  PSQSEDSEWTRIDSKGNNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120
           PSQSEDSEWTRIDSKGNNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH
Sbjct: 61  PSQSEDSEWTRIDSKGNNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120

Query: 121 LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI 180
           LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFD+AV LILESRLSI
Sbjct: 121 LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDLAVELILESRLSI 180

Query: 181 NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA 240
           NWVES  AK LW+TMALIP +N SKPEQ+ KPNKSN++NFI TKSKDINYFW+SEIASSA
Sbjct: 181 NWVESSVAKNLWATMALIPIDNTSKPEQVLKPNKSNITNFICTKSKDINYFWKSEIASSA 240

Query: 241 HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 300
           +ILNEKTFT R   LVSLTKRL AL+NVTF+S+VFDHWSN+K+SN+LGV LVTYDEEE K
Sbjct: 241 YILNEKTFTKRNKFLVSLTKRLCALENVTFISIVFDHWSNNKISNHLGVSLVTYDEEEEK 300

Query: 301 QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360
           Q+ FLVKMDRSDSHKTIDISQQL EIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL
Sbjct: 301 QLSFLVKMDRSDSHKTIDISQQLVEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360

Query: 361 LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 420
           LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN
Sbjct: 361 LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 420

Query: 421 EILKQDIFTEYXXXXXXXXXXXXADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 480
           EILKQDIFTEY            ADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR
Sbjct: 421 EILKQDIFTEYLLSNNSQLSSESADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 480

Query: 481 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 540
           ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVL ELNREPSLGVFFDEEDF
Sbjct: 481 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLTELNREPSLGVFFDEEDF 540

Query: 541 VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 600
           VLMDDLTDILSPFRSLCEM SNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP
Sbjct: 541 VLMDDLTDILSPFRSLCEMPSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 600

Query: 601 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS 660
           VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS
Sbjct: 601 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS 660

Query: 661 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSXXXXXXXXXXXXXXXX 720
           QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSS                
Sbjct: 661 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSEGQEEKNLEFEEEFDE 720

Query: 721 XSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS 780
            SIKDDLQEQIRLELEQYRLR LSLVK YSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS
Sbjct: 721 FSIKDDLQEQIRLELEQYRLRDLSLVKGYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS 780

Query: 781 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL 840
           RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL
Sbjct: 781 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL 840

Query: 841 RIKLGSINITDCTLNDALRLTKELNLE 867
           RIKLGSINITDCTLNDALRLTKELNLE
Sbjct: 841 RIKLGSINITDCTLNDALRLTKELNLE 867

>NCAS0B07990 Chr2 (1514105..1516705) [2601 bp, 866 aa] {ON} 
          Length = 866

 Score = 1484 bits (3843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 737/867 (85%), Positives = 771/867 (88%), Gaps = 1/867 (0%)

Query: 1   MNNNIPDSPPSNTCSSEILVRQISFRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDY 60
           MNNNIPDSPPSNTCSSEILVRQISFRD                              +DY
Sbjct: 1   MNNNIPDSPPSNTCSSEILVRQISFRDTTTPNTSVSSNNNSTPTPKRRKVLENFILLKDY 60

Query: 61  PSQSEDSEWTRIDSKGNNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120
           PSQ EDS+WT I+SKG NSIWSHFLEGKKDRS LKCT+CN+V+RYNRR+A YN +PAE H
Sbjct: 61  PSQFEDSDWTHIESKGKNSIWSHFLEGKKDRSTLKCTHCNHVFRYNRRKATYNIQPAENH 120

Query: 121 LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI 180
           LR DCT+P DYFHGNLKDERIIKEIC+KK +KYR+LKQYIKTQSFFD+AV LILESRLSI
Sbjct: 121 LRYDCTDP-DYFHGNLKDERIIKEICEKKQNKYRNLKQYIKTQSFFDLAVELILESRLSI 179

Query: 181 NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA 240
           NWVES  AK LW+TMALIP +N SKPEQ+ KPNKSN++NFI TKSKDINYFW+SEIASSA
Sbjct: 180 NWVESSVAKNLWATMALIPIDNTSKPEQVLKPNKSNITNFICTKSKDINYFWKSEIASSA 239

Query: 241 HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 300
           +ILNEKTFT R   LVSLTKRL AL+NVTF+S VFDHWS++K+SN+LGV LVTYDEEE K
Sbjct: 240 YILNEKTFTKRNKFLVSLTKRLCALENVTFISFVFDHWSHNKISNHLGVSLVTYDEEEEK 299

Query: 301 QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360
           Q+ FLVKMDRSDSHKTIDISQQL EIF+KFDGLRTVTVGMSTDN ANMLKVP+E +R GL
Sbjct: 300 QLSFLVKMDRSDSHKTIDISQQLVEIFSKFDGLRTVTVGMSTDNVANMLKVPREFTRNGL 359

Query: 361 LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 420
           L + FLG VPCLLHS +IMNST+ DMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN
Sbjct: 360 LSSHFLGDVPCLLHSPDIMNSTLLDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 419

Query: 421 EILKQDIFTEYXXXXXXXXXXXXADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 480
           EILKQDIFTEY            ADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR
Sbjct: 420 EILKQDIFTEYLLSNNSQLSSESADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 479

Query: 481 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 540
           ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF
Sbjct: 480 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 539

Query: 541 VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 600
           VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP
Sbjct: 540 VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 599

Query: 601 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS 660
           VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVIS VS
Sbjct: 600 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISFVS 659

Query: 661 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSXXXXXXXXXXXXXXXX 720
           QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSS                
Sbjct: 660 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSEGQEEKNLEFEEEFDE 719

Query: 721 XSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS 780
            SIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGAD+IFWS
Sbjct: 720 FSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADDIFWS 779

Query: 781 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL 840
           RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL
Sbjct: 780 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL 839

Query: 841 RIKLGSINITDCTLNDALRLTKELNLE 867
           RIKLGSINITDCTLNDALRLTKELNLE
Sbjct: 840 RIKLGSINITDCTLNDALRLTKELNLE 866

>NCAS0C04620 Chr3 complement(944804..947287) [2484 bp, 827 aa] {ON} 
          Length = 827

 Score = 1383 bits (3580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/824 (83%), Positives = 724/824 (87%), Gaps = 1/824 (0%)

Query: 1   MNNNIPDSPPSNTCSSEILVRQISFRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDY 60
           MNNNIPDSPPSNTCSSEILVRQISFRD                              +DY
Sbjct: 1   MNNNIPDSPPSNTCSSEILVRQISFRDTTTPNTSVSSNNNSTPTPKRRKVLENFILLKDY 60

Query: 61  PSQSEDSEWTRIDSKGNNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120
           PSQ EDS+WT I+SKG NSIWSHFLEGKKDRS LKCT+CN+V+RYNRR+A YN +PAE H
Sbjct: 61  PSQFEDSDWTHIESKGKNSIWSHFLEGKKDRSTLKCTHCNHVFRYNRRKAPYNIQPAENH 120

Query: 121 LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI 180
           LR DCT+P DYFHGNLKDERIIKEIC+KK +KYR+LKQYIKTQSFFD+AV LILESRLSI
Sbjct: 121 LRYDCTDP-DYFHGNLKDERIIKEICEKKQNKYRNLKQYIKTQSFFDLAVELILESRLSI 179

Query: 181 NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA 240
           NWVES  AK LW+TMALIP +N SKPEQ+ KPNKSN++NFI TKSKDINYFW+SEIASSA
Sbjct: 180 NWVESSVAKNLWATMALIPIDNTSKPEQVLKPNKSNITNFICTKSKDINYFWKSEIASSA 239

Query: 241 HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 300
           +ILNEKTFT R   LVSLTKRL AL+NVTF+S+VFDHWS++K+SN+LGV LVTYDEEE K
Sbjct: 240 YILNEKTFTKRNKFLVSLTKRLCALENVTFISIVFDHWSHNKISNHLGVSLVTYDEEEEK 299

Query: 301 QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360
           Q+ FLVKMDRSDSHKTIDISQQL EIF+KFDGLRTVTVGMSTDN ANMLKVP+E +R GL
Sbjct: 300 QLSFLVKMDRSDSHKTIDISQQLVEIFSKFDGLRTVTVGMSTDNVANMLKVPREFTRNGL 359

Query: 361 LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 420
           L + FLG VPCLLHS +IMNST+ DMVEED LG VDSE +S+LLELAAMKYQLNSDGSRN
Sbjct: 360 LSSHFLGDVPCLLHSPDIMNSTLLDMVEEDGLGPVDSEHESELLELAAMKYQLNSDGSRN 419

Query: 421 EILKQDIFTEYXXXXXXXXXXXXADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 480
           EILKQDIFTEY            ADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR
Sbjct: 420 EILKQDIFTEYLLSNNSQLSSESADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 479

Query: 481 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 540
           ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF
Sbjct: 480 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 539

Query: 541 VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 600
           VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP
Sbjct: 540 VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 599

Query: 601 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS 660
           VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS
Sbjct: 600 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS 659

Query: 661 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSXXXXXXXXXXXXXXXX 720
           QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSS                
Sbjct: 660 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSEGQEEKNLEFEEEFDE 719

Query: 721 XSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS 780
            SIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS
Sbjct: 720 FSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS 779

Query: 781 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQL 824
           RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDK K  L
Sbjct: 780 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKEKPTL 823

>NCAS0D04560 Chr4 (866980..869580) [2601 bp, 866 aa] {ON} 
          Length = 866

 Score = 1332 bits (3446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/867 (76%), Positives = 732/867 (84%), Gaps = 1/867 (0%)

Query: 1   MNNNIPDSPPSNTCSSEILVRQISFRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDY 60
           MN++I DSPP +  SSE+ + QISFR+                              +DY
Sbjct: 1   MNHDILDSPPPSNGSSELFIPQISFRNTTTCDTSVIDNSNSMPTPKRRKVLENFILLKDY 60

Query: 61  PSQSEDSEWTRIDSKGNNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120
           PSQ EDS+WT I+SKG NSIWSHFLEGKKDRS LKCT+CN+V+RYNRR+A YN +PAE H
Sbjct: 61  PSQFEDSDWTHIESKGKNSIWSHFLEGKKDRSTLKCTHCNHVFRYNRRKAPYNIQPAENH 120

Query: 121 LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI 180
           LR DCT+P DYFHGNLKDERIIKEIC+KK +KYR+LKQYIKTQSFFD+AV LILESRLSI
Sbjct: 121 LRYDCTDP-DYFHGNLKDERIIKEICEKKQNKYRNLKQYIKTQSFFDLAVELILESRLSI 179

Query: 181 NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA 240
           NWVES  AK LW+TMALIP +N SKPEQ+ KPNKSN++NFI TKSKDINYFW+SEIASSA
Sbjct: 180 NWVESSVAKNLWATMALIPIDNTSKPEQVLKPNKSNITNFICTKSKDINYFWKSEIASSA 239

Query: 241 HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 300
           +ILNEKTFT R   LVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK
Sbjct: 240 YILNEKTFTKRNKFLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 299

Query: 301 QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360
           QIPFLVKMDRSDSHK IDISQQLGEIF+KFDGLRTVTVGMSTDN ANMLKVP+E +R GL
Sbjct: 300 QIPFLVKMDRSDSHKKIDISQQLGEIFSKFDGLRTVTVGMSTDNVANMLKVPREFTRNGL 359

Query: 361 LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 420
           L + FLG VPCLLHS +IMNST+ DMVEED LG VDS+ +S+LLELAA+KYQLNSDGSRN
Sbjct: 360 LSSHFLGDVPCLLHSPDIMNSTLLDMVEEDGLGPVDSKHESELLELAAIKYQLNSDGSRN 419

Query: 421 EILKQDIFTEYXXXXXXXXXXXXADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 480
            ILKQDIFT Y            A+ GG+ SFIT DIILKKNNQLA  IKS+ VNQLLYR
Sbjct: 420 NILKQDIFTNYLLSNSSQLSSEPAETGGLLSFITDDIILKKNNQLAHAIKSNHVNQLLYR 479

Query: 481 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 540
           ELC+EF KM+ +EPLA+KTYSK++WLSA+DV+LRLRELK VLMELN EPSLGVFF+EEDF
Sbjct: 480 ELCIEFAKMHEDEPLALKTYSKSKWLSAVDVLLRLRELKLVLMELNEEPSLGVFFEEEDF 539

Query: 541 VLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLP 600
           VL+DDLTDILSPF SLCEMLSN TCT+KNTLP+LISYKDKIDK+F EKS+S +  +RHLP
Sbjct: 540 VLIDDLTDILSPFHSLCEMLSNGTCTIKNTLPMLISYKDKIDKMFAEKSRSCSPAYRHLP 599

Query: 601 VFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS 660
           VFIRF+RK+DKYYKKYVSMD CLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS
Sbjct: 600 VFIRFKRKIDKYYKKYVSMDNCLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVS 659

Query: 661 QKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSXXXXXXXXXXXXXXXX 720
           +KLTDILIPFLNISYYP  DSDTED++G SSHA RVY+AE Y S                
Sbjct: 660 RKLTDILIPFLNISYYPTYDSDTEDIVGNSSHAERVYDAEGYLSEGQKQENLEFEGEFDE 719

Query: 721 XSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWS 780
            SIKDDL ++IRLELE+YRLRALSLVKEYSNEVLSKS K WS F+RQVQ+IVGAD IFWS
Sbjct: 720 FSIKDDLHKRIRLELERYRLRALSLVKEYSNEVLSKSNKSWSKFNRQVQVIVGADRIFWS 779

Query: 781 RHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLL 840
           RHKREFPLLSLAN+LFHCIPSTSI  ERLF LA+QI+DKRK+QLSDQ FEDLCIIRSFLL
Sbjct: 780 RHKREFPLLSLANRLFHCIPSTSILTERLFCLASQIYDKRKNQLSDQTFEDLCIIRSFLL 839

Query: 841 RIKLGSINITDCTLNDALRLTKELNLE 867
           RIK GSINITDCTL DALRLTKELN+E
Sbjct: 840 RIKSGSINITDCTLKDALRLTKELNME 866

>NCAS0G04270 Chr7 complement(793572..795209) [1638 bp, 545 aa] {ON} 
          Length = 545

 Score = 1018 bits (2632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/545 (91%), Positives = 499/545 (91%)

Query: 1   MNNNIPDSPPSNTCSSEILVRQISFRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDY 60
           MNNNIPDSPPSNTCSSEILVRQISFRD                              QDY
Sbjct: 1   MNNNIPDSPPSNTCSSEILVRQISFRDTTTPNTSVSSNNNSTPTPKRRKVLKKFVLVQDY 60

Query: 61  PSQSEDSEWTRIDSKGNNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120
           PSQSEDSEWTRIDSKG NSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH
Sbjct: 61  PSQSEDSEWTRIDSKGKNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELH 120

Query: 121 LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI 180
           LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI
Sbjct: 121 LRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSI 180

Query: 181 NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA 240
           NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA
Sbjct: 181 NWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSA 240

Query: 241 HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 300
           HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK
Sbjct: 241 HILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGK 300

Query: 301 QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360
           QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL
Sbjct: 301 QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360

Query: 361 LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 420
           LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN
Sbjct: 361 LGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRN 420

Query: 421 EILKQDIFTEYXXXXXXXXXXXXADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYR 480
           EILKQDIFTEY            ADIGGIFSFITGDIILKKNNQLA  IKSSSVNQLLYR
Sbjct: 421 EILKQDIFTEYLLSNNSQISSESADIGGIFSFITGDIILKKNNQLAHAIKSSSVNQLLYR 480

Query: 481 ELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 540
           ELCVEFGKMNGEEPLAIKTYSKTRW SALDVVLRLRELKPVLMELNREPSLGVFFDEEDF
Sbjct: 481 ELCVEFGKMNGEEPLAIKTYSKTRWQSALDVVLRLRELKPVLMELNREPSLGVFFDEEDF 540

Query: 541 VLMDD 545
           VLMDD
Sbjct: 541 VLMDD 545

>NCAS0E04230 Chr5 complement(834106..835707) [1602 bp, 533 aa] {ON}
          Length = 533

 Score =  978 bits (2527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/533 (91%), Positives = 493/533 (92%)

Query: 335 TVTVGMSTDNAANMLKVPKELSRTGLLGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGF 394
           TVTVGMSTDN ANMLKVP+E +R GLL + FLG VPCLLHS +IMNST+ DMVEED LG 
Sbjct: 1   TVTVGMSTDNVANMLKVPREFTRNGLLSSHFLGDVPCLLHSPDIMNSTLLDMVEEDGLGP 60

Query: 395 VDSELKSKLLELAAMKYQLNSDGSRNEILKQDIFTEYXXXXXXXXXXXXADIGGIFSFIT 454
           VDSE +S+LLELAAMKYQLNSDGSRNEILKQDIFTEY            ADIGGIFSFIT
Sbjct: 61  VDSEHESELLELAAMKYQLNSDGSRNEILKQDIFTEYLLSNNSQLSSESADIGGIFSFIT 120

Query: 455 GDIILKKNNQLALNIKSSSVNQLLYRELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLR 514
           GDIILKKNNQLALNIKSSSVNQLLYRELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLR
Sbjct: 121 GDIILKKNNQLALNIKSSSVNQLLYRELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLR 180

Query: 515 LRELKPVLMELNREPSLGVFFDEEDFVLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLL 574
           LRELKPVLMELNREPSLGVFFDEEDFVLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLL
Sbjct: 181 LRELKPVLMELNREPSLGVFFDEEDFVLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLL 240

Query: 575 ISYKDKIDKIFVEKSKSSNLTHRHLPVFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVD 634
           ISYKDKIDKIFVEKSKSSNLTHRHLPVFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVD
Sbjct: 241 ISYKDKIDKIFVEKSKSSNLTHRHLPVFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVD 300

Query: 635 SSVFIEQFPRENTEIKKSDHVISVVSQKLTDILIPFLNISYYPIKDSDTEDMIGISSHAG 694
           SSVFIEQFPRENTEIKKSDHVISVVSQKLTDILIPFLNISYYPIKDSDTEDMIGISSHAG
Sbjct: 301 SSVFIEQFPRENTEIKKSDHVISVVSQKLTDILIPFLNISYYPIKDSDTEDMIGISSHAG 360

Query: 695 RVYNAEDYSSXXXXXXXXXXXXXXXXXSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVL 754
           RVYNAEDYSS                 SIKDDLQEQIRLELEQYRLRALSLVKEYSNEVL
Sbjct: 361 RVYNAEDYSSEGQEEKNLEFEEEFDEFSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVL 420

Query: 755 SKSKKRWSPFDRQVQMIVGADNIFWSRHKREFPLLSLANKLFHCIPSTSIHAERLFSLAA 814
           SKSKKRWSPFDRQVQMIVGADNIFWSRHKREFPLLSLANKLFHCIPSTSIHAERLFSLAA
Sbjct: 421 SKSKKRWSPFDRQVQMIVGADNIFWSRHKREFPLLSLANKLFHCIPSTSIHAERLFSLAA 480

Query: 815 QIFDKRKSQLSDQMFEDLCIIRSFLLRIKLGSINITDCTLNDALRLTKELNLE 867
           QIFDKRKSQLSDQMFEDLCIIRSFLLRIKLGSINITDCTLNDALRLTKELNLE
Sbjct: 481 QIFDKRKSQLSDQMFEDLCIIRSFLLRIKLGSINITDCTLNDALRLTKELNLE 533

>NCAS0D01210 Chr4 (220793..223423) [2631 bp, 876 aa] {ON} 
          Length = 876

 Score =  941 bits (2432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/873 (54%), Positives = 621/873 (71%), Gaps = 11/873 (1%)

Query: 1   MNNNIPDSPPSNTCSSEILVRQISFRDXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXQ 58
           +++NIPDSPP++  SS++++ Q+   D                                 
Sbjct: 2   LSHNIPDSPPTDNASSKLVLSQVDSEDISISEESSLTSDNCFSTPTNKRRKIIKELVLPP 61

Query: 59  DYPSQSEDSEWTRIDSKGNNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAE 118
           D+  Q ED EW RIDSKG NS+W +F + KK+ SILKC NC+ ++  ++ +ARYNSEPAE
Sbjct: 62  DHLLQFEDPEWVRIDSKGKNSVWKYFKQNKKNYSILKCNNCHKIFNCDKEKARYNSEPAE 121

Query: 119 LHLRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRL 178
            HLR+ C+NPPD+FHGNL DE+ IKEICKKK D  R L Q+++  ++FDIA+ + LE RL
Sbjct: 122 SHLRNSCSNPPDHFHGNLNDEKTIKEICKKKKDGNRKLNQHLRKLTYFDIAIQMTLEFRL 181

Query: 179 SINWVESFTAKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIAS 238
           S+NW+ S T++ ++S M L P  N +   +    NKS+M ++I T  KDI+YFW+SEIAS
Sbjct: 182 SLNWISSKTSRRIFSCMNLEPDNNENSRTEHLTLNKSSMCSYINTTVKDIDYFWKSEIAS 241

Query: 239 SAHILNEKTFTNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEE 298
           SA++L +KTFT +     +L +RL  L NVTFMSLVFDHWSNHK++NYLGV LVTYDE+E
Sbjct: 242 SAYLLEKKTFTKKYNFPFTLAERLKELGNVTFMSLVFDHWSNHKITNYLGVSLVTYDEKE 301

Query: 299 GKQIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRT 358
           GKQ+PFL+KMDRS S K +DI+ QL +IFN + GL T+TVGMSTDNA N+LKVPK+L+  
Sbjct: 302 GKQLPFLIKMDRSPSGKKVDINNQLAKIFNTYAGLSTITVGMSTDNATNILKVPKQLANN 361

Query: 359 GLLGTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGS 418
            LL + FL HVPCL +SAN MNST+FDMV +   G +DSE +S++ ELAAMKYQL SDGS
Sbjct: 362 DLLSSHFLDHVPCLFNSANTMNSTLFDMVAKSGFGDIDSERESEIFELAAMKYQLKSDGS 421

Query: 419 RNEILKQDIFTEY--XXXXXXXXXXXXADIGGIFSFITGDIILKKNNQLALNIKSSSVNQ 476
           R+ ++KQDIFTE+              A+   + +F+TGD+ILKKNNQL L+IK+S  NQ
Sbjct: 422 RSGVIKQDIFTEFLLSNDTKNISAKNEAESSDLLTFLTGDVILKKNNQLVLDIKTSRSNQ 481

Query: 477 LLYRELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFD 536
            LYR LC +  K    EPLA+K Y+KTR LSAL+V+ RL ELKPVLMELN+   LG F +
Sbjct: 482 ELYRTLCEKHKKSYMGEPLALKIYTKTRRLSALEVLTRLYELKPVLMELNKSVELGGFLE 541

Query: 537 EEDFVLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTH 596
           E+DF+L++DLT+IL PF+S+CEMLSND CT+K+TLPLL+SYK+  DK+FV+K KSSN  +
Sbjct: 542 EDDFILIEDLTEILLPFQSVCEMLSNDACTVKSTLPLLVSYKNLTDKMFVDKIKSSNTKY 601

Query: 597 RHLPVFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVI 656
           RH   FIRF+++MD YY+ Y++M+ CLLSSYLNI FV++ VF++ F   N +IKK +HV 
Sbjct: 602 RHFSCFIRFKQRMDSYYEMYINMEDCLLSSYLNITFVNNPVFVQHFVPTNKDIKKREHVS 661

Query: 657 SVVSQKLTDILIPFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDY---SSXXXXXXXXX 713
            V+SQKL  IL+PFLNISY    D +  D    +S  G  +NA DY    S         
Sbjct: 662 RVISQKLATILVPFLNISYSSFGDREKTD---TNSSFGEDFNAADYLDNLSGIQEGEGND 718

Query: 714 XXXXXXXXSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSK-SKKRWSPFDRQVQMIV 772
                   SIK DLQE+I+ ELEQYR  ALS ++E   E   + S + WS F +QVQ+IV
Sbjct: 719 INEPFDEFSIKGDLQEKIKTELEQYRELALSSIEECIREFSKQHSNEDWSEFGQQVQVIV 778

Query: 773 GADNIFWSRHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDL 832
           GAD IFWS++K  FPLLS AN+LF+ +PSTSIHAERLFSLAAQI ++R++QLSDQ+FEDL
Sbjct: 779 GADRIFWSKYKGYFPLLSFANRLFNSLPSTSIHAERLFSLAAQISEQRRNQLSDQVFEDL 838

Query: 833 CIIRSFLLRIKLGSINITDCTLNDALRLTKELN 865
           C+IRSFLLR++L SINITDCTL DAL LTK+LN
Sbjct: 839 CVIRSFLLRLRLDSINITDCTLTDALSLTKKLN 871

>NCAS0F00700 Chr6 complement(136532..137914) [1383 bp, 460 aa] {ON} 
          Length = 460

 Score =  904 bits (2337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/457 (96%), Positives = 444/457 (97%)

Query: 195 MALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSAHILNEKTFTNRKTL 254
           MALIPTENNSKPEQ+FKPNKSNMSNFIRTKSKDINYFWRSEIASSAHILNEKTFTNRKTL
Sbjct: 1   MALIPTENNSKPEQVFKPNKSNMSNFIRTKSKDINYFWRSEIASSAHILNEKTFTNRKTL 60

Query: 255 LVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGKQIPFLVKMDRSDSH 314
           LVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGKQIPFLVKMDRSDSH
Sbjct: 61  LVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGKQIPFLVKMDRSDSH 120

Query: 315 KTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGLLGTRFLGHVPCLLH 374
           KTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSR GLLGTRFLGHVPCLLH
Sbjct: 121 KTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRIGLLGTRFLGHVPCLLH 180

Query: 375 SANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRNEILKQDIFTEYXXX 434
           SANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRNEILKQDIFTEY   
Sbjct: 181 SANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRNEILKQDIFTEYLLS 240

Query: 435 XXXXXXXXXADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYRELCVEFGKMNGEEP 494
                    ADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYRELCVEFGKMNGEEP
Sbjct: 241 NNSQLSSESADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYRELCVEFGKMNGEEP 300

Query: 495 LAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDFVLMDDLTDILSPFR 554
           LAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDFVLMDDLTDILSPFR
Sbjct: 301 LAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDFVLMDDLTDILSPFR 360

Query: 555 SLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLPVFIRFRRKMDKYYK 614
           SLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLPVFIRFRRKMDKYYK
Sbjct: 361 SLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLPVFIRFRRKMDKYYK 420

Query: 615 KYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKK 651
           KYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKK
Sbjct: 421 KYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKK 457

>NCAS0G04250 Chr7 complement(791694..792794) [1101 bp, 366 aa] {ON} 
          Length = 366

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/333 (93%), Positives = 314/333 (94%)

Query: 489 MNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDFVLMDDLTD 548
           MNGEEPLAIKTYSKTRW SALDVVLRLRELKPVLMELNREPSLGVFFDEEDFVLMDDLT+
Sbjct: 1   MNGEEPLAIKTYSKTRWQSALDVVLRLRELKPVLMELNREPSLGVFFDEEDFVLMDDLTN 60

Query: 549 ILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLPVFIRFRRK 608
           ILSPFRSLCEML NDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLPVFIRFRRK
Sbjct: 61  ILSPFRSLCEMLPNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLPVFIRFRRK 120

Query: 609 MDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVSQKLTDILI 668
           MDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVSQKLTDILI
Sbjct: 121 MDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVSQKLTDILI 180

Query: 669 PFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSXXXXXXXXXXXXXXXXXSIKDDLQ 728
           PFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSS                 SIKDDLQ
Sbjct: 181 PFLNISYYPIKDSDTEDMIGISSHAGRVYNAEDYSSEGQEEKNLEFEEEFDEFSIKDDLQ 240

Query: 729 EQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADNIFWSRHKREFPL 788
           EQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGAD+IFWSRHKREFPL
Sbjct: 241 EQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQMIVGADDIFWSRHKREFPL 300

Query: 789 LSLANKLFHCIPSTSIHAERLFSLAAQIFDKRK 821
           LSLANKLFHCIPSTSIHAERLFSLAAQIFDKRK
Sbjct: 301 LSLANKLFHCIPSTSIHAERLFSLAAQIFDKRK 333

>NCAS0A06420 Chr1 complement(1264842..1267157) [2316 bp, 771 aa]
           {ON} 
          Length = 771

 Score =  445 bits (1145), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 275/729 (37%), Positives = 412/729 (56%), Gaps = 31/729 (4%)

Query: 149 KLDKYRDLKQYIKTQSFFDIAVGLILESRLSINWVESFTAKTLWSTMALIPTENNSK--- 205
           K DK   L +Y K  S FD  + L L   LS+NW+   + +  ++   L   +N  K   
Sbjct: 48  KSDKRSSLSEYRKKPSKFDETIALTLTLNLSLNWLADKSLRRQFNR--LYENDNGYKTAG 105

Query: 206 PEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSAHILNEKTFT---NRKTLLVSLTKRL 262
           P+     N  ++S  I  K K+INYFWR E+ SS ++LN+K +    N+++L +S+ +R+
Sbjct: 106 PKDNLTLNPISLSIAIGNKVKEINYFWRRELLSSEYVLNQKLYVREVNQESLKISILQRI 165

Query: 263 YALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGKQIPFLVKMDRSDSHKTIDISQQ 322
             L +VTF+SLVFDHW N+KM N+ GV LVTYDE      PFL++M    SH T  I  Q
Sbjct: 166 EDLRDVTFLSLVFDHWPNYKMGNFSGVTLVTYDEMRNTLCPFLLQMAPLSSHTTDAIGTQ 225

Query: 323 LGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGLLGTRFLGHVPCLLHSANIMNST 382
           L  I   F GL+++TV MSTDNAAN+LK PK L +   L  RFLGHVPCLL S N +N T
Sbjct: 226 LDNITQDFPGLKSLTVAMSTDNAANILKTPKGLEKLNKLNDRFLGHVPCLLQSINRVNGT 285

Query: 383 MFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRNEILKQDIFTEYXXXXXXXXXXX 442
           +F+  EE     + S ++S+L+E  A++ QL  DGS+      D F E            
Sbjct: 286 LFESSEEGRDD-IRSYMESRLMEKYALECQLQEDGSKIGNYTADSFFESLQKTQNIDDE- 343

Query: 443 XADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYRELCVEFGKMNGEEPLAIKTYSK 502
                 +  F++GD IL+KNN+LA  IK+S + + ++   C +    + +  L +K+Y  
Sbjct: 344 ------LTYFLSGDKILRKNNELAYEIKTSFIKKEIFNSHCQKHQIAHADNDLRLKSYCI 397

Query: 503 TRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDFVLMDDLTDILSPFRSLCEMLSN 562
           TRW+SA+D + R++ LKPVL +L  + +    F +EDF L DDL   + PF+ LCE LS 
Sbjct: 398 TRWVSAIDTLQRIKLLKPVLTDLGNDQTFVTKFTKEDFALADDLLKFIEPFQVLCETLSR 457

Query: 563 DTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLPVFIRFRRKMDKYYKKYVSMDIC 622
           D CT+K  +PLL+ YK  +++  +E  KS+++  +H     +F  KM KYY KY    +C
Sbjct: 458 DNCTVKFAIPLLLHYKILMEQNDIEHLKSNSVNFQHTKHLTQFTEKMKKYYHKYTENKVC 517

Query: 623 LLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVSQKLTDILIPFLNISYYPIKDSD 682
            +SS+L I FV+S  +  ++P    + KK+  +  ++S+K+++ +IPFLN+ Y    D +
Sbjct: 518 EISSFLCINFVNSKFWPAKYPGRGADGKKTSFIAEMLSKKISEAIIPFLNVHYNKEDDFE 577

Query: 683 TEDMIGISSHAGRVYNAEDYSSXXX----XXXXXXXXXXXXXXSIKDDLQEQIRLELEQY 738
            + +   SS      +  D  S                     SI+ DL++ I  E+ +Y
Sbjct: 578 NQVVDPNSSFIAGFDDTVDQGSIGAIDNSEEVGAGNDTTFNKESIRTDLEQLIFEEIIEY 637

Query: 739 RLRA----LSLVKEYS--NEVLSKSKKRWSPFDRQVQMIVGADNIFWSRHKREFPLLSLA 792
             +A     + VKE++  N+  S  + +W     +   IVGADNIFW +    FP+LS A
Sbjct: 638 CAKADQERRNCVKEFAQTNKFPSMERFKW-----KCSTIVGADNIFWKKFGANFPILSFA 692

Query: 793 NKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRSFLLRIKLGSINITDC 852
           N+LF  IP++SI+ ERLF +A+ I  K+KSQ S++M E+LCI++SF   I L  IN+  C
Sbjct: 693 NRLFRNIPASSIYVERLFGVASMIDAKKKSQQSNKMLENLCILKSFRSNISLEEINLATC 752

Query: 853 TLNDALRLT 861
            L DA+ +T
Sbjct: 753 NLKDAIEVT 761

>NCAS0C03910 Chr3 (792605..795127) [2523 bp, 840 aa] {ON} 
          Length = 840

 Score =  432 bits (1110), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 268/804 (33%), Positives = 417/804 (51%), Gaps = 33/804 (4%)

Query: 69  WTRIDSKGNNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELHLRDDCTNP 128
           W  I     +S  + F +   D ++  C  C+ +Y Y+     YN+   E H RD+C NP
Sbjct: 59  WEDIKELKKSSPLNFFKKNIHDSTLYCCKGCSQMYYYDSEAPHYNTSALERHFRDECINP 118

Query: 129 PDYFHGNLKDERIIKEICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSINWVESFTA 188
           P  F+  +   R  K       +K  ++         F+ A+   L   L + W+E   A
Sbjct: 119 PSGFYDRV--SRKSKPEPNSTFEKPYNISTV--NNDMFNKAILFTLTFDLPLMWLEDRAA 174

Query: 189 KTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSAHILNEKTF 248
           K+ +   A     +  K   +   N   ++  I+ K ++I+ FW++E+ SSA +L +   
Sbjct: 175 KSWYEEYACHTNIDFKKQTSL---NYRTLTASIKRKHQEIDNFWKAELNSSAFLLRQTKI 231

Query: 249 TNRKTLLVSLTKRLYALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGKQIPFLVKM 308
           + +  LL ++ KR+  L ++   SLV DHW N K ++Y+GV++V+YD  + K +PFL+K+
Sbjct: 232 SKKNRLLDTIVKRIGELKSINLFSLVLDHWPNDKTNSYMGVVIVSYDSTQKKLVPFLLKL 291

Query: 309 DRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAA-------NMLKVPKELSRTGLL 361
            RS  H    +  QL +I   F GL    V +S DNAA       +MLKVP  +S   L 
Sbjct: 292 PRSHKHDAATVYSQLQQIVRYFPGLSETCVAISIDNAAISTNNDTSMLKVPNNISSNLLF 351

Query: 362 GTRFLGHVPCLLHSANIMNSTMFDMVEEDSLGFVDSELKSKLLELAAMKYQLNSDGSRNE 421
              FLG+VP LLHS+N+MN  +    EE+S    +  L+SK LE  AM+ +++ +G+   
Sbjct: 352 NKVFLGNVPSLLHSSNLMNFGLLHKSEEES---TEDYLESKALEEDAMESRVSENGTNTN 408

Query: 422 ILKQDIFTEYXXXXXXXXXXXXADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLLYRE 481
             K D F  +              +       T ++IL+KNN L   IK+    + LY +
Sbjct: 409 FQKHDPFVHFLTIQDDSLELTEGHM-------TEEMILEKNNSLFCEIKTDISKKQLYDD 461

Query: 482 LCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEEDFV 541
           +C  +GK+  +E L +K Y +TRW+SA+D + RL ++K VL+EL R  +    F E DF 
Sbjct: 462 ICAHYGKVYRDEGLKLKLYCRTRWVSAIDTLKRLLQMKDVLLELERHKTFETQFTENDFH 521

Query: 542 LMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRHLPV 601
           +  DL  I+ P++  CE LS+D CT+K  LPLL  YK K+++   +  K      +  P 
Sbjct: 522 IAQDLLMIVEPYKVFCETLSSDNCTVKYALPLLSYYKQKMEQYEKDLKK-----RQETPY 576

Query: 602 FIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISVVSQ 661
            I F++KMDKY++++   DICLLSS L+I F+D   + ++FPR+  + KK   V S +++
Sbjct: 577 LIAFKKKMDKYFERFSKNDICLLSSCLSIDFIDDPFWTKKFPRKGADGKKRTFVFSKIAE 636

Query: 662 KLTDILIPFLNISY---YPIKDSDTEDMIGISSHAGRVYNAEDYSSXXXXXXXXXXXXXX 718
           KL+  L+P+LNISY        S  ED    ++H         + S              
Sbjct: 637 KLSGRLLPYLNISYEGKMDDSSSFDEDDSSSTTHPFASTGEAMHESDEYFHRLAENIQNF 696

Query: 719 XXXSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRW-SPFDRQVQMIVGADNI 777
              +IK DL+E I  EL  YR      +  Y+ E   K    + S F    ++++ ADN 
Sbjct: 697 DPKTIKRDLEELIYNELLDYRKVTKKKIHIYTKEYRQKEDISFESYFTSLCKLVIAADNA 756

Query: 778 FWSRHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMFEDLCIIRS 837
           FW  H  EFP+LS AN +F  +P+TSI  ++LFSLA  I  K+ S LSD MFE LC+++S
Sbjct: 757 FWDDHFDEFPILSFANDIFRNVPATSIQVDKLFSLAGCIATKKISNLSDSMFESLCVLKS 816

Query: 838 FLLRIKLGSINITDCTLNDALRLT 861
           F     + ++++  CTL+ A+  T
Sbjct: 817 FSQTADISAVDLQKCTLSQAINST 840

>NCAS0A10520 Chr1 complement(2091961..2094384) [2424 bp, 807 aa]
           {ON} 
          Length = 807

 Score =  429 bits (1104), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 262/815 (32%), Positives = 432/815 (53%), Gaps = 48/815 (5%)

Query: 85  LEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELHLRDDCTNPPDYFHGNLKDERIIKE 144
           +E  ++ ++ +C  C+    YN     YN    + HL+  CT  P   +G++  +  +  
Sbjct: 1   MESTREPNLYQCNLCHKTIVYNESFENYNPRILDRHLKFSCTKAPPVLNGDISSQSALMH 60

Query: 145 ICKKKLDKYRDLKQYIKTQSFFDIAVGLILESRLSINWVESFTAKTLWSTMALIPTENNS 204
           + K++   +++L       S FD+AV    +  L + W+E+     ++  +        +
Sbjct: 61  LAKERQKSFKNLSYLNYIPSEFDLAVSFTSKLNLPLTWIENEDITGIFKYVLNSLDNKQT 120

Query: 205 KPEQIFKP-NKSNMSNFIRTKSKDINYFWRSEIASSAHILNEKTFTNRKTLLVSLTKRLY 263
             E   K  NK ++ N I  K++DI YFW++E A+S  IL ++TF  ++ LL ++ +R+ 
Sbjct: 121 YCENYQKKFNKKSLVNAIINKTEDIRYFWQAEFATSNFILMQQTFAKKENLLSTIIERIQ 180

Query: 264 ALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGKQIPFLVKMDRSDSHKTIDISQQL 323
            LD+V F  L+ D+WSNHKM+NYLG+++  Y++   K  PFL+K+ R +SH       Q+
Sbjct: 181 KLDSVVFPFLILDNWSNHKMNNYLGMMITIYNKATQKLCPFLLKIPRCESHTASTTYNQI 240

Query: 324 GEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGLLGTRFLGHVPCLLHSANIMNSTM 383
            E+ + F GL  + VGM++DNA+NML++ K+L    L G  +L HVPCL HS N+MNS +
Sbjct: 241 QELLDDFPGLSNLLVGMTSDNASNMLRLSKDLELGELFGNVYLSHVPCLSHSTNLMNSCL 300

Query: 384 FD-------------------------MVEEDSLGFVDSELKSKLLELAAMKYQLNSDGS 418
                                      M+  +S   + + + SKLLE    +  LN DG+
Sbjct: 301 IQPSSIEENNENSEENEPGDEEEPEDHMILINSFD-LKNYIDSKLLEKFDHECMLNPDGT 359

Query: 419 RNEILKQDIFTEYXXXXXXXXXXXXADIGGIFSFITGDIILKKNNQLALNIKSSSVNQLL 478
           +    + D+F EY                 I S +TG  +L+KNNQLA  IK S   + +
Sbjct: 360 QGITYEDDVFFEYLRGQELDKE--------IISLLTGHQLLQKNNQLAAEIKMSMHKRKI 411

Query: 479 YRELCVEFGKMNGEEPLAIKTYSKTRWLSALDVVLRLRELKPVLMELNREPSLGVFFDEE 538
           Y   C   G+    E L +K++ +TRW+SA++   RL  LKPV++ ++        F  E
Sbjct: 412 YDANCARMGRSRRGEGLRLKSFCRTRWMSAVETFKRLLFLKPVILSISTSSEFETKFTHE 471

Query: 539 DFVLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKSKSSNLTHRH 598
           +F ++ D+  +L PF +LCE LS+D CT+K  LPLL+  K  +    V+   + +    H
Sbjct: 472 EFNIVKDILSLLEPFATLCETLSSDRCTVKYALPLLVRCKCTMKTNSVDYLSNDDNNFSH 531

Query: 599 LPVFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFIEQFPRENTEIKKSDHVISV 658
           L    +F +KMDKY  KY + DICL+SS+L I+F D  ++ + FP +  +  K + + S 
Sbjct: 532 LAHMTQFMQKMDKYVAKYKNNDICLISSFLTISFDDHPIWTQIFPGKGQDGSKGEFIRSK 591

Query: 659 VSQKLTDILIPFLNISYYPIKDSDT--EDMIGISSHAGRVYN-AEDYSSXXXXXXXXXXX 715
           +++ +T +L+P LNIS+Y  +D DT  E     S     V+N ++D  +           
Sbjct: 592 IAKMITKMLLPLLNISFYNSEDEDTCSEGEADSSFIDSFVHNSSKDSKNSFDDTTENIAN 651

Query: 716 XXXXXXSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSP------FDRQVQ 769
                 SI++DL + +  EL+ +RL A   V    +   +++K +  P      F+   +
Sbjct: 652 NNFDFCSIENDLCDLVLSELKDFRLEAQKQV----SLCFAQNKLKMDPSLCGRSFNNICK 707

Query: 770 MIVGADNIFWSRHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQLSDQMF 829
            +  AD  FWS+   +FP+LSL N +   IP++SIH ER FS+A++I DKRK+ LSD+MF
Sbjct: 708 TLFDADLYFWSQFGDKFPILSLVNNVLKNIPASSIHIERFFSMASRIADKRKTDLSDKMF 767

Query: 830 EDLCIIRSFLLRIKLGSINITDCTLNDALRLTKEL 864
             LCI++SF L++    +NI   ++  A+  +++L
Sbjct: 768 SSLCILKSFGLKVDFTKVNIHKSSVFQAMEYSEDL 802

>NCAS0B02340 Chr2 complement(391384..393528) [2145 bp, 714 aa] {ON} 
          Length = 714

 Score =  168 bits (426), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 122/398 (30%), Positives = 210/398 (52%), Gaps = 24/398 (6%)

Query: 471 SSSVNQLLYRELCVEFGKMNGEEPLAIKTYSKTRWL-SALDVVLRLRELKPVLMELNREP 529
           ++ VN+ L+ E   E+  +       I+ ++KT+ + + L  +   ++L P + E  +  
Sbjct: 301 TNHVNECLFDEENEEYTNVT-----IIREFAKTKEMETTLQSLKSSKDLTPAIKESAKII 355

Query: 530 SLGVFFDEEDFVLMDDLTDILSPFRSLCEMLSNDTCTLKNTLPLLISYKDKIDKIFVEKS 589
                   ++  ++DDL  IL PF+ +CE+LS+D+CT+K  LPLL  Y     +I   + 
Sbjct: 356 EFDTKILTDNLTMIDDLLHILEPFQYICELLSSDSCTVKGALPLLEFYHILFKEIVTTEF 415

Query: 590 KSSNLTHRHLPVFIRFRRKMDKYYKKYVSMDICLLSSYLNIAFVDSSVFI--EQFP-REN 646
           +   ++     + I+  ++++KYYK Y+S D+CL++SYLN A+   ++F   E +P REN
Sbjct: 416 EKKVVSLHEGTILIKCLQQLEKYYKIYLSNDVCLMASYLN-AYFHKNIFWTREIYPKREN 474

Query: 647 TEIKKSDHVISVVSQKLTDILIPFLNISY-YPIKDSDTEDMIG--ISSHAGRVYNAEDYS 703
            E   S++    ++++ T +L+P+LNISY  P   S  E+ +   I     +++ +   S
Sbjct: 475 EE---SNYRYRDMAKRYTCMLLPYLNISYDEPNNCSGEEEFVADRIIDEIIQIHTSPVCS 531

Query: 704 SXXXXXXXXXXXXXXXXXSIKDDLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSP 763
                             SIK D++E +  EL  Y  R L    E       K K++   
Sbjct: 532 PSSSPIKPKDSQEYFDINSIKSDVEELVFEEL-LYFERKLRTATE-------KPKEKMRA 583

Query: 764 FDRQVQMIVGADNIFWSRHKREFPLLSLANKLFHCIPSTSIHAERLFSLAAQIFDKRKSQ 823
           F++    I+  D  FW  H++ FPLLSL N++ + IPS+SI  E++F+ A +I  +    
Sbjct: 584 FEKFGHQIIDLDRKFWKIHRKSFPLLSLVNRILNNIPSSSIRVEKMFNEAGKIAYEGGEL 643

Query: 824 LSDQMFEDLCIIRSFLLRIKLGSINITDCTLNDALRLT 861
           LS   FE LC +RSF  +I+L  I++ +CTLN A+ +T
Sbjct: 644 LSKTFFEQLCFLRSFSQKIELDEIDLEECTLNQAIEVT 681

 Score =  160 bits (404), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 103/297 (34%), Positives = 154/297 (51%), Gaps = 17/297 (5%)

Query: 105 YNRREARYNSEPAE----LHLRDDCTNPPDYFHGNLKDERIIKEICKKKLDKYRDLKQYI 160
           YN+R+ +Y S+ A      H    C  P    + ++ D+  I+E  ++K      L++ I
Sbjct: 25  YNQRQDKYRSDAAYTHFYAHFSTQCETPTKPHYSHVPDKVDIQEFIEEKKRTALPLEKII 84

Query: 161 KTQSFFDIAVGLILESRLSINWVESFTAKTLWST-------MALIPTENNSKPEQIFKPN 213
                FD A+   L  + S++W+     K +            L   E++  P       
Sbjct: 85  VEPGKFDRALIYTL-YQGSLDWITRLGPKKIIEGPVFSVKDGCLYKRESSGPPLDAL--- 140

Query: 214 KSNMSNFIRTKSKDINYFWRSEIASSAHILNEKTFTNRKTLLVSLTKRLYALDNVTFMSL 273
             N+  FI  K + +      EI  SA I+ +KT   R  L  ++ KR   L +VTF SL
Sbjct: 141 --NVQKFIVKKVQQLKRLLSFEIMGSAAIMKKKTTCRRHNLNETIEKRANVLRHVTFFSL 198

Query: 274 VFDHWSNHKMSNYLGVLLVTYDEEEGKQIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGL 333
           VF HWSNH M NYLGV LVTY+E++ K   FL+++  + S   IDI  QL +I  +++GL
Sbjct: 199 VFGHWSNHGMYNYLGVTLVTYNEKQEKLTSFLIRITDAYSPTAIDICNQLNDILEEYEGL 258

Query: 334 RTVTVGMSTDNAANMLKVPKELSRTGLLGTRFLGHVPCLLHSANIMNSTMFDMVEED 390
           +++ VG+STDNA+NM+KVP+ L     L   FLG +P LLHS N +N  +FD   E+
Sbjct: 259 KSLIVGLSTDNASNMVKVPEFLKENDELYPLFLGRIPRLLHSTNHVNECLFDEENEE 315

>TPHA0N01980 Chr14 (426263..428101) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 82/177 (46%), Gaps = 14/177 (7%)

Query: 211 KPNKSNMSNFIRTKSKDINYFWRSEIASSAHILNEKTFTN----RKTLLVSLTKRLYALD 266
           K N+   SN +R  S  I  F+++E+  +  I N +T         +L V + + +  L 
Sbjct: 151 KINRKEASNVLRKASTKIQVFFKNELKKNT-IFNNRTIIEFSLEVNSLEVFVVQIMTQLK 209

Query: 267 NV--TFMSLVFDHWSNHKMSNYLGVLL--VTYDEEEGKQIPFLVKMDRSDSHKTIDISQQ 322
           N    ++++  D W ++K  +Y  V+    T D  +G    F+ +  +++S K ID    
Sbjct: 210 NSEPPYVNVEMDDWKSNKRISYTAVIFNFPTMDYSKG---TFIARFVKAESKKKIDHQLI 266

Query: 323 LGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGLLGTRFLGHVPCLLHSANIM 379
           L    ++++    V     TDNA+ +L    EL+ +      + GH+ CL H  N++
Sbjct: 267 LKSTCDEYNS-NNVWTNTCTDNASAVLHCTSELTGSPNYPV-YAGHIGCLCHILNVI 321

>Kpol_387.6 s387 complement(11669..14446) [2778 bp, 925 aa] {ON}
           complement(11669..14446) [2778 nt, 926 aa]
          Length = 925

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 130/299 (43%), Gaps = 55/299 (18%)

Query: 110 ARYNSEPAELHLRDDCTNPPDYFHGNLKD------ERIIKEICKKK-----LDKYRDLKQ 158
           +R  +E  E H++D+  +P +YF  N+ D        + K + KKK     +D  R +K+
Sbjct: 131 SRRGAERCEDHIKDE--HPKEYFLENIMDCLNPNHAPVRKLLAKKKATPNVVDMIRTVKE 188

Query: 159 Y--IKTQSFFDIAVGLILESRLSINWVESFTAKTLWSTMALIPTENNSKPEQIF--KPNK 214
               K   F D A+     + L I++       ++W       T  +SK  Q F  K ++
Sbjct: 189 TNNKKRTQFEDYALTF---AHLGISF-------SIWDNKVFRKT--HSKFNQGFSRKHHR 236

Query: 215 SNMSNFIRTKSKDINYFWRSEIASSAHILNEKTF-------TNRKTLLVSLTKRLYAL-- 265
              S F++  SK + +F++ ++ S  H    KT        TN K++++   KR   L  
Sbjct: 237 RKASAFVKMISKRVVHFFQLKL-SEDHNFKSKTILNYPLDSTNLKSVIL---KRFSDLKY 292

Query: 266 DNVTFMSLVFDHW-SNHKMSNYLGVLLVTYDEEEGKQIPFLVKMDRSDSHKTIDISQQLG 324
               ++S+  D W SN K+S    V+++ +      +  FL   D+ +S    +    L 
Sbjct: 293 SKPPYVSMETDDWKSNTKLS--YNVVILNFTTGHYNKGTFLAMYDKIESKTKENHKIILL 350

Query: 325 EIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGLLGTR----FLGHVPCLLHSANIM 379
               K+   R  T    TDNA+++L        T L+G      + GH+ CL H  N++
Sbjct: 351 STCKKYKANRLWT-NTCTDNASSILHCT-----TALIGNPKYPIYAGHIGCLCHIINLV 403

>Kpol_1030.35 s1030 complement(74264..76993) [2730 bp, 909 aa] {ON}
           complement(74264..76993) [2730 nt, 910 aa]
          Length = 909

 Score = 39.3 bits (90), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 86/199 (43%), Gaps = 12/199 (6%)

Query: 188 AKTLWSTMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSAHILNEKT 247
           A ++W +          K     K ++   S+F++T SK +  +++S+++   +     T
Sbjct: 218 AFSIWDSKVFSKISRKDKQRLSLKDHRRKASDFVKTISKRVVDYFQSQLSEDQN-FKSTT 276

Query: 248 FTNRKTLLVSL----TKRLYALDNV--TFMSLVFDHW-SNHKMSNYLGVLLVTYDEEEGK 300
             N   L  SL     KR+  L N    ++S+  D W SN K+     V++  +     K
Sbjct: 277 IVNYPLLGESLEEIIVKRISDLKNSKPPYVSMETDVWKSNTKLP--YNVVIFNFTTGHYK 334

Query: 301 QIPFLVKMDRSDSHKTIDISQQLGEIFNKFDGLRTVTVGMSTDNAANMLKVPKELSRTGL 360
           +  FL K D+ +S    +    L     ++D   T+     TDN +++L     L R+  
Sbjct: 335 KGSFLAKYDKIESKTKENDKDILLSTCKEYD-TNTLWSNTCTDNDSSILHCTTALIRSPE 393

Query: 361 LGTRFLGHVPCLLHSANIM 379
               + GH+ CL H  N++
Sbjct: 394 YPN-YAGHIVCLSHIINLV 411

>SAKL0H03916g Chr8 (362450..365092) [2643 bp, 880 aa] {ON} similar
           to Saccharomyces cerevisiae YLR373C VID22 Vacuole import
           and degradation and to uniprot|P53246 Saccharomyces
           cerevisiae YGR071C Hypothetical ORF
          Length = 880

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 66/307 (21%), Positives = 116/307 (37%), Gaps = 41/307 (13%)

Query: 61  PSQSEDS-----EWTRIDSKGNNS--IWSHFLEGKKDRSILKCTNCNNVYRYNRREARYN 113
           PS+  +S     EW  +  +  N    W+H+L        +KC +C  +   ++ + + +
Sbjct: 84  PSEQGNSDEGCVEWVPVHHRKKNRSLCWTHYLCKDAQLETVKCKHCGAIITSDKSKNKSS 143

Query: 114 SEPAELHLRDDCTNPP--DYFHGNL----KDERIIKEICKKKLDKYRDLKQYI----KTQ 163
           +     HLR      P  DY+ G         R +       L     L   +     T 
Sbjct: 144 TSRFRSHLRIKHKIDPNSDYYAGTTLLPPTSTRPVGRPKGSTLASNTSLNSRVISRPNTS 203

Query: 164 SFFDIAVGLILESR---------------LSINWVESFTAKTLWSTMALIPTENNSK--P 206
           +   + VG   ES                L +++ ++ + + L    AL  T  + +   
Sbjct: 204 ALGSLHVGPARESNIDTKDLISIICASQDLPLSFFDNASVRLLLQ-RALNNTTIDPELVK 262

Query: 207 EQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSAHILNEKTFTNRKTLLVSLTKRLYALD 266
           E I K +K+      RT  ++ N     ++    HI    T T R+ +   L  ++  L 
Sbjct: 263 ESIIKTSKNIEHMVKRTVLRNCN-----DLPVEIHITAHNTIT-REQIKEQLRLKISELS 316

Query: 267 NVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGKQIPFLVKMDRSDSHKTIDISQQLGEI 326
           NV F SL    W     S    V L  YD  + KQ   L+ + R   +  + + +++ +I
Sbjct: 317 NVMFFSLTQHTWKRSHGSPISTVSLQFYDSIKKKQKQILITVKRLGENNVVSLRREILDI 376

Query: 327 FNKFDGL 333
           F +F GL
Sbjct: 377 FTRFPGL 383

>NDAI0D04520 Chr4 (1060889..1063849) [2961 bp, 986 aa] {ON}
           Anc_4.221 YGR071C
          Length = 986

 Score = 35.4 bits (80), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 73/341 (21%), Positives = 135/341 (39%), Gaps = 60/341 (17%)

Query: 75  KGNNSIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPA-ELHLRDDCTNPPD--- 130
           K N  +W+H+L      +I+KC +CN + +    +A  NS     +HL+      P+   
Sbjct: 95  KTNALLWTHYLGIDGALNIVKCKHCNTILKRGPHDAAKNSTVNFRMHLKTAHKVTPNMSF 154

Query: 131 YFHGNLKDERIIKEICKKK--LD------------------------------------- 151
           Y   N+ D  + K +  ++  LD                                     
Sbjct: 155 YDEENILDNNVTKNLHSRESTLDDVSSTFDSQLFKRRKYIKKPKTLPPFTLDMSKEITKL 214

Query: 152 KYRDL--KQYIKT-QSFF---DIAVGLILESRLSINWVESFTAKTLWST-MALIPTENNS 204
           K RD+  +  IKT Q FF   ++   ++    L +++  +   K L S+ +  +PT  +S
Sbjct: 215 KPRDVPSETTIKTRQHFFPSNNLLAIVVASENLPLDFANNSALKLLMSSILTSLPTSPDS 274

Query: 205 KPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSAHILNEKTFTNRKTLLVSLT-KRLY 263
             E I     S ++  IR  S   +Y    E+  S H+ N+   T RK LL +L    L 
Sbjct: 275 IRENIIGMATS-INKMIRKSSIQNDYHLPFELDIS-HLRNDLIGTERKLLLCTLIMNGLK 332

Query: 264 ALDNVTFMSLVFDHWSNHKMSNYLGVLLVTYDEEEGKQIPFLVKMDRSDSHKTIDISQQL 323
            L +  F SL    W  ++  + + +  + Y   + + +P  ++   +       +++QL
Sbjct: 333 DLPSFNFYSLSHQIW--NQQYSLISIQFIDYVNSKLRILPISIEDMGNKPITPKLLNRQL 390

Query: 324 GEIFNKFDGLRTVTVGMST-----DNAANMLKVPKELSRTG 359
             + +K+ GL    + +S      D   +   +P E  + G
Sbjct: 391 YNVISKYPGLTNSLLSISAPRKICDTLKSADPIPNEFGKRG 431

>KAFR0A06130 Chr1 (1241576..1244461) [2886 bp, 961 aa] {ON}
           Anc_4.221 YLR373C
          Length = 961

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 3/70 (4%)

Query: 68  EWTRID--SKGNNSIWSHFLEGKKDRSILKCTNCNNVY-RYNRREARYNSEPAELHLRDD 124
           +W  I   +K  ++ W+HFL   K   ++KC +C  +  R N    + +++  + HLR  
Sbjct: 55  QWVPIHLLNKNRSNCWTHFLGVTKRLEMVKCKHCGTIIERSNNPNEKSSNKKFQRHLRKH 114

Query: 125 CTNPPDYFHG 134
             +P   ++G
Sbjct: 115 KIDPSVNYYG 124

>NCAS0A09880 Chr1 complement(1975537..1978155) [2619 bp, 872 aa]
           {ON} 
          Length = 872

 Score = 32.7 bits (73), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 41/95 (43%), Gaps = 17/95 (17%)

Query: 338 VGMSTDNAANMLKVPKELSRTGLLGTRFLGHVPCLLHSANIMNSTMFDMV--EE--DSLG 393
           V   TDNA+ +L    EL+        + GH+ CL H  N++  ++   V  EE  D L 
Sbjct: 369 VNTCTDNASAVLHCTSELASDENYAV-YAGHISCLCHILNLVCESVIRCVSSEEGVDELL 427

Query: 394 FVDSELKSKLLELAAMKYQLNSDGSRNEILKQDIF 428
            +D EL S             SD   +E +  DIF
Sbjct: 428 EMDDELLS------------GSDEEEDEFINADIF 450

>ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} similar
           to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
           ATP binding cassette (ABC) transporter of the plasma
           membrane general stress response factor implicated in
           cellular detoxification target of Pdr1p Pdr3p and Pdr8p
           transcription regulators promoter contains a PDR
           responsive element
          Length = 1462

 Score = 32.3 bits (72), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 726 DLQEQIRLELEQYRLRALSLVKEYSNEVLSKSKKRWSPFDRQVQM 770
           DLQEQI+  L+Q     L  +KE  N   SK  +R SP+     M
Sbjct: 406 DLQEQIQNRLDQNHEEGLRAIKESHNAAQSKRTRRSSPYTVSYGM 450

>KLTH0G09240g Chr7 complement(764752..766188) [1437 bp, 478 aa] {ON}
           conserved hypothetical protein
          Length = 478

 Score = 32.0 bits (71), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 82/194 (42%), Gaps = 26/194 (13%)

Query: 79  SIWSHFLEGKKDRSILKCTNCNNVYRYNRREARYNSEPAELHLRDDCTNPPDYFHGNLKD 138
           +IWS+  E K    IL  +  +   +    E +++      +L  DC   P   HG +K 
Sbjct: 272 TIWSYNREQKGSTIILTLSLTDEQSKCGENEYQFSV--ISRYLPYDCFGRP---HGAVKK 326

Query: 139 E--RIIKEICKKKLDKYRDL---KQYIKTQSFFDIAVGLILESRLSINWVESFTAKTLWS 193
           +  R+ +E+ ++K  +  D    + ++ +  +F + V  +L      N  ++ T +T  S
Sbjct: 327 KLNRVQEELEREKETRKGDTYCWRHFLTSFEYFKL-VSFMLGKEYDFNLNDNQTGETRGS 385

Query: 194 TMALIPTENNSKPEQIFKPNKSNMSNFIRTKSKDINYFWRSEIASSAHILNEKTFTNRKT 253
              +I  E                   +RT+S    YF    + S+  +LN++T ++ K+
Sbjct: 386 DGKVISPEKRHD---------------MRTRSHAKIYFEGKAVKSAHELLNDETISSHKS 430

Query: 254 LLVSLTKRLYALDN 267
            +V    ++ A  N
Sbjct: 431 FIVGTFGQIMAYTN 444

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 88,801,389
Number of extensions: 3839931
Number of successful extensions: 11929
Number of sequences better than 10.0: 60
Number of HSP's gapped: 12210
Number of HSP's successfully gapped: 62
Length of query: 867
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 749
Effective length of database: 39,950,811
Effective search space: 29923157439
Effective search space used: 29923157439
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)