Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0A140807.341ON78783926e-51
TDEL0C020607.341ON88842079e-23
ZYRO0F11528g7.341ON121802082e-22
Kwal_YGOB_Anc_7.3417.341ON86842017e-22
KLTH0H01452g7.341ON86841973e-21
SAKL0F10956g7.341ON86821852e-19
Kpol_530.377.341ON88821792e-18
ACL158W7.341ON95841698e-17
Ecym_45207.341ON91841698e-17
KLLA0C16709g7.341ON79721671e-16
NDAI0A019507.341ON122901673e-16
TPHA0F029107.341ON1081001655e-16
TBLA0E004707.341ON1161011594e-15
KNAG0C038107.341ON82761513e-14
CAGL0I03432g7.341ON149821511e-13
KAFR0B009007.341ON78791434e-13
Suva_4.847.341ON81821411e-12
YDL160C-A (MHF2)7.341ON80801271e-10
Skud_4.957.341ON79791235e-10
Smik_4.767.341ON80801202e-09
KAFR0K005007.38ON27541602.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0A14080
         (78 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}              155   6e-51
TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}...    84   9e-23
ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some si...    85   2e-22
Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON} ...    82   7e-22
KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON...    80   3e-21
SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON...    76   2e-19
Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON} c...    74   2e-18
ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolo...    70   8e-17
Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar t...    70   8e-17
KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conser...    69   1e-16
NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.34...    69   3e-16
TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.34...    68   5e-16
TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341 ...    66   4e-15
KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}...    63   3e-14
CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {O...    63   1e-13
KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}...    60   4e-13
Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON} Y...    59   1e-12
YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}  ...    54   1e-10
Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON} Y...    52   5e-10
Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON} Y...    51   2e-09
KAFR0K00500 Chr11 complement(105567..106394) [828 bp, 275 aa] {O...    28   2.3  

>NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}
          Length = 78

 Score =  155 bits (392), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%)

Query: 1  MAIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKELGQTDI 60
          MAIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKELGQTDI
Sbjct: 1  MAIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKELGQTDI 60

Query: 61 VIDEKDLERVVGLLLLDM 78
          VIDEKDLERVVGLLLLDM
Sbjct: 61 VIDEKDLERVVGLLLLDM 78

>TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 88

 Score = 84.3 bits (207), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 8/84 (9%)

Query: 3  IPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEK--------E 54
          IPKETIA+  Q+ AFEN  T +T+ET+ M+Q+YME+F+REA+ RS  NKE+        +
Sbjct: 5  IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQ 64

Query: 55 LGQTDIVIDEKDLERVVGLLLLDM 78
              +IV+  +DLE + GLLLLDM
Sbjct: 65 RNSNEIVLTHEDLENITGLLLLDM 88

>ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some
           similarities with uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160C-A Identified by homology to Ashbya
           gossypii
          Length = 121

 Score = 84.7 bits (208), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 62/80 (77%), Gaps = 4/80 (5%)

Query: 3   IPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKELGQTD--- 59
           +PKETI +IL+L+AFE+  T +TEET++M+Q+Y+E+F+REA+ RS+ NK+ +    D   
Sbjct: 42  VPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKDSQGSHGDGDG 101

Query: 60  -IVIDEKDLERVVGLLLLDM 78
            I ++ +DLE++ G+LLLDM
Sbjct: 102 EIQLNHEDLEKITGMLLLDM 121

>Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 86

 Score = 82.0 bits (201), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 63/84 (75%), Gaps = 8/84 (9%)

Query: 2  AIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEK-------E 54
          ++PK+TIA+I Q  +F+N  T++TE TL+++  Y+E+F+REA+ RS++NK++       +
Sbjct: 4  SVPKDTIARIFQTCSFQNDSTRITETTLTLVDEYLEIFVREAILRSIENKDQVKDEHQDQ 63

Query: 55 LGQTDIVIDEKDLERVVGLLLLDM 78
          LG + +V+  KDLERV GLLLLDM
Sbjct: 64 LG-SQVVLTHKDLERVSGLLLLDM 86

>KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON}
          weakly similar to uniprot|Q3E829 Saccharomyces
          cerevisiae YDL160c-a
          Length = 86

 Score = 80.5 bits (197), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 41/84 (48%), Positives = 61/84 (72%), Gaps = 8/84 (9%)

Query: 2  AIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEK-------E 54
          +IP +TIA+I Q  +F++  T++TE TLS++  Y+E+F+REA+ RS++NKE+       +
Sbjct: 4  SIPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQ 63

Query: 55 LGQTDIVIDEKDLERVVGLLLLDM 78
          LG   +V+  KDLERV GLLLLDM
Sbjct: 64 LGD-QVVLTHKDLERVSGLLLLDM 86

>SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON}
          similar to uniprot|Q3E829 Saccharomyces cerevisiae
          YDL160C-A Putative protein of unknown function
          Length = 86

 Score = 75.9 bits (185), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 59/82 (71%), Gaps = 5/82 (6%)

Query: 2  AIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKELGQTD-- 59
          ++PK+TIA+I Q  +F    T++TE+T+++  +Y+ELF+REA+ RSL+NKEK   +T+  
Sbjct: 5  SLPKDTIARIFQTCSFTQDSTRITEDTVALTNKYIELFVREAVLRSLENKEKVKPETESL 64

Query: 60 ---IVIDEKDLERVVGLLLLDM 78
              V+  +DLE + GLLLLDM
Sbjct: 65 DNGTVLSHEDLEEISGLLLLDM 86

>Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON}
          complement(86462..86728) [267 nt, 89 aa]
          Length = 88

 Score = 73.6 bits (179), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 59/82 (71%), Gaps = 5/82 (6%)

Query: 2  AIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNK---EKELGQT 58
           IPKETIA++L+  +FE++ T++TE+ +  +Q+YMELF+REA+ RS++ K   E+E   T
Sbjct: 6  PIPKETIARLLETSSFEHSSTRITEDVVEGLQKYMELFVREAIMRSIETKAKLEEENSFT 65

Query: 59 DIVID--EKDLERVVGLLLLDM 78
           + ++    DLE + GLLLLDM
Sbjct: 66 GVRVELTHTDLEEIAGLLLLDM 87

>ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolog
          of Saccharomyces cerevisiae YDL161CX; YDL161CX was
          overlooked in Saccharomyces cerevisiae
          Length = 95

 Score = 69.7 bits (169), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 55/84 (65%), Gaps = 7/84 (8%)

Query: 2  AIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKELGQT--- 58
          AIP +TIA++    +F    TK+TE+ +++++RYM+LFIREA+ RSL+NKEK   +T   
Sbjct: 12 AIPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRAD 71

Query: 59 ----DIVIDEKDLERVVGLLLLDM 78
                V+   DLE + G+L+LD 
Sbjct: 72 SFAEGPVLQHTDLEEISGVLILDF 95

>Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar to
          Ashbya gossypii ACL158W
          Length = 91

 Score = 69.7 bits (169), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 58/84 (69%), Gaps = 7/84 (8%)

Query: 2  AIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKE---KELGQT 58
           +P +TIA+I QL +F    T++TE+T+++ ++Y++LF+REA+ RSL+NK+   KE G+ 
Sbjct: 8  VVPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVKKEDGKG 67

Query: 59 DI----VIDEKDLERVVGLLLLDM 78
           +    V+   DLE + G+LLLD 
Sbjct: 68 SLIEGPVLHHTDLEEISGILLLDF 91

>KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON}
          conserved hypothetical protein
          Length = 79

 Score = 68.9 bits (167), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 52/72 (72%), Gaps = 2/72 (2%)

Query: 7  TIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKELGQTDIVIDEKD 66
          TIA+ILQ E F++++T++TEE + +++ Y+ELF+RE + RSL+NK   L   D  +D  D
Sbjct: 9  TIARILQTEGFQDSNTRITEECMQLLEPYIELFVREGVLRSLENKADMLA--DKTVDFVD 66

Query: 67 LERVVGLLLLDM 78
          LE V GLLL+D 
Sbjct: 67 LEAVAGLLLMDF 78

>NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 122

 Score = 68.9 bits (167), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 58/90 (64%), Gaps = 12/90 (13%)

Query: 1   MAIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNK--------- 51
           M I  ETI +IL+ E+F+N DT +T+ET+ MIQRYM+LFI+EA+ RS +NK         
Sbjct: 33  MTILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVEDFD 92

Query: 52  ---EKELGQTDIVIDEKDLERVVGLLLLDM 78
              + +     I +   DLER+VGLLL+++
Sbjct: 93  DEEDADEEDKTIELTHLDLERIVGLLLMEL 122

>TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 108

 Score = 68.2 bits (165), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 60/100 (60%), Gaps = 24/100 (24%)

Query: 2   AIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKELGQ---- 57
            IPK+TIA+ILQLE+F   +T+++ E++ ++Q+YMELF+REA+ RS++N+E++       
Sbjct: 9   PIPKDTIARILQLESF-GEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEAL 67

Query: 58  -------------------TDIVIDEKDLERVVGLLLLDM 78
                                I +  +DLE + GLLLLDM
Sbjct: 68  KKAPAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107

>TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 116

 Score = 65.9 bits (159), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 58/101 (57%), Gaps = 25/101 (24%)

Query: 3   IPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKELGQ----- 57
           +P+ TIA+ILQ  +F + +T++T+ T++ +Q+YMELFIREA  RSL+NKE+++       
Sbjct: 16  LPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAV 75

Query: 58  --------------------TDIVIDEKDLERVVGLLLLDM 78
                                DI +  + LE + GLLLLDM
Sbjct: 76  KNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116

>KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 82

 Score = 62.8 bits (151), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 56/76 (73%), Gaps = 3/76 (3%)

Query: 3  IPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKELGQTDIVI 62
          I +ET+++IL  ++F+N  T + ++ L+ +Q+Y+E +++E + RSL+N  K+LG     +
Sbjct: 9  ISRETLSRILT-QSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLEN--KDLGVNPAEL 65

Query: 63 DEKDLERVVGLLLLDM 78
           E+D+ER++GLLLLDM
Sbjct: 66 TERDIERILGLLLLDM 81

>CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {ON}
           some similarities with KLLA0C16709g Kluyveromyces lactis
           and DEHA0G05016g Debaryomyces hansenii and CA5994|IPF677
           Candida albicans
          Length = 149

 Score = 62.8 bits (151), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 55/82 (67%), Gaps = 4/82 (4%)

Query: 1   MAIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSL---DNKEKELGQ 57
           M +P++TIA++LQ+ AF++  T++  + +  +QRY+++F REA+ RS+   D  ++ L Q
Sbjct: 68  MDVPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQ 127

Query: 58  -TDIVIDEKDLERVVGLLLLDM 78
             D  I   DLE + GLLLLDM
Sbjct: 128 EQDKEITHTDLENIAGLLLLDM 149

>KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 78

 Score = 59.7 bits (143), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 52/79 (65%), Gaps = 2/79 (2%)

Query: 1  MAIPKETIAQILQLEAFENADT-KMTEETLSMIQRYMELFIREAMCRSLDNKEKELGQTD 59
          M+IPKETI++IL  +  EN +   +  ET+  + +Y ++ I E + RSL+NKE  + +  
Sbjct: 1  MSIPKETISRILLNKLNENGENFSINTETVESVTKYTDVLIEEMVLRSLENKEN-IAEAT 59

Query: 60 IVIDEKDLERVVGLLLLDM 78
            +D  DLE+++GLLLLDM
Sbjct: 60 PTLDVDDLEKIIGLLLLDM 78

>Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON}
          YDL160C-A (REAL)
          Length = 81

 Score = 58.9 bits (141), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 5/82 (6%)

Query: 1  MAIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKELGQTD- 59
          M +PKE I +IL  +   + + K+ ++ + MIQ+Y+E+FI EA  RSL + +   G  D 
Sbjct: 1  MILPKEAIIKILS-QNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDG 59

Query: 60 ---IVIDEKDLERVVGLLLLDM 78
             + +   DLER+VGLLL+DM
Sbjct: 60 DGPLELSHLDLERIVGLLLMDM 81

>YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}
          MHF2Protein of unknown function; ortholog of human
          MHF2, and component of the heterotetrameric MHF
          histone-fold complex that in humans interacts with both
          DNA and Mph1p ortholog FANCM to stabilize and remodel
          blocked replication forks and repair damaged DNA; mhf2
          srs2 double mutants are MMS hypersensitive
          Length = 80

 Score = 53.5 bits (127), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 51/80 (63%), Gaps = 5/80 (6%)

Query: 3  IPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKELG----QT 58
          + KE + +IL      N D K+ +E + MIQ+Y+++FI EA+ RSL + +   G    ++
Sbjct: 2  LSKEALIKILSQNEGGN-DMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKS 60

Query: 59 DIVIDEKDLERVVGLLLLDM 78
           + +  +DLER+VGLLL+DM
Sbjct: 61 PLELSHQDLERIVGLLLMDM 80

>Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON}
          YDL160C-A (REAL)
          Length = 79

 Score = 52.0 bits (123), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 48/79 (60%), Gaps = 4/79 (5%)

Query: 3  IPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDN-KEKELGQTD-- 59
          + K+ + +IL    F   D K+ ++ L MIQ Y+++FI EA  RSL + K+   G  D  
Sbjct: 2  LSKDALIKILSQNNFRK-DIKIDDKVLPMIQNYLDIFIEEAALRSLQSQKDASGGHRDGP 60

Query: 60 IVIDEKDLERVVGLLLLDM 78
          + +   DLER+VGLLL+DM
Sbjct: 61 LELSHLDLERIVGLLLMDM 79

>Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON}
          YDL160C-A (REAL)
          Length = 80

 Score = 50.8 bits (120), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 51/80 (63%), Gaps = 5/80 (6%)

Query: 3  IPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKE---KELGQTD 59
          + KE + +IL        D ++++E + MIQ+Y+++FI EA  RSL + +   KE  + D
Sbjct: 2  LSKEALVKILSQNNC-GKDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKD 60

Query: 60 IV-IDEKDLERVVGLLLLDM 78
           + +  +DLERVVG+LL+DM
Sbjct: 61 PLELSHQDLERVVGVLLMDM 80

>KAFR0K00500 Chr11 complement(105567..106394) [828 bp, 275 aa] {ON}
           Anc_7.38 YAL039C
          Length = 275

 Score = 27.7 bits (60), Expect = 2.3,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 14  LEAFENADTKMTEETLSMIQRYMEL--FIREAMCRSLDNKE 52
           L+ F NA  +M   TLSM+Q+Y+     +++   +S DN +
Sbjct: 232 LDNFVNAKDRMDAFTLSMLQKYVHSSKMLKDGSVKSNDNNQ 272

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,216,304
Number of extensions: 240374
Number of successful extensions: 950
Number of sequences better than 10.0: 23
Number of HSP's gapped: 929
Number of HSP's successfully gapped: 23
Length of query: 78
Length of database: 53,481,399
Length adjustment: 50
Effective length of query: 28
Effective length of database: 47,748,099
Effective search space: 1336946772
Effective search space used: 1336946772
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)