Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0A092101.319ON71071036890.0
NDAI0G057501.319ON73472518470.0
Suva_6.1371.319ON71873013930.0
Skud_10.1581.319ON71672413481e-177
YJL061W (NUP82)1.319ON71372513231e-173
Smik_10.1791.319ON71372613101e-171
ZYRO0G20680g1.319ON69270612781e-166
KAFR0A017201.319ON71666412611e-164
TDEL0D018801.319ON69171712301e-159
KNAG0C058401.319ON74772810901e-138
TBLA0F013101.319ON74273110381e-130
SAKL0D06930g1.319ON69071510181e-128
Kpol_1035.241.319ON71771710001e-125
TPHA0O014601.319ON7217278341e-100
Kwal_14.25801.319ON6877197939e-95
CAGL0J05214g1.319ON7167007722e-91
KLTH0H10692g1.319ON6917217562e-89
Ecym_62901.319ON6717126783e-78
AEL168C1.319ON6737066713e-77
KLLA0F01661g1.319ON6876754131e-41
Skud_4.1742.388ON10625790.12
SAKL0H15378g8.331ON3729143860.15
NCAS0D011902.388ON10725720.96
NDAI0H001704.4ON62876761.5
AAL030C1.389ON153963771.6
Smik_4.1552.388ON10626701.7
Kpol_1024.91.360ON226546762.1
Skud_13.614.351ON125345752.3
Ecym_53454.238ON1366148733.9
Kpol_2002.1045.209ON70983725.5
YDL081C (RPP1A)2.388ON10625667.2
KLLA0B06798g3.245ON663114708.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0A09210
         (710 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa] ...  1425   0.0  
NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON} Anc_1...   716   0.0  
Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON...   541   0.0  
Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {...   523   e-177
YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Link...   514   e-173
Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061...   509   e-171
ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]...   496   e-166
KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {O...   490   e-164
TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.3...   478   e-159
KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON} Anc_1...   424   e-138
TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {O...   404   e-130
SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {...   396   e-128
Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {O...   389   e-125
TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {...   325   e-100
Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {O...   310   9e-95
CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa] ...   301   2e-91
KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {...   295   2e-89
Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar t...   265   3e-78
AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON} S...   263   3e-77
KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {...   163   1e-41
Skud_4.174 Chr4 complement(305312..305632) [321 bp, 106 aa] {ON}...    35   0.12 
SAKL0H15378g Chr8 complement(1328983..1340172) [11190 bp, 3729 a...    38   0.15 
NCAS0D01190 Chr4 complement(217410..217733) [324 bp, 107 aa] {ON...    32   0.96 
NDAI0H00170 Chr8 complement(16146..18032) [1887 bp, 628 aa] {ON}...    34   1.5  
AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON} ...    34   1.6  
Smik_4.155 Chr4 complement(286254..286574) [321 bp, 106 aa] {ON}...    32   1.7  
Kpol_1024.9 s1024 complement(34561..41358) [6798 bp, 2265 aa] {O...    34   2.1  
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    33   2.3  
Ecym_5345 Chr5 complement(699527..703627) [4101 bp, 1366 aa] {ON...    33   3.9  
Kpol_2002.104 s2002 complement(246226..248355) [2130 bp, 709 aa]...    32   5.5  
YDL081C Chr4 complement(309802..310122) [321 bp, 106 aa] {ON}  R...    30   7.2  
KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} simila...    32   8.8  

>NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa]
           {ON} Anc_1.319 YJL061W
          Length = 710

 Score = 1425 bits (3689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 691/710 (97%), Positives = 691/710 (97%)

Query: 1   MSNIDSIASHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTID 60
           MSNIDSIASHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTID
Sbjct: 1   MSNIDSIASHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTID 60

Query: 61  FFQPESTAPQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDD 120
           FFQPESTAPQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDD
Sbjct: 61  FFQPESTAPQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDD 120

Query: 121 GYSPIKQVLFHPEAYKDSCLVVLYDNGTISLMDVTQITKTITLNKRVATFGIDTQITDIE 180
           GYSPIKQVLFHPEAYKDSCLVVLYDNGTISLMDVTQITKTITLNKRVATFGIDTQITDIE
Sbjct: 121 GYSPIKQVLFHPEAYKDSCLVVLYDNGTISLMDVTQITKTITLNKRVATFGIDTQITDIE 180

Query: 181 SICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTDR 240
           SICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTDR
Sbjct: 181 SICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTDR 240

Query: 241 DVKRNVIRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYRLIRGQGPFTIDPYPERLYSAT 300
           DVKRNVIRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYRLIRGQGPFTIDPYPERLYSAT
Sbjct: 241 DVKRNVIRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYRLIRGQGPFTIDPYPERLYSAT 300

Query: 301 ALEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELMQLKDT 360
           ALEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELMQLKDT
Sbjct: 301 ALEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELMQLKDT 360

Query: 361 DVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSKLDFFE 420
           DVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSKLDFFE
Sbjct: 361 DVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSKLDFFE 420

Query: 421 TTNGITKCSPCKWRGRDVILFITKEDVYMHPVEMRKSGILGNNKPVLVNNEELKHQEYKT 480
           TTNGITKCSPCKWRGRDVILFITKEDVYMHPVEMRKSGILGNNKPVLVNNEELKHQEYKT
Sbjct: 421 TTNGITKCSPCKWRGRDVILFITKEDVYMHPVEMRKSGILGNNKPVLVNNEELKHQEYKT 480

Query: 481 SFKQPVEELMALNKLFQQQCSMGVSKLIAPXXXXXXXXXXXXXXXXXXXSDVSKEVISKI 540
           SFKQPVEELMALNKLFQQQCSMGVSKLIAP                   SDVSKEVISKI
Sbjct: 481 SFKQPVEELMALNKLFQQQCSMGVSKLIAPEERQVLLNNENNEVQLELLSDVSKEVISKI 540

Query: 541 GQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTSRSSQLI 600
           GQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTSRSSQLI
Sbjct: 541 GQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTSRSSQLI 600

Query: 601 KRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRDAQEELNHLK 660
           KRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRDAQEELNHLK
Sbjct: 601 KRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRDAQEELNHLK 660

Query: 661 KDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKELLSTTEAL 710
           KDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKELLSTTEAL
Sbjct: 661 KDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKELLSTTEAL 710

>NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON}
           Anc_1.319 YJL061W
          Length = 734

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/725 (49%), Positives = 487/725 (67%), Gaps = 17/725 (2%)

Query: 3   NIDSIASHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTIDFF 62
           N   IASHPIF     T + + RF FTSH GTRMV+LQG +L+WC+V  ++++SM +   
Sbjct: 4   NFSPIASHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTTYHSMKVKSI 63

Query: 63  QPESTAPQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYN----NKD 118
                      LS SG+F+C+YT  TI+++EIPWGY      ++SKFQ F Y+       
Sbjct: 64  FNNKRKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPDELLSKFQPFHYDISSSTSA 123

Query: 119 DDGYSPIKQVLFHPEAYKDSCLVVLYDNGTISLMDVTQITKTITLNKRVATFGIDTQITD 178
               S IKQVLFHP++Y ++CLV+LY++  I L+D T  T+TIT+N+   T G++T++ D
Sbjct: 124 LSSPSDIKQVLFHPKSYHETCLVILYEDSIIQLIDTTASTETITINQPTGTLGVETRVID 183

Query: 179 IESICFSKD-GWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLD 237
           IESICF K  G  LYALSISDGGDIYA YPCLP +L+V ++++  LL +S++LY+SLK +
Sbjct: 184 IESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKEN 243

Query: 238 TDRDVKRNVIRQVQFVNKLNGLLTENEKNSNED------------FIEIEQEYRLIRGQG 285
              DVKRNVI+Q+QF  KL G   E  K   ++             ++++ EYRL+  QG
Sbjct: 244 MSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVNFQG 303

Query: 286 PFTIDPYPERLYSATALEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVH 345
           PFTI P+P  LYSATA E   + IN NNEL+ M FDDGS+ALLF+DL LTMSWD+ NY+H
Sbjct: 304 PFTISPFPNELYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWDIANYIH 363

Query: 346 NNSFSLVELMQLKDTDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLN 405
           +NSF+LVEL++LK TD+ R++ Y D +G+FF+  D  + LVHT+ WSD LAKAID+SNLN
Sbjct: 364 DNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDDSNLN 423

Query: 406 ELLEMNFTSKLDFFETTNGITKCSPCKWRGRDVILFITKEDVYMHPVEMRKSGILGNNKP 465
            L E+ F S++ +F+       C+PCK+ G++ I+F++ ++V++  +  + S        
Sbjct: 424 ILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNIKGSS 483

Query: 466 VLVNNEELKHQEYKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPXXXXXXXXXXXXXXX 525
              +NEE    EYK +FKQP++ELM LN+LFQ+QC M  SKLI P               
Sbjct: 484 TSNSNEETAESEYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNESNEIQ 543

Query: 526 XXXXSDVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQ 585
               +D+SKE+I+KI  GQ L  NLH+RL EQQ ELTRQLK    +  KQ  ++ K++E 
Sbjct: 544 LEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKNKNKEI 603

Query: 586 SRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSF 645
            +RW++Q +RS +L  RLQ+L+ K++ IN+SP L  YPI   ELEWFKEIRNQV KFNSF
Sbjct: 604 LKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVHKFNSF 663

Query: 646 VHNQRDAQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKELLS 705
           VH QRDA EEL+ LKK+L RIS + + + DEKS KEW+ELR IL+ D++II+ECN EL  
Sbjct: 664 VHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECNIELTK 723

Query: 706 TTEAL 710
           TTE++
Sbjct: 724 TTESM 728

>Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON}
           YJL061W (REAL)
          Length = 718

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/730 (39%), Positives = 459/730 (62%), Gaps = 37/730 (5%)

Query: 1   MSNIDSIASHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSV-TASSFNSMTI 59
           M   DS+A+ PIFQ    + + +PR++F+SH+GTR+VV+Q  ++RWCS+ T  S++S+  
Sbjct: 1   MPQSDSLAALPIFQA-SLSANQSPRYIFSSHNGTRLVVIQDDIIRWCSLLTDPSYHSLNF 59

Query: 60  -------DFFQPESTAPQKAILSNSGEFICVYTNHTIEVIEIPWGYVT-PSPSMVSKFQL 111
                  D F         AI S SG+ +C Y++  I V+EIPWGY+     S+   FQ+
Sbjct: 60  SRHLVLDDTFH--------AISSASGDLLCFYSDQEIFVMEIPWGYLNLGDVSIQDAFQV 111

Query: 112 FSYNNKDDD--GYSPIKQVLFHPEAYKDSCLVVLYDNGTISLMDV-TQITKTITLNKRVA 168
           F Y+  + +    SPIK+VLFHP++Y DSC+VVL ++ TI++ D+  Q    I LNKR +
Sbjct: 112 FHYSVDELELGSNSPIKKVLFHPKSYNDSCIVVLKNDDTITMFDILNQQEAPIILNKRNS 171

Query: 169 TFGIDTQITDIESICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESV 228
           +FG+D ++ DI    FSKDG TLY L+ ++GGDI+AFYP LP  L +  + +  +L++S+
Sbjct: 172 SFGLDARVNDITDFAFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLSLSEKDLGWILNKSL 231

Query: 229 LLYESLKLDTDRDVKRNVIRQVQFVNKLNGLLTENEKNSNEDF--IEIEQEYRLIRGQGP 286
           ++YESL   TD  VKRN+ +Q+QFV+KL+       KN +     ++I+ EYRL++ QGP
Sbjct: 232 VMYESLNATTDYKVKRNITKQLQFVSKLH-------KNWDSKLAKVKIDDEYRLVKMQGP 284

Query: 287 FTIDPYPERLYSATALEISTLPI-NSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVH 345
           FTI+P+P  LY  TA +I+T+PI N  NE++C+ FDDGS+ +LF+DL ++MSWDVDNYV+
Sbjct: 285 FTINPFPNELYDFTASKITTIPIDNQQNEIVCVSFDDGSLIILFQDLEMSMSWDVDNYVY 344

Query: 346 NNSFSLVELMQLKDTDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLN 405
           NNS  L+E ++L+  ++K + + PD  G+ ++  +SS+  +    W+ +L+K ID S+LN
Sbjct: 345 NNSLILIERIKLQQKEMKSLTALPDQLGKLYVTLESSVHQLDCTSWTSVLSKCIDESDLN 404

Query: 406 ELLEMNFTSKLDFFETTNGITKCSPCKWRGRDVILFITKEDVYMHPVEMRKSGILGNNKP 465
            L ++ F SK +   T + ++  +   W  +  +  I+KE + +  +   K     N   
Sbjct: 405 ALADVKFVSKFEDIATIHQLSNFAYINWNDKSSLALISKEKLTIQNISNHKKEQSLNAPA 464

Query: 466 VLVNN-----EELKHQEYKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPXXXXXXXXXX 520
            L  N      +   + Y+ SF QP+ E+++LN+ FQ+ C     ++I P          
Sbjct: 465 ELDTNVNSDKSDTGKRGYEISFTQPINEILSLNESFQKVCLSPCERIIPPADRQLPLKNE 524

Query: 521 XXXXXXXXXSDVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRR 580
                    +D+SKE + KI + Q+L +++++R+ EQQ+ELTRQL+    I++K   L++
Sbjct: 525 ANENQLEIFTDISKEFLRKIIKAQSLGVSIYNRIHEQQFELTRQLQSTSKIIAKDEILQK 584

Query: 581 KSEEQSRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVL 640
           K E Q+ +W+ Q+SR ++L+ R   L   + ++  S K KE  I+  E+EWFKEIRNQ+L
Sbjct: 585 KLEAQTEKWNSQSSRQAELMTRFGKLTENLSKVAESDKFKEQNISHGEMEWFKEIRNQIL 644

Query: 641 KFNSFVHNQRDAQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECN 700
           +FN FVH+Q+  Q++L++LK++L RI  ET    D+KS  EWDELR +L+ D++II+ECN
Sbjct: 645 QFNGFVHSQKSIQQDLSYLKRELIRIESETIN-ADKKSQNEWDELRKMLEVDSKIIKECN 703

Query: 701 KELLSTTEAL 710
           +EL+  ++ L
Sbjct: 704 EELVHVSQQL 713

>Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {ON}
           YJL061W (REAL)
          Length = 716

 Score =  523 bits (1348), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 286/724 (39%), Positives = 462/724 (63%), Gaps = 30/724 (4%)

Query: 1   MSNIDSIASHPIFQG-LDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWC-SVTASSFNSMT 58
           MS  +S+ + PIFQ  L  +Q  +P ++F+SH+GTR+V +Q  ++RWC S+T SS+ S+ 
Sbjct: 1   MSKSNSLVALPIFQASLSASQ--SPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSL- 57

Query: 59  IDFFQP---ESTAPQKAILSNSGEFICVYTNHTIEVIEIPWGYVT-PSPSMVSKFQLFSY 114
            DF +    + T   + I S SG+ +  +    I V+E+PWGY      S+   FQLF Y
Sbjct: 58  -DFSRHLILDDTF--RVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHY 114

Query: 115 N--NKDDDGYSPIKQVLFHPEAYKDSCLVVLYDNGTISLMDV-TQITKTITLNKRVATFG 171
           +    ++   S IK+VLFHP++Y DSC+VVL ++ TI++ D+  Q  K I LNKR  +FG
Sbjct: 115 SVGQVENGSRSLIKKVLFHPKSYHDSCIVVLKEDDTITMFDILNQQHKPIVLNKRSNSFG 174

Query: 172 IDTQITDIESICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLY 231
           +D ++ DI  + FS+DG TLY L+ ++GGD++AFYP LP  L +  + +  +L++S+++Y
Sbjct: 175 LDARVNDITDLAFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMY 234

Query: 232 ESLKLDTDRDVKRNVIRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYRLIRGQGPFTIDP 291
           ESL   TD  VKRN+I+Q+Q V+KL+  L     +S    +EI++EYRL++ QGPFTI+P
Sbjct: 235 ESLDSTTDITVKRNIIKQLQLVSKLHENL-----DSQLGKVEIDEEYRLVKMQGPFTINP 289

Query: 292 YPERLYSATALEISTLPI-NSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFS 350
           +P+ LY  TA  I+T+PI N  NE++C+ FDDGS+ LLF+DL ++MSWDVDNYVHNNS  
Sbjct: 290 FPDELYEYTAANITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLV 349

Query: 351 LVELMQLKDTDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNELLEM 410
           L+E +++++TD+K + + P+  G+ ++F ++S+  + +  WS +L++ I+ S+LN L ++
Sbjct: 350 LIERIKIQETDIKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDV 409

Query: 411 NFTSKLDFFETTNGITKCSPCKWRGRDVILFITKEDVYMHPV----EMRKSGILGNNKPV 466
            F SKL+   T    +  +   W     ++   +  +    +    E++ +    NNK  
Sbjct: 410 KFESKLENIVTIEHPSNLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSD 469

Query: 467 LVNNEELKHQEYKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPXXXXXXXXXXXXXXXX 526
            ++      + Y+ SF QP+ E+++LN+ FQ+ C     K+I P                
Sbjct: 470 RID----AGKHYEMSFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQL 525

Query: 527 XXXSDVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQS 586
              + +SKE + KI + Q+L  ++++R+ EQQ+ELTRQL+    I+SK +DL+ K   Q+
Sbjct: 526 EIFTGISKEFLQKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQN 585

Query: 587 RRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFV 646
           ++WD Q SR  +L++R + L   + +I  S KL+E  IN  E++WFKEIRNQ+L+FN+FV
Sbjct: 586 KKWDAQVSRQVKLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFV 645

Query: 647 HNQRDAQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKELLST 706
            +Q+  Q++L+++KK+L RI  ET +  DEK+  EWDELR +L+ D++II+ECN+EL+  
Sbjct: 646 RSQKSLQQDLSYMKKELTRIEAETIK-TDEKTQNEWDELRKMLEEDSKIIKECNEELMHV 704

Query: 707 TEAL 710
           ++ L
Sbjct: 705 SQQL 708

>YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Linker
           nucleoporin component of the nuclear pore complex (NPC);
           also part of the NPC cytoplasmic filaments; contributes
           to nucleocytoplasmic transport and NPC biogenesis; forms
           stable associations with three FG-nucleoporins (Nsp1p,
           Nup159p, and Nup116p)
          Length = 713

 Score =  514 bits (1323), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 283/725 (39%), Positives = 448/725 (61%), Gaps = 36/725 (4%)

Query: 1   MSNIDSIASHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSV-TASSFNSMTI 59
           MS    +++ PIFQ    +   +PR++F+S +GTR+V +Q  ++RW +V T S ++S+  
Sbjct: 1   MSQSSRLSALPIFQA-SLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNF 59

Query: 60  -------DFFQPESTAPQKAILSNSGEFICVYTNHTIEVIEIPWGYV-TPSPSMVSKFQL 111
                  D F          I S SG+ +C++ ++ I V+E+PWGY      S+   FQ+
Sbjct: 60  SRHLVLDDTFH--------VISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQI 111

Query: 112 FSYNNKDDD--GYSPIKQVLFHPEAYKDSCLVVLYDNGTISLMDV-TQITKTITLNKRVA 168
           F Y+  +++    S IK+VLFHP++Y+DSC+VVL ++ TI++ D+     K I LNK   
Sbjct: 112 FHYSIDEEEVGPKSSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPIVLNKPNN 171

Query: 169 TFGIDTQITDIESICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESV 228
           +FG+D ++ DI  + FSKDG TLY L+ ++GGDI+AFYP LP  L +  + +  +L++S+
Sbjct: 172 SFGLDARVNDITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSL 231

Query: 229 LLYESLKLDTDRDVKRNVIRQVQFVNKLNGLLTENEKNSNEDF--IEIEQEYRLIRGQGP 286
           ++YESL   TD  VKRNVI+Q+QFV+KL+       +N N  F  ++I++EYRL + QGP
Sbjct: 232 VMYESLDSTTDVIVKRNVIKQLQFVSKLH-------ENWNSRFGKVDIQKEYRLAKVQGP 284

Query: 287 FTIDPYPERLYSATALEISTLPI-NSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVH 345
           FTI+P+P  LY  TA  I+T+ I N  NE++C+ FDDGS+ LLFKDL ++MSWDVDNYV+
Sbjct: 285 FTINPFPGELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVY 344

Query: 346 NNSFSLVELMQLKDTDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLN 405
           NNS  L+E ++L+  ++K +++ P+  G+ ++  D+ +  V+   W+  L+K I+ S+LN
Sbjct: 345 NNSLVLIERVKLQ-REIKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLN 403

Query: 406 ELLEMNFTSKLDFFETTNGITKCSPCKWRGRDVILFITKEDVYMHPV--EMRKSGILGNN 463
            L  + F SKL+   T   I   +   W  +  +  ++ + +    +  +M+        
Sbjct: 404 PLAGLKFESKLEDIATIERIPNLAYINWNDQSNLALMSNKTLTFQNISSDMKPQSTAAET 463

Query: 464 KPVLVNNEELKHQEYKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPXXXXXXXXXXXXX 523
             +     +     +K SF QP+ E++ LN  FQ+ C     ++I               
Sbjct: 464 S-ISTEKSDTVGDGFKMSFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASE 522

Query: 524 XXXXXXSDVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSE 583
                 +D+SKE + +I + Q L +++H+R+ EQQ+ELTRQL+    I+SK  DLRRK E
Sbjct: 523 NQLEIFTDISKEFLQRIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFE 582

Query: 584 EQSRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFN 643
            Q+++WD Q SR S+L++R   L  K+ +I  S K KE  I+  E++WFKEIRNQ+L+FN
Sbjct: 583 AQNKKWDAQLSRQSELMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFN 642

Query: 644 SFVHNQRDAQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKEL 703
           SFVH+Q+  Q++L++LK +L RI  ET ++ D+KS  EWDELR +L+ D++II+ECN+EL
Sbjct: 643 SFVHSQKSLQQDLSYLKSELTRIEAETIKV-DKKSQNEWDELRKMLEIDSKIIKECNEEL 701

Query: 704 LSTTE 708
           L  ++
Sbjct: 702 LQVSQ 706

>Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061W
           (REAL)
          Length = 713

 Score =  509 bits (1310), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 281/726 (38%), Positives = 450/726 (61%), Gaps = 34/726 (4%)

Query: 1   MSNIDSIASHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSV-TASSFNSMTI 59
           MS   S+AS PIFQ    +   +PR++FTS +GTR+V +Q  ++RW +V T   ++S+++
Sbjct: 1   MSQSKSLASLPIFQA-SLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSL 59

Query: 60  -------DFFQPESTAPQKAILSNSGEFICVYTNHTIEVIEIPWGYV-TPSPSMVSKFQL 111
                  D F          I S SG+ +C + +  I V+E+PWGY    + S+   FQ+
Sbjct: 60  SRHLVLDDTFH--------VISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQV 111

Query: 112 FSYNNKDDDGYSP---IKQVLFHPEAYKDSCLVVLYDNGTISLMDV-TQITKTITLNKRV 167
           F Y+  D+    P   IK+VLFHP++Y DSC+VVL +N TI + D+  Q  K I LNK  
Sbjct: 112 FHYS-VDETELGPKSLIKKVLFHPKSYHDSCIVVLKENDTIIMFDILNQQEKPIILNKPN 170

Query: 168 ATFGIDTQITDIESICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHES 227
            +FG+D ++ DI  + FSKDG TLY L+ ++GGDI+AFYP LP  L +    ++ +L++S
Sbjct: 171 NSFGLDARLNDITDLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKS 230

Query: 228 VLLYESLKLDTDRDVKRNVIRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYRLIRGQGPF 287
           +++YESL   TD  VKRN+I+Q+QFV+KL+    EN  +S  + ++I+ EYRL++ QGPF
Sbjct: 231 LVMYESLDPTTDVTVKRNIIKQLQFVSKLH----EN-WDSKLNKVDIDSEYRLVKVQGPF 285

Query: 288 TIDPYPERLYSATALEISTLPI-NSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHN 346
           TI+P+P  LY  TA  I+T+ I N  NE+ C+ FDDGS+ LL KDL ++MSWDV NYV+N
Sbjct: 286 TINPFPNELYDYTAKNIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYN 345

Query: 347 NSFSLVELMQLKDTDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNE 406
           +S  L+E ++++  +++ +++ P+  G+ ++F  + ++ V++  W+  ++K I+ S+LN 
Sbjct: 346 DSLVLIERVKMQK-EIESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNP 404

Query: 407 LLEMNFTSKLDFFETTNGITKCSPCKWRGRDVILFITKEDVYMHPVEMRKSGILGNNKPV 466
           L ++ F SK++   T  G+   +   W     +   + +++    V + +  +       
Sbjct: 405 LGDLKFESKIENIATVEGMPNLAHIYWNNTSNLALASNKELTFQTVSVDQK-MQSTETET 463

Query: 467 LVNNEE--LKHQEYKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPXXXXXXXXXXXXXX 524
            +  EE  L    Y+  F QP+ E++ LN+ FQ+ C     ++I                
Sbjct: 464 DIGTEESGLAKCRYELRFTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASEN 523

Query: 525 XXXXXSDVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEE 584
                +DVSKE + KI + Q+L +++++R+ EQQ ELTRQL+    I+SK  DLR+K E 
Sbjct: 524 QLEIFTDVSKEFLQKIAKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEA 583

Query: 585 QSRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNS 644
           Q+++WD Q  R S+L++R   L   + EI+ S K KE  I++ E+EWFKEIRNQ+L+FN 
Sbjct: 584 QNKKWDAQIIRQSKLMERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNC 643

Query: 645 FVHNQRDAQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKELL 704
           +VH+Q+  Q++L++LK++L RI  ET Q+ D+KS  EW+ELR +L+ D++II+ECN+EL 
Sbjct: 644 YVHSQKSLQQDLSYLKRELTRIETETIQV-DKKSQSEWNELRKMLEIDSKIIKECNEELQ 702

Query: 705 STTEAL 710
             ++ L
Sbjct: 703 HASQQL 708

>ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 692

 Score =  496 bits (1278), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 276/706 (39%), Positives = 421/706 (59%), Gaps = 34/706 (4%)

Query: 6   SIASHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTIDFFQPE 65
           SI SH IF+       ++ RFL TS  G+++V+ Q   +RWC+   S +  M     +P 
Sbjct: 2   SIGSHSIFKR---ASGSSKRFLCTSQDGSKVVIYQDSSIRWCNAFDSKYEFM---LLEPT 55

Query: 66  STAPQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDDGYSPI 125
               +  +LS +G  + +Y +  + ++EIPWGY   S     KF+ +S +++ D     I
Sbjct: 56  IEDVEHVVLSPTGTLLLLYNSREVRIVEIPWGYSQVSYEGFQKFR-YSVDSRQD---PLI 111

Query: 126 KQVLFHPEAYKDSCLVVLYDNGTISLMD----VTQITKTITLNKRVATFGIDTQITDIES 181
           K+VLFHP AY++ C+V+L  + TI L+D      +  K + LN+    FG++  +TDIES
Sbjct: 112 KKVLFHPLAYREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIES 171

Query: 182 ICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTDRD 241
           I FS+DG TLYALS+++G DIYAFYPCLP  +E+   K+  L+H+S++ YE+L ++T   
Sbjct: 172 ITFSQDGLTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDA 231

Query: 242 VKRNVIRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYRLIRGQGPFTIDPYPERLYSATA 301
            KRN I+Q QF++KL   L EN++      I+I  ++  +RGQGPFTI P+P+R Y  TA
Sbjct: 232 TKRNTIKQFQFISKLRQGL-ENDQTK----IDIPMDWLRVRGQGPFTIAPFPDRYYDRTA 286

Query: 302 LEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELMQLKDTD 361
           +++  LPI +NN+L+ M FDDG+I +L++DL LTM WD   Y +NNS  LVE ++L+  +
Sbjct: 287 VQLKILPIGANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERGE 346

Query: 362 VKRIVSYPDTYGQFFIFGDSS-LFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSKLDFFE 420
              +V    T  QFF+ G +S ++LV T  WS +L+  IDNS+L  + ++ F S++   E
Sbjct: 347 ---LVLKQGTLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIE 403

Query: 421 TTNGITKCSPCKWRGRDVILFITKEDVYMHPVEMRKSGILGNNKPVLVNNEELKHQE--- 477
             + I   +  K       +F++K+ V++    +       N++P  V +E+  + +   
Sbjct: 404 GVSQIDSYAMWKKDTEPKDVFVSKDTVFVKSTAV-------NDQPSTVKDEKKANVDIPR 456

Query: 478 YKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPXXXXXXXXXXXXXXXXXXXSDVSKEVI 537
           Y+ +  QP+ E+++LN  FQ +    +SKL+ P                   + VSKE +
Sbjct: 457 YEVALNQPMSEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFL 516

Query: 538 SKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTSRSS 597
            KI + Q L  NLH+R LEQQYELTRQL+    I+SKQ  LR K++ QS   + +  R  
Sbjct: 517 QKIVKAQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQD 576

Query: 598 QLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRDAQEELN 657
           +L++R   L  K+  IN SPK +E  I DKE+ WFKEIRNQVL FN +VH+Q++ Q++L 
Sbjct: 577 KLLQRFNSLSEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLR 636

Query: 658 HLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKEL 703
           +L+K+L  IS E   +  EKS  EW EL  IL+ D +II+ECN +L
Sbjct: 637 YLQKELENISLEDKDV-GEKSKSEWTELLSILESDTKIIKECNNQL 681

>KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {ON}
           Anc_1.319 YJL061W
          Length = 716

 Score =  490 bits (1261), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 266/664 (40%), Positives = 412/664 (62%), Gaps = 16/664 (2%)

Query: 44  LRWCSVTASSFNSMTIDFFQPESTAPQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSP 103
           LRW SV +S ++S+ + FF  + +A +  I+SNSG+F+C+Y   ++ +IEIPWGY     
Sbjct: 54  LRWGSVASSQYHSLPLLFF--DDSAYENVIISNSGQFLCLYDKKSLSLIEIPWGYDGAVT 111

Query: 104 SMVSKFQ-LFSYNNKDDDGYSPIKQVLFHPEAYKDSCLVVLYDNGTISLMDVTQITKTIT 162
           S+ S FQ +F   NK  D    IK++LFHP+A  D C+V+L++N  I L D+ + ++ + 
Sbjct: 112 SIKSSFQRVFRDVNKSSD----IKKILFHPKAADDGCVVILFENDVICLFDLRK-SEKLF 166

Query: 163 LNKRVATFGIDTQITDIESICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITS 222
           LNK     GI+T++TDIE + FS+DG TLY LS++DGGDIYAFYPCLP +L +K+  +  
Sbjct: 167 LNKTANKLGIETRVTDIEDMEFSQDGLTLYMLSVTDGGDIYAFYPCLPPKLSLKKSVLED 226

Query: 223 LLHESVLLYESLKLDTDRDVKRNVIRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYRLIR 282
           L ++S +LY+SL      +V++NV++Q++F+  L    ++  KNS    +EI  ++R ++
Sbjct: 227 LFNKSRILYDSLDSTVSIEVRKNVLKQIKFIASLRDSSSDETKNS---CLEISNDFRQVK 283

Query: 283 GQGPFTIDPYPERLYSATALEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDN 342
            QGPFT+ PYPE+LY ATA EI TL I +NNEL  + FD+G++ LL KDL L+MSW+ DN
Sbjct: 284 AQGPFTVAPYPEKLYEATAKEIYTLDIGNNNELFAITFDNGTVTLLLKDLELSMSWNADN 343

Query: 343 YVHNNSFSLVELMQLKDTDVKRIVSYPDTYGQFFIFGD-SSLFLVHTHIWSDLLAKAIDN 401
           YV+NNSF L+E +++    +K + S   T GQ FI  + SS+  + T  WS  ++K I N
Sbjct: 344 YVYNNSFVLIESVEMGPESIKLLKSSSLT-GQMFISQNHSSVRKIDTTAWSFKVSKCITN 402

Query: 402 SNLNELLEMNFTSKLDFFETTNGITKCSPCKWRGRDVILFITKEDVYMHPV-EMRKSGIL 460
           S+L  L++++F SK+   +    +        RG   ILF++   V    + E   S ++
Sbjct: 403 SDLTSLIDVDFKSKISDLDIKENVDCYGVWSLRGERGILFVSNSSVISRTLPESDSSFVI 462

Query: 461 GNNKPVLVNN-EELKHQEYKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPXXXXXXXXX 519
             ++     N E+   ++Y+ SF QP+ E+M LN  FQ+ C     K+I+P         
Sbjct: 463 KLDEMSRSKNIEDPVTKKYEVSFTQPISEIMNLNDSFQRICRHPFKKIISPEERQTVLSN 522

Query: 520 XXXXXXXXXXSDVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLR 579
                     +++S +++S I +GQ+L L L +RL EQQYELT+QLK    ++ KQS L+
Sbjct: 523 DSNETQLATLTEISNDLVSNIVEGQSLGLVLRNRLYEQQYELTKQLKESIQLIEKQSLLK 582

Query: 580 RKSEEQSRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQV 639
              +++  RW+    +  +LI+R   L+  + +I+ S ++ + PI++KE+EWFKE+RNQ+
Sbjct: 583 SSYDDKMVRWNKNLKKQDELIQRFNALNGNLAKIHESKEISKTPISEKEVEWFKEVRNQI 642

Query: 640 LKFNSFVHNQRDAQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQEC 699
           LKFN FVH  R+ QE++N L+K L+RI  +  Q R      EW E + IL+ D  II+EC
Sbjct: 643 LKFNDFVHVHRNMQEQINFLRKGLSRIESKVGQ-RSSHLTSEWAEFKKILETDTNIIKEC 701

Query: 700 NKEL 703
           N+EL
Sbjct: 702 NEEL 705

>TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.319
           YJL061W
          Length = 691

 Score =  478 bits (1230), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 261/717 (36%), Positives = 413/717 (57%), Gaps = 49/717 (6%)

Query: 6   SIASHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTIDFFQPE 65
           ++ +HPIF+     Q  + RF  T+  G R VV+Q   +RWC+V+   ++SMT++    +
Sbjct: 2   TVETHPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAFKD 61

Query: 66  STAPQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDDGYSPI 125
               +  ++SNSGEF+C+Y +  + +IE+PW Y T   SM + FQLF + + +    + I
Sbjct: 62  V---KHVVMSNSGEFLCLYNDDELRIIEVPWAY-TEVSSMANAFQLFRFVSDE----ARI 113

Query: 126 KQVLFHPEAYKDSCLVVLYDNGTISLMDVTQI--TKTITLNKRVATFGIDTQITDIESIC 183
           KQVLFHP AY+   +V+L D+ +I++M+      +K   LN    T+ +D+ ITD+E I 
Sbjct: 114 KQVLFHPLAYQQETVVILKDDDSITIMNWQDFGDSKPDVLNLSNGTYSLDSSITDVECIT 173

Query: 184 FSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTDRDVK 243
           FS+DG TLY LS+S+G DIYAFYPCL  +++  ++ +  L+++S++ Y+ L + TD +VK
Sbjct: 174 FSQDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVK 233

Query: 244 RNVIRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYRLIRGQGPFTIDPYPERLYSATALE 303
           RN I+Q++FV+ L+      ++ +++  +EI +  R +RGQGPFTI P+P+++YS+T   
Sbjct: 234 RNTIKQLKFVSGLH------KQQNSQRILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTG 287

Query: 304 ISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELMQLKDTDVK 363
           I++LPIN  NEL+ M  DDG+IA+L +DL +TM+WD   Y +NNSF+LVEL+ L   +++
Sbjct: 288 IASLPINDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQ 347

Query: 364 RIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSKLDFFE--- 420
           +IV     YGQF +     +F + T  WS ++A  +  S+L  L E    S++ F E   
Sbjct: 348 QIVVGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKD 407

Query: 421 ----------TTNGITKCSPCKWRGRDVILFITKEDVYMHPVEMRKSGILGNNKPVLVNN 470
                     T   + K S  + + + V   ++K+D            I G+ +      
Sbjct: 408 SPKSVAWWNTTPQSVVKVSNREVKSKQVSEGVSKQD----------DDITGSRQ------ 451

Query: 471 EELKHQEYKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPXXXXXXXXXXXXXXXXXXXS 530
              + ++Y   + QP+ E+M LN+ FQ + S   SK+I P                   +
Sbjct: 452 ---EPEKYNAHYSQPIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLT 508

Query: 531 DVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWD 590
           + SK+ +SKI  GQ L + LH+R+ EQQ +LT QLK    +M KQ  +      QS R D
Sbjct: 509 EASKDFVSKIAVGQTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSD 568

Query: 591 DQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQR 650
              +R S L+ R       + +I NS + K+  I+ +E+EWFKEIR QVL FN  VHNQ+
Sbjct: 569 AVHARHSTLMSRFNKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQK 628

Query: 651 DAQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKELLSTT 707
             Q++L HLK+++ RI++ T     +  D EW ELR +L+ D  I+Q+CN +L S  
Sbjct: 629 RLQDQLIHLKQEMNRIAQVTGDQNSQARD-EWHELRHMLEEDTIILQDCNNQLKSAA 684

>KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON}
           Anc_1.319 YJL061W
          Length = 747

 Score =  424 bits (1090), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 261/728 (35%), Positives = 397/728 (54%), Gaps = 50/728 (6%)

Query: 7   IASHPIFQ---GLDCTQDAAPRFLFTSHHGTRMVVLQ--GGLLRWCSVTASSFNSMTIDF 61
           +   PI Q   GL    D + R++FT+  GT+ V L    GLLRW SV+   +NSM +  
Sbjct: 20  MGQRPILQPTAGL--PSDLSSRYVFTTDKGTKYVYLDKTNGLLRWGSVSEDEYNSMPLKI 77

Query: 62  --FQPESTAPQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDD 119
             F  +S      ILS+SGEF+CVY+   + VIE+PW Y  P   M   FQ  S+     
Sbjct: 78  SNFADKSV---NVILSDSGEFLCVYSKDCVTVIEVPWRYRNPE-EMSYVFQT-SFKEIRK 132

Query: 120 DGYSPIKQVLFHPEAYKDSCLVVLYDNGTISLMDVTQITKTITLNKRVATFGIDTQITDI 179
           D +  IK+VLFHP A K +C+V+L+++ TI L DV    K I LN      GI+ +IT I
Sbjct: 133 DSF--IKKVLFHPRAIKKTCMVILFEDDTIYLFDVEDNNK-IALNVPSGNIGIEDRITSI 189

Query: 180 ESICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTD 239
             I FS+DG TLY LS  D GD+YA YPCLP  L + ++++ SL++ SVLLY+SL   T 
Sbjct: 190 ADIEFSQDGLTLYVLSAEDCGDVYAIYPCLPPILAMSQKELKSLMNRSVLLYDSLTETTP 249

Query: 240 RDVKRNVIRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYRLIRGQGPFTIDPYPERLYSA 299
             VK+ VI+QV+F+++L  +    E+ SN   +EI+  YRL + QGPFTI P+PE+LYSA
Sbjct: 250 SAVKKGVIKQVEFISQLQNISHGKEEISN--VLEIDTIYRLAKPQGPFTIAPFPEKLYSA 307

Query: 300 TALEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELMQLKD 359
           TA EI  L I   NE++C+ +D+G+   LFKDL L+M+WDV    +NNS  L+E   L+ 
Sbjct: 308 TATEICPLNIGGGNEILCIAYDNGTALFLFKDLELSMAWDVGGIYYNNSLVLMEEFDLQT 367

Query: 360 TDVKRI-----------------VSYPDTYGQFFIFGD------SSLFLVHTHIWSDLLA 396
                I                 V + D    F   GD      S +  V T  WS +++
Sbjct: 368 ESAVSILKSFKMDGLILFKVSDSVQHIDVSKSFIQDGDLLVQQSSMIRCVDTKAWSSVVS 427

Query: 397 KAIDNSNLNELLEMNFTSKLDFFETTNG-ITKCSPCKWRGRDVILFITKEDVYMHPVEMR 455
             ID  ++N L+ ++F SK   +      IT C      G + + +IT + V    ++ +
Sbjct: 428 DCIDRHDINALITVSFKSKGHTWAIAGSDITSCGAWNHGGTEGVTWITNKSVTCKELKKQ 487

Query: 456 KSGILGNNKPVLVNNEELKHQEY-KTSFKQPVEELMALNKLFQQQCSMGVSKLIAPXXXX 514
            S      KP    + E K Q + K  F  P+ EL ALN  +Q  C +G   +I+P    
Sbjct: 488 VSW-----KPEQSTSSEKKKQAFPKPEFSVPISELNALNINYQDTCRIGFHDIISPLDRQ 542

Query: 515 XXXXXXXXXXXXXXXSDVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSK 574
                          + +S  +++ +G+GQ L + L++RLLEQQ ELT+QL+  + I+ K
Sbjct: 543 KPLLNPSNEKQLQVMTSLSNYLLATVGKGQGLGMTLYNRLLEQQLELTKQLQCSNKILMK 602

Query: 575 QSDLRRKSEEQSRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKE 634
           Q  + +K EEQ   W+++ ++ ++L +R   L  K+  I+ + K  +  I D+E  WFKE
Sbjct: 603 QPAIAKKLEEQKSVWNEKLAKQNKLKERFSSLQQKLAAIDKTKKSTDLVITDEESVWFKE 662

Query: 635 IRNQVLKFNSFVHNQRDAQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQ 694
           ++ + L FN  V+ Q   Q++L  LK++L+    ++ +L    ++ EW  L+++LKHD+ 
Sbjct: 663 VKKEALTFNDLVYKQESVQDDLRFLKRELSTFVSDSQRLPG-TANTEWHSLQEMLKHDSL 721

Query: 695 IIQECNKE 702
           +++   K+
Sbjct: 722 LLRADKKD 729

>TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {ON}
           Anc_1.319 YJL061W
          Length = 742

 Score =  404 bits (1038), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 253/731 (34%), Positives = 401/731 (54%), Gaps = 57/731 (7%)

Query: 8   ASHPIFQG---LDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTIDFFQP 64
            SHPIF+        Q+ +PRF FT++   R+VV+Q G +RWC   + +++S TI     
Sbjct: 16  TSHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTI---AS 72

Query: 65  ESTAPQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSK-FQLFSYNNKDDDGYS 123
            +   + +++SNSG F+C Y++  I ++EIPW +     +  S   Q + Y+ K    YS
Sbjct: 73  RNFDIKDSLISNSGSFVCYYSDTDISIMEIPWSHSNSVNASSSHCIQKYRYSFK---KYS 129

Query: 124 -PIKQVLFHPEAYKDSCLVVLYDNGTISLMDVTQ----ITKTITLNKRVATFGIDTQITD 178
             +KQVLFHP A  +SCLVVL  + TI  +D ++    ++    LNK+  + G+ +QI+D
Sbjct: 130 LTVKQVLFHPLATLESCLVVLLSDDTIVFIDFSKSFDLLSSDYILNKKSKSIGLSSQISD 189

Query: 179 IESICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDT 238
           I+S+ FS+DG TLYALS S   D+YAFYPCLP   +   E++ +L+++SV+ YE L+ D 
Sbjct: 190 IQSLTFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDD 249

Query: 239 DRDVKRNVIRQVQFVNKL---NGLLTENEKNSNEDFIEIEQEYRLIRGQGPFTIDPYPER 295
              +K N+I+Q++F + L        E + +S     ++  EYRLIR QGPFTI P+P+ 
Sbjct: 250 PTALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPDS 309

Query: 296 LYSATALEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELM 355
           LY ++   I ++PI++ NEL+ + F DGS+  LF+DL LTMSWD DN+  NNS  L+EL+
Sbjct: 310 LYYSSPTHIVSVPIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELI 369

Query: 356 QLKDTDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSK 415
           + K+ +++++ +Y   YG F+I G    F V T  WS  LA  I +S++ +L  +   S 
Sbjct: 370 KTKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLIKSV 429

Query: 416 LDFF-----ETTNGITKCSPCKWRGRDVILFITKEDVYMHPVEMRKSGILGNNKPVLVNN 470
           +  F     E T+G   CSP        +LFI K  V    +E+       N KP L+ +
Sbjct: 430 IKPFDNAAYELTSGGWWCSPT----ISSLLFINKSTV----IEL-------NEKPKLLLS 474

Query: 471 EELKH---QEYKTSFKQPVEE---------------LMALNKLFQQQCSMGVSKLIAPXX 512
           ++  H    E    +  P+E+               L  +N +F+++ +  ++  I    
Sbjct: 475 DDTTHLLTSELAQKYIPPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQE 534

Query: 513 XXXXXXXXXXXXXXXXXSDVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIM 572
                            + +SK +  KI  GQ+L   +++++L+QQ  +  QL+    ++
Sbjct: 535 RNVTLFNKTNENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVELQLRQTQRLL 594

Query: 573 SKQSDLRRKSEEQSRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWF 632
            K+  L  K  EQ+ +    T R  +L+ RL  ++ K+ + +    L    I+ KELE+F
Sbjct: 595 EKEKILNTKYNEQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFF 654

Query: 633 KEIRNQVLKFNSFVHNQRDAQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHD 692
           KEIR QVL FN FVH Q+D  + L  +KK+L RI  E + + DE   K+WD LRD+L  D
Sbjct: 655 KEIRKQVLLFNEFVHKQKDQHDTLLFIKKELIRIKGENA-IVDENDFKQWDRLRDMLHDD 713

Query: 693 AQIIQECNKEL 703
           A  I+ C + +
Sbjct: 714 ATTIETCTESI 724

>SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 690

 Score =  396 bits (1018), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 246/715 (34%), Positives = 389/715 (54%), Gaps = 40/715 (5%)

Query: 6   SIASHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTIDFFQPE 65
           S   HPIFQ +   +++ P+ L T+  G R+VV+QG  +R CS   S +  +        
Sbjct: 2   SAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQIIECGI---- 57

Query: 66  STAPQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDDGYSPI 125
                 A L+NSG  +C Y    ++VI      V PSP + S   +   +  +    SPI
Sbjct: 58  -NTVAGAALNNSGTLLCAYNETELQVI------VLPSPFVSSHGGILKPHTYNITVKSPI 110

Query: 126 KQVLFHPEAYKDSCLVVLYDNGTISLMDVTQ---ITKTITLNKRVATFGIDTQITDIESI 182
           KQV +HP    DS  VVL+ + TI++ ++        T  LN      G+ + ITDIES+
Sbjct: 111 KQVQWHPRGKLDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESM 170

Query: 183 CFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTDRDV 242
           CFSKDG  LY L+ S+GGD+YA YP LP  L +  + +    ++S + YE+L  D    V
Sbjct: 171 CFSKDGLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTV 230

Query: 243 KRNVIRQVQFVNKLNGLLTEN--EKNSNEDFI-EIEQEYRLIRGQGPFTIDPYPERLYSA 299
           KRNVI+Q+QFV++L+        +K  N D +  I++ YR  + QGPFTI+P+ E+LYSA
Sbjct: 231 KRNVIKQLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSA 290

Query: 300 TALEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELMQLKD 359
           TA +I+T+PI+  NEL+ + FD+G+I   F+DL L+M W+  +   NNS  ++E + +  
Sbjct: 291 TATQITTMPIDEFNELILVYFDNGTILQCFQDLDLSMCWEEIDSSSNNSLVVLESLDILS 350

Query: 360 TDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSKLDFF 419
             +  +  +     +F + G  S F+V +  W+  L++ I+ SNL  L ++N  S +   
Sbjct: 351 GQIICLTPH-----KFAVLGPKS-FVVDSSEWTKALSECINFSNLEVLSQINIKSTIT-- 402

Query: 420 ETTNGITKCSPCKWRGRDVILFITKEDV---YMHPVEMRKSGILGNNKPVLVNNEELKHQ 476
                 T+    +  G   ++F++ + V    +      K  +    +PV     E+K  
Sbjct: 403 PVNGAFTQAGLWESNGEKQLIFMSDKSVKSITLPEPNKTKDAVSKTVQPVT----EVK-- 456

Query: 477 EYKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPXXXXXXXXXXXXXXXXXXXSDVSKEV 536
            Y+  F QP+ E++ LNK FQ +CS     +I P                   +D+SKEV
Sbjct: 457 -YEPVFSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEV 515

Query: 537 ISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTSRS 596
            SKI QGQ L L +H+RL EQ+YELTRQL+    I+ K   L+ +  +Q+ RW+  + + 
Sbjct: 516 FSKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQ 575

Query: 597 SQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRDAQEEL 656
             +  R + L +++ EI++S KLK+  I+ +E+EWFKEI++QV  FN FV  Q+D +E+L
Sbjct: 576 ENIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQL 635

Query: 657 NHLKKDLARISKETSQLRDEKSDK-EWDELRDILKHDAQIIQECNKELLSTTEAL 710
             ++ +L    K   + R  K D  +W EL+++L  D++II+ECN+ L+   + L
Sbjct: 636 EFVQSEL----KTAGERRVSKEDVFDWAELQELLSVDSEIIKECNEGLVEAAKEL 686

>Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {ON}
           complement(57897..60050) [2154 nt, 718 aa]
          Length = 717

 Score =  389 bits (1000), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 241/717 (33%), Positives = 393/717 (54%), Gaps = 30/717 (4%)

Query: 10  HPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWC-SVTASSFNSMTIDFFQPESTA 68
           +PIF+    +++   RF F++++GTR+++ Q   +RW  S     + SM +     + T 
Sbjct: 6   NPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSDMDVTG 65

Query: 69  PQKAILSNSGEFICVYTNHTIEVIEIPWGYVTP---SPSMVSKFQLFSYNNKDDDGYSPI 125
              AI+S+ G+++C+Y +H I VIEIPWG       S SM S  Q   YN  +D     +
Sbjct: 66  ---AIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDK--LSV 120

Query: 126 KQVLFHPEAYKDSCLVVLYDNGTISLMDVTQITKT------ITLNKRVA-TFGIDTQITD 178
           KQVLFHP +     LVVL+    I+ +D+  + K+        LN   +   GID ++ +
Sbjct: 121 KQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVEN 180

Query: 179 IESICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDT 238
           I+ + F+ D  +LY+L+     D+Y FYPCLP    + + ++  L+++S++LYE+L +D 
Sbjct: 181 IQYVVFADDCLSLYSLT---DTDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDA 237

Query: 239 DRDVKRNVIRQVQFVNKLNGLLTENEKNSNEDF---IEIEQEYRLIRGQGPFTIDPYPER 295
           D  V++NVI+Q+Q  + L   + E E N+N +    +EI+ E+R  + QG F+I PYPE 
Sbjct: 238 DDIVRKNVIKQLQLASSLRKKIEEFE-NANGEVEVNVEIDLEFRQTKAQGYFSISPYPES 296

Query: 296 LYSATALEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELM 355
           LY+ T  +IS LPI   NEL  + FD+G++ ++FKD   TMSWDV++Y  NNSF+LVE++
Sbjct: 297 LYTCTGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEII 356

Query: 356 QLKDTDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSK 415
           + K  ++  +V      G+F + G+ S  LV T  WS +++K I +++L  L+ +   S 
Sbjct: 357 KFKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKST 416

Query: 416 LDFFETTNGITKCSPCKWR-GRDVILFITKEDVYMHPVEMRKSGILGNNKPVLVNNEELK 474
           +    +   I  C    W  G    L +   +V +     +K       KP        +
Sbjct: 417 ITHINSDMQINSCGI--WNSGEAKSLLLVDTNVVVGYQLFKKEVEF---KPESAEEISTE 471

Query: 475 HQEYKT-SFKQPVEELMALNKLFQQQCSMGVSKLIAPXXXXXXXXXXXXXXXXXXXSDVS 533
            + +    F  P  EL A N  FQ+  S+  SK+I                     +D+S
Sbjct: 472 LENFTLDKFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDIS 531

Query: 534 KEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQT 593
           ++V SKI QGQ+L L L+ RLLEQQ +L+ QL I + I+ +   ++     Q  + D++ 
Sbjct: 532 RDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKL 591

Query: 594 SRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRDAQ 653
            +   L K L  +++ +  I  S KLK  P+++KE++ FKE+R+Q+L FN+FVH Q+D +
Sbjct: 592 KKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQK 651

Query: 654 EELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKELLSTTEAL 710
           + +  LKK+L +I   +     +    EW+ELR IL  DA+II+ECN++L   ++ L
Sbjct: 652 QNIQFLKKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKEL 708

>TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {ON}
           Anc_1.319 YJL061W
          Length = 721

 Score =  325 bits (834), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 223/727 (30%), Positives = 374/727 (51%), Gaps = 44/727 (6%)

Query: 10  HPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTAS--SFNSMTIDFFQPEST 67
           H IF      + ++ R   T  +G ++++ Q   +R+  V  +  +F S+T+   + E  
Sbjct: 7   HTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITL---EKEMI 63

Query: 68  APQKAILSNSGEFICVYTNHTIEVIEIPW----GYVTPSPSMVSKFQLFSYNNKDDDGYS 123
                I    G ++C++    I VIE+PW         S  + +  Q+ SY+ K     +
Sbjct: 64  GDVSIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKS--FGT 121

Query: 124 PIKQVLFHPEAYKDSCLVVLYDNGTISLMDVTQITKT-------ITLNKRVATFGIDTQI 176
            I+++LFHP      CLVVL  N  I  +D+ +I K        IT        G+ + I
Sbjct: 122 TIQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLSSCI 181

Query: 177 TDIESICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKL 236
            DI  I FS D  +LYAL+     DIY FYP L   + V + +I  L  +S++L+E+L+ 
Sbjct: 182 DDIIDISFSSDKLSLYALT---ETDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLEN 238

Query: 237 DTDRDVKRNVIRQVQFVNKLNG-LLTENEKNSNED-----FIEIEQEYRLIRGQGPFTID 290
           D+   V+RN+I+Q+Q ++ L+G + T+ ++  N D      I+I  EYR +  QG F+I 
Sbjct: 239 DSSEAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIA 298

Query: 291 PYPERLYSATALEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFS 350
           P+PE LY  +A+ +S + I   NEL  + +DDG++ +L++DL  +MSWD ++Y  NNSF 
Sbjct: 299 PFPEELYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFI 358

Query: 351 LVELMQLKDTDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNELLEM 410
           L+E ++    + K I+  P   G F I GD ++ L+ T  WSD+L++ I ++++  L  +
Sbjct: 359 LLEKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGL 418

Query: 411 NFTSKLDFFETTNGITKCSPCKWRGRDVILFITKEDVYMHPVEMRKSGILGNNK------ 464
           +  S      T      C       +  +LFIT+        ++  S IL +N       
Sbjct: 419 SIESHKQTINTLEEPNSCILWNEHNKKELLFITE-------TKLISSDILESNNESAEKL 471

Query: 465 PVLVNNEELKHQEYK-TSFKQPVEELMALNKLFQQQCSMGVSKLIAPXXXXXXXXXXXXX 523
           PV   N+  K ++ +  ++ QP++E+    + ++  C +  SK+I               
Sbjct: 472 PVPAINDIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENE 531

Query: 524 XXXXXXSDVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSE 583
                 +++S+E+ SKI QGQ +AL +H RL EQQ     QL   +  +     +++  +
Sbjct: 532 DQLAYITEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYD 591

Query: 584 EQSRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFN 643
            QS +    T R+++L +R   L   + +I  S + K  PIND E + FKEI+ QVL FN
Sbjct: 592 IQSTKIKHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFN 651

Query: 644 SFVHNQRDAQEELNHLKKDLARISKETSQLRD---EKSDKEWDELRDILKHDAQIIQECN 700
             V+ Q++ QE +  L+ +L  I ++ +Q  D   +  + EW+EL D+L  DA+II++CN
Sbjct: 652 DAVNRQQEQQEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCN 711

Query: 701 KELLSTT 707
            EL S +
Sbjct: 712 AELSSAS 718

>Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {ON}
           YJL061W (NUP82) - 82-kDa protein, with putative
           coiled-coil domain, has carboxy-terminal domain,
           containing heptad repeats, that binds Nsp1p; nucleoporin
           [contig 224] FULL
          Length = 687

 Score =  310 bits (793), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 201/719 (27%), Positives = 352/719 (48%), Gaps = 55/719 (7%)

Query: 9   SHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTIDFFQPESTA 68
           SHPIF     +   + RF+F     ++  VLQG  LRWCS     +  +    F+P    
Sbjct: 5   SHPIFDTKTNSSGKSRRFVFNIGIASKYGVLQGNTLRWCSAGGHEYQYLE---FEPR-ID 60

Query: 69  PQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDDGYSPIKQV 128
               +++ SG  +C+Y +  ++++ + W        ++S               + IKQ 
Sbjct: 61  YTSVVINESGSLLCLYNSKQVQILAVSWDESKSDTILISP-------------PAGIKQA 107

Query: 129 LFHPEAYKDSCLVVLYDNGTISLMDVTQ---ITKTITLNKRVATFGIDTQITDIESICFS 185
           L+HP     SCL VL     I L ++        T  LN      G+ + + DI S+ FS
Sbjct: 108 LWHPRGRLGSCLAVLTTQDEICLYELLTEDYTEPTTILNTCTKELGMGSVVKDITSMSFS 167

Query: 186 KDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTDRDVKRN 245
            DG TLY LS S+G DIY+ YPCLP ++E+    + S+ ++++L Y+ L  +   D++R 
Sbjct: 168 SDGLTLYLLSTSEGADIYSIYPCLPSEMEISGALLKSVFNKALLQYQDLNDNDSPDLRRK 227

Query: 246 VIRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYRLIRGQGPFTIDPYPERLYSATALEIS 305
           V +Q+QFV+KL      + K++    + I + +R  R QGPFTI+P+P+ LY AT  ++ 
Sbjct: 228 VTKQLQFVSKLQK--KNDYKDTESHVVTISKAHRSPRAQGPFTINPFPDNLYLATGRQVE 285

Query: 306 TLPINS-NNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELMQLKDTDVKR 364
            + +     EL+ + FDDG+I   F D    MSW+ + +  NNS     L+ L   ++  
Sbjct: 286 VIKLQGCAAELLLISFDDGTILECFPDREPVMSWEDEGFCENNS-----LIVLGSVNIGG 340

Query: 365 IVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSKLDFFETTNG 424
            ++  + Y  F +   + +  V     + ++  ++++ +++   E + + ++   E    
Sbjct: 341 EIALVNGY-TFVVLSSAKVTFVSLRKLAQVIESSLNDCDISYFDEADLSEEV--VEKNGR 397

Query: 425 ITKCSPCKWRGRDVILFITKEDV-------YMHPVEMRKSGILGNNKPVLVNNEELKHQE 477
                 C    +  +  +++           +   +MR +  LG  K  +        ++
Sbjct: 398 FCSAIICASSEKSCVALLSETTTSHIDIPFSLDAPKMRTA--LGTAKTDV--------EQ 447

Query: 478 YKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPXXXXXXXXXXXXXXXXXXXSDVSKEVI 537
           Y+  + QP+ E++ALN+  Q      +   ++P                   + +SKEV+
Sbjct: 448 YR-PYGQPLNEVLALNEKVQALLKKPLQTGVSPSLRQAKLNNESNEDQLSLLTSISKEVM 506

Query: 538 SKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTSRSS 597
           ++I   Q LAL+L+ RL  QQ ELT+ L+ V  +   QS + R+ ++QS RW+   +++ 
Sbjct: 507 TRIASAQTLALSLYLRLSCQQGELTQHLETVSKVEELQSKVLRRLKDQSSRWEAAQAKNK 566

Query: 598 QLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRDAQEELN 657
            +  RL+ + +K+ ++++S K +  PI++ ELEWFKEIR+QV++FN  VH Q+     L+
Sbjct: 567 SISSRLEQISSKLKQVSSSGKFQSQPISNHELEWFKEIRDQVIRFNRLVHEQQSLGNTLS 626

Query: 658 HLKKDLARI------SKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKELLSTTEAL 710
           +LK +L  +       K  S   D K +  WDELR +L  D +II EC   L    + L
Sbjct: 627 NLKCELEYVHVESKEGKSGSSSADNKDEVPWDELRALLAKDLRIIGECQDSLQGVAKQL 685

>CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061w NUP82 nuclear pore protein
          Length = 716

 Score =  301 bits (772), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 202/700 (28%), Positives = 358/700 (51%), Gaps = 26/700 (3%)

Query: 19  TQDAAPRFLFTSHHGTRMV-VLQGGLLRWCSVTASSFNSMTIDFFQPESTAPQKAILSNS 77
           T +AA RFLF+S  GT++V +   G LRWC  T++++ S+  D  Q E    + A+ S +
Sbjct: 14  TGNAAQRFLFSSSDGTKIVSIADRGHLRWCHSTSTTYKSLDFDL-QFEGKV-EGAVSSTT 71

Query: 78  GEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDDGYSPIKQVLFHPEAYKD 137
            +++C+Y    + V+E+PW Y      +  K     Y++K D+ +S IKQVLFHP++Y D
Sbjct: 72  ADYVCIYNRDELHVLEVPWMYSGEENGL--KHLCHIYSHKFDENHS-IKQVLFHPKSYLD 128

Query: 138 SCLVVLYDNGTISLM---DVTQITKTITLNKRVATFGIDTQITDIESICFSKDGWTLYAL 194
           S ++VL ++ +I ++   D       I LN + +  G+  +I DI+ I FS+DG +L  L
Sbjct: 129 STILVLTNDDSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGLSLLIL 188

Query: 195 SISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTDRDVKRNVIRQVQFVN 254
           S  +G DI+  YPCLP++ ++   ++ +L  +S+LLY ++ ++T    KRN+++Q+ F+ 
Sbjct: 189 SAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLNFME 248

Query: 255 KLNGLLTENEKNSNEDFIEIEQEYRLIRGQGPFTIDPYPERLYSATALEISTLPINSNNE 314
           K+ G  T   +N  +  I +E  Y   + QGPF++ PYP  LY   A +I+ + I  N  
Sbjct: 249 KIRGQKTA-FRNDKKPLI-LEDAYLNAQPQGPFSMTPYPNELYDFMATDINIIQITQNIS 306

Query: 315 LMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELMQLKDTDVKRIVSYPDTYGQ 374
           L+ + F +G++ L   DL   MSWD+  +  +NS +L+E ++L+ TD  + +S P TYG+
Sbjct: 307 LLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPGTYGK 366

Query: 375 FFIFGD-SSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSKLDFFETTNGITKCSPCKW 433
           F +  +  S F V+T  WS +LA+ ID+S++  L  +   S ++  +     T  S   W
Sbjct: 367 FVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQL-ATTFKSIIYW 425

Query: 434 RGRDVILFITKEDVYMHPVEMRKSGILGNNKPVLVNNE-----------ELKHQEYKTSF 482
           +  ++       D  +  ++M   GI    K  L++             ELK+  Y+  F
Sbjct: 426 KNENISCNYIISDKKIEELDML-DGISSTTKHKLIDQSNSQVESKLDLPELKNGLYEVKF 484

Query: 483 KQPVEELMALNKLFQQQCSMGVSKLIAPXXXXXXXXXXXXXXXXXXXSDVSKEVISKIGQ 542
            +P+ E+    +++ +         I                     + +S+  +  I  
Sbjct: 485 ARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMKMISM 544

Query: 543 GQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTSRSSQLIKR 602
            Q L      R+++   E +RQ++  + I     +  +  E Q+ + D    +  +L++R
Sbjct: 545 AQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQKLMER 604

Query: 603 LQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRDAQEELNHLKKD 662
           L  L  K+        +    I+  E EWF EI+  V++FNS+V       +EL  +K+ 
Sbjct: 605 LSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEFIKEQ 664

Query: 663 LARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKE 702
            A+I+ +   +  E   KEW++L+ +L+ D +II E  K+
Sbjct: 665 QAQIANQKPDISSENG-KEWNDLQQLLRTDLKIISEFEKK 703

>KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 691

 Score =  295 bits (756), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 211/721 (29%), Positives = 349/721 (48%), Gaps = 55/721 (7%)

Query: 9   SHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTIDFFQPESTA 68
           +HPIFQ     +  + R    +   +R ++L+G  L+WC + A ++  M ++     ++A
Sbjct: 5   AHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLMDAPNYEYMELNAISNYTSA 64

Query: 69  PQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDDGYSPIKQV 128
               +L++SG  +C+     I+V+ + W    P           SY  K   G   +KQV
Sbjct: 65  ----VLNDSGTLLCLNNVDEIQVLALSWDQTRPE----------SYRIKVPAG---VKQV 107

Query: 129 LFHPEAYKDSCLVVLYDNGTISLMDVTQ---ITKTITLNKRVATFGIDTQITDIESICFS 185
           L+HP    DSCL VL     I L ++        T  LN      G+ + + DIES+CFS
Sbjct: 108 LWHPRGRLDSCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVCFS 167

Query: 186 KDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTDRDVKRN 245
            DG TLY +S+S+G D+++ YPC+P +L + R+ +    ++++L Y+ L      ++K  
Sbjct: 168 ADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKLK 227

Query: 246 VIRQVQFVNKLNGLLTENEKNSNEDFIE---IEQEYRLIRGQGPFTIDPYPERLYSATAL 302
             RQ+ F++ L      +  +S  + ++   I + YR  R QGPFTI P+PE+LY ATA 
Sbjct: 228 ATRQLHFMSSLYNQ-PHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAK 286

Query: 303 EISTLPI-NSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELMQLKDTD 361
           +I  + + +   EL+ + FDD +I   F DL   MSW+       NS   V  ++L    
Sbjct: 287 QIKAIALEDETTELLLITFDDDTILECFPDLTPVMSWEDSGSSEKNSLISVGSLKLPG-- 344

Query: 362 VKRIVSYPDTYGQFFIF-GDSSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSKLDFFE 420
                S    YG  F+        +V+    +  + +++D+ +  EL E + T ++    
Sbjct: 345 -----SISLIYGSCFVLISAEKAAVVNLSRLTRSIERSLDDCDATELSEEDLTEEI---- 395

Query: 421 TTNGITKCSPCKW--RGRDVILFITKEDVYMHPVEMRKSGILGNNKPVLVNNEELKHQE- 477
           T    T  S   W   G   I+ ++++       E+    I     P     E+++  E 
Sbjct: 396 TEKKGTFQSAGLWPESGMQKIVLLSEK-------EITSIDISSMQTPASSTTEKIEKSET 448

Query: 478 -YKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPXXXXXXXXXXXXXXXXXXXSDVSKEV 536
             +  + QP+ E+  LN+  Q      +S +I                     +D+SKEV
Sbjct: 449 NRQRPYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEV 508

Query: 537 ISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTSRS 596
           +S++   Q L L+LH RLL QQ EL + L+ V  + +K+  +      Q  RW+    ++
Sbjct: 509 LSRVTLAQTLGLSLHLRLLGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEKN 568

Query: 597 SQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRDAQEEL 656
             +  R + L   + +I+ S +L+  PI   E+EWFKE+RNQV++FN  VH Q+D  E L
Sbjct: 569 KSIALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDLAEAL 628

Query: 657 NHLKKDL--ARISKETSQLRDEKSDKE-----WDELRDILKHDAQIIQECNKELLSTTEA 709
           + LK  L   R+    +  R +KS +      WDEL+ +L  D++II+EC  EL  TT+ 
Sbjct: 629 SSLKLSLEYVRVDSAEAASRSKKSAESAGGVPWDELQAMLAKDSRIIKECQAELQCTTQE 688

Query: 710 L 710
           L
Sbjct: 689 L 689

>Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar to
           Ashbya gossypii AEL168C
          Length = 671

 Score =  265 bits (678), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 203/712 (28%), Positives = 347/712 (48%), Gaps = 63/712 (8%)

Query: 10  HPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTIDFFQPESTAP 69
           HPIFQ +   +  +   +    + T++V      LR+  VT  +F S  +D    E    
Sbjct: 6   HPIFQ-VPPFRTLSKLHVHVCKNATQIVTCFDKNLRYARVTEHTFKSKHLDIKHSE---- 60

Query: 70  QKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDDGYSPIKQVL 129
             +IL+NSG  I  Y ++ +E+ ++             + +L             IKQVL
Sbjct: 61  -HSILNNSGTLIAFYGSNDVELFDMD------GKKSCLRVEL------------GIKQVL 101

Query: 130 FHPEAYKDSCLVVLYDNGTISLMDVTQ---ITKTITLNKRVATFGIDTQITDIESICFSK 186
           +HP AY DSCLVVL    TI L ++ +   +  T+ LN+++   GI + +++I S+ FS 
Sbjct: 102 WHPLAYLDSCLVVLTKENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMAFSP 161

Query: 187 DGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTDRDVKRNV 246
           DG TLY LS+ +GGD+YA +P LP +L +KR    S  +++  LYES+  DT  + K  +
Sbjct: 162 DGLTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKKIAM 221

Query: 247 IRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYRLIRGQGPFTIDPYPERLYSATALEIST 306
           I    FV+K+  ++   +K+S    + I +  R++  +GPF+I  +PE LY+ TA ++ T
Sbjct: 222 IEHFDFVSKIYKMI---DKDSEFFDVNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLIT 278

Query: 307 LPINSNNELMCMI-FDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELMQLKDTDVKRI 365
           LP+N     + ++ FDDG+I  LF D+ L MSW   +   NN+ S V + + +       
Sbjct: 279 LPVNDEGAYVLILSFDDGTILSLFPDIELLMSW---SRSLNNACSFVLIEKFR------- 328

Query: 366 VSYPDTYGQFFIF--GDSSLFLVHTHI----WSDLLAKAIDNSNLNELLEMNFTSKLDFF 419
                  G+ F    G + L   + HI    +   L + I   ++  ++++  TS +   
Sbjct: 329 -----AGGEIFAIESGVAILEKNNAHIVRFPYLKALGECIKEGDIAPMVDVKLTSDITPL 383

Query: 420 ETT-NGITKCSPCKWRGRDVILFITKEDVYMHPVEMRKSGILGNNKPVLVNNEELKHQEY 478
             + + +   +    +G   ILFI    +   P ++  S       P +  N      +Y
Sbjct: 384 AGSYHTVVTWNEPSTKG---ILFIGNSVIRSIPDDVGLSSFKPRVDPAISQN-----GKY 435

Query: 479 KTSFKQPVEELMALNKLFQQQCSMGVSKLIAPXXXXXXXXXXXXXXXXXXXSDVSKEVIS 538
              F   +EEL+  NK  Q      +  L+                     + +S EV+ 
Sbjct: 436 TVCFPSTMEELLKTNKALQHTLRQPLP-LVPLEQKNVPLNSEFNEHQLATLTKISTEVMD 494

Query: 539 KIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTSRSSQ 598
           +I   Q+L   +++R   QQ+EL RQL+ V  +  +   L++ ++  + R D  + +   
Sbjct: 495 RIILAQSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIA 554

Query: 599 LIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRDAQEELNH 658
           L  RL+ L   + ++N SPK  E P++ KE  WF+E++N VL FN +V       EELN 
Sbjct: 555 LRSRLEKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSKLCEELNF 614

Query: 659 LKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKELLSTTEAL 710
           LKK+L  I      + +E+    +++L+D+L  D+++I +CN +LL+  + L
Sbjct: 615 LKKELELIESNHGNIPNEEL-FNFEKLQDLLTLDSKMIGDCNDQLLAAAKDL 665

>AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL061W
           (NUP82)
          Length = 673

 Score =  263 bits (671), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 202/706 (28%), Positives = 333/706 (47%), Gaps = 49/706 (6%)

Query: 10  HPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTIDFFQPESTAP 69
           HPIF   D    +      T   GT++V      LR    T  ++ S     +  E  A 
Sbjct: 6   HPIFNA-DALGASHRLHAHTHGDGTKIVGYYNKHLRLGRFTEQTYKS-----WHAEVDAK 59

Query: 70  QKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDDGYSPIKQVL 129
             +IL+ SG  +  Y +H IEV++     +T            + N         IKQVL
Sbjct: 60  ASSILNGSGSLLAFYGDHIIEVVDREGKKIT-----------LTVNGG-------IKQVL 101

Query: 130 FHPEAYKDSCLVVLYDNGTISLMDVTQI---TKTITLNKRVATFGIDTQITDIESICFSK 186
           +HP AY DSCLVVL    TI + ++ +      T+ LN+  +  GI +++ DI +I F+ 
Sbjct: 102 WHPLAYLDSCLVVLTGQETIEIYELNEPRYEKPTLVLNEPTSQLGISSRVIDITNIAFAP 161

Query: 187 DGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTDRDVKRNV 246
           DG +LY  S S+GGD++   P LP +++  R K     +++  LY +L  DT  D K   
Sbjct: 162 DGLSLYLFSTSEGGDVHVICPLLPSRIKADRAKWARQWNKATALYSTLTKDTPDDAKVAT 221

Query: 247 IRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYRLIRGQGPFTIDPYPERLYSATALEIST 306
           I  ++FV +   LL   EKN ++  + I +  R    QGP+ I  +PE+LYSA   +++ 
Sbjct: 222 IEYLEFVTQ---LLQAIEKNGSDGELVIPEHRRRTISQGPYNIHGFPEKLYSAVGTKLTV 278

Query: 307 LPIN-SNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELMQLKDTDVKRI 365
           +P+  S   L+ + FDD +  LLF    + MSW  D     N+++L+ + +   T     
Sbjct: 279 VPLGESEAHLLLLSFDDSTNILLFPSTEVLMSWTKD---LKNAYTLMLVEEFTATG---- 331

Query: 366 VSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSKLDFFETTNGI 425
            ++    G   +  DS+  +   ++ +  L   I + NL  L ++NFTS +   +     
Sbjct: 332 TAFATCDGVAVLGIDSAQRVEIPYLQA--LEDCIRDCNLAALQDINFTSSI--CKIPGKF 387

Query: 426 TKCSPCKWRGRDVILFITKEDVYMHP-VEMRKSGILGNNKPVLVNNEELKHQEYKTSFKQ 484
              +     G   I+ +      + P  E  KS     +    ++++  K   Y   F  
Sbjct: 388 HSVARFNAPGNKGIILVGDHHAKIVPSTEAAKS-----DTETELDSQPGKEPTYTVCFPN 442

Query: 485 PVEELMALNKLFQQQCSMGVSKLIAPXXXXXXXXXXXXXXXXXXXSDVSKEVISKIGQGQ 544
            +EE++  NK  Q++    +  L+ P                   +++SKEV+ +I   Q
Sbjct: 443 SLEEILNTNKELQRRKHQPLP-LVPPALKNIPLNSDLNEQHLATLTNISKEVMDRIILSQ 501

Query: 545 NLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTSRSSQLIKRLQ 604
           +  L +H+RL  QQYEL RQ++ V  I S+ S LR  SE  S R      R  +L +RL 
Sbjct: 502 SAGLLMHNRLSLQQYELHRQVETVADICSRHSVLRDSSEAMSSRLTSVLKRDRRLKQRLC 561

Query: 605 DLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRDAQEELNHLKKDLA 664
            L + +  IN+S K  + P++ KE +WF+E++NQ + FN +V      ++EL  LK +L 
Sbjct: 562 MLQSTLNRINSSHKFSDLPLSKKEADWFRELKNQAISFNDYVLQSAQLRDELAFLKNELE 621

Query: 665 RISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKELLSTTEAL 710
            + +     R E+   ++  L+++LK D++II EC   L +    L
Sbjct: 622 SLPEHRQHDRQEEEPFDFRRLQELLKLDSKIITECTDNLSAAAREL 667

>KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {ON}
           weakly similar to uniprot|P40368 Saccharomyces
           cerevisiae YJL061W NUP82 Subunit of the nuclear pore
           complex (NPC) forms a subcomplex with Nup159p and Nsp1p
           interacts with Nup116p and is required for proper
           localization of Nup116p in the NPC
          Length = 687

 Score =  163 bits (413), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 174/675 (25%), Positives = 310/675 (45%), Gaps = 81/675 (12%)

Query: 68  APQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDDGYSPIKQ 127
            P++ ++S SG  +  + N  + V+E+         +  S+ +      K  +    IK+
Sbjct: 60  VPEQMVISPSGGLVAFHANSELYVMEV---------NEQSRLR------KHFNTSLGIKK 104

Query: 128 VLFHPEAYKDSCLVVLYDNGTISLMDVTQI-TKTITL-NKRVATFGIDTQITDIESICFS 185
           +L+HP A      V+L+D+ TI + D+  +  ++IT+ N++  +FG+   +  +  I F 
Sbjct: 105 LLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164

Query: 186 KDGWTLYALSISDGGDIYAFYPCLPQQLEVK---------REKITSL----LHESVLLYE 232
             G TLY LS  +  DIYA +PCLP+   ++         R K  SL    LH+S+ LY 
Sbjct: 165 PTGLTLYLLSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYN 224

Query: 233 SL----KL--DTDRDV-------KRNVIRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYR 279
           SL    KL   +D DV       K ++++Q+QF +         +KN   D     +  R
Sbjct: 225 SLDKQLKLISGSDPDVESDYLTLKHDLLKQIQFFDNY-------KKNDGIDTF-TSKAIR 276

Query: 280 LIRGQGPFTIDPYPERLYSATALEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWD 339
               QGPF I  +P  L +     ++ +P+     L+ + F DG+  +LF D  + MSW 
Sbjct: 277 NSVPQGPFIIKKFPTALNAKEVTGLTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWS 336

Query: 340 VDNYVHNNSFSLVELMQLKDTDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAI 399
           + +    N+ S++ +   K        S P    +    GDSS  ++    W + LA+ I
Sbjct: 337 LRSNTTFNNLSVITMFNAKGQCQLLNSSEP----KLVFTGDSSTTIMEMP-WLEPLAQCI 391

Query: 400 DNSNLNELLEMNFTSKLDFFETTNGITKCSPCKWRGRDVILFITKEDVY-MHPVEMRKSG 458
              + + + ++ F +K+    T +G        + G  V+  ++ + +Y  +  ++ +S 
Sbjct: 392 RLHDFSIIDDVKFENKI---RTVSGT-------FLG--VLSTLSGDILYNGNSFKVIESN 439

Query: 459 ILGNNKPVLVNNEELKHQEYKTSFKQPVEELMALNKLFQQQCS---MGVSKLIAPXXXXX 515
                +  +   +E+K+  YK S     +EL  L   ++ + +    G+   +AP     
Sbjct: 440 DKSTTQKPINRTDEVKYT-YKPSLPTSGKELDMLLTKYKTEANGFISGIPDSLAP----L 494

Query: 516 XXXXXXXXXXXXXXSDVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQ 575
                         S++ KE + ++  GQ +   + ++  E+  EL RQL+  + I   +
Sbjct: 495 PLKNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTNEIEMLR 554

Query: 576 SDLRRKSEEQSRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEI 635
           + L     +   R+     +S  L KRL  L      I N+ KL+   I++ EL WFK I
Sbjct: 555 NKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAELVWFKSI 614

Query: 636 RNQVLKFNSFVHNQRDAQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQI 695
           +NQVLKFN++VH     +EEL  L   L    + T++  D  S+ E+  L+ +L +D ++
Sbjct: 615 KNQVLKFNNYVHLTNKLREELEFLDTQL----RSTTKGDDFFSELEFSSLQQMLLNDKKV 670

Query: 696 IQECNKELLSTTEAL 710
           I  C  EL ++ E L
Sbjct: 671 INSCMNELSASIEDL 685

>Skud_4.174 Chr4 complement(305312..305632) [321 bp, 106 aa] {ON}
           YDL081C (REAL)
          Length = 106

 Score = 35.0 bits (79), Expect = 0.12,   Method: Composition-based stats.
 Identities = 15/25 (60%), Positives = 21/25 (84%), Gaps = 1/25 (4%)

Query: 390 IWSDLLAKAIDNSNLNELLEMNFTS 414
           IW+D+ AKA+DN NL ELL +NF++
Sbjct: 40  IWADIFAKALDNQNLKELL-VNFSA 63

>SAKL0H15378g Chr8 complement(1328983..1340172) [11190 bp, 3729 aa]
           {ON} similar to uniprot|Q750B4 Ashbya gossypii AGR043W
           AGR043Wp and weakly similar to YDR150W uniprot|Q00402
           Saccharomyces cerevisiae YDR150W NUM1 Protein required
           for nuclear migration localizes to the mother cell
           cortex and the bud tip may mediate interactions of
           dynein and cytoplasmic microtubules with the cell cortex
          Length = 3729

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 67/143 (46%), Gaps = 18/143 (12%)

Query: 585 QSRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELE------WFKEIRNQ 638
           + RR   +  + +  +K LQ  D K L+ + +    +Y +  KE E      W  E + Q
Sbjct: 94  ECRRLQSENEKKNTKLKTLQQ-DYKKLQQSFNQLTSKYQLTSKEEESLRDINWELETKLQ 152

Query: 639 VLK------FNSFVHNQRDAQEEL---NHLKKDLARISKETSQLRDEKSDKEWDELRDI- 688
            L         SF  NQR+ Q+++   NH+K +L  +S E   LR+E S K+   L +I 
Sbjct: 153 TLSQEFKDLTESFNKNQREVQKQIDLSNHIKTELEEVSLERIGLREELSSKQQQHLLEIS 212

Query: 689 -LKHDAQIIQECNKELLSTTEAL 710
            LK   Q + E N +L S  E L
Sbjct: 213 ELKKHIQELNEENDQLNSKVEDL 235

>NCAS0D01190 Chr4 complement(217410..217733) [324 bp, 107 aa] {ON}
           Anc_2.388
          Length = 107

 Score = 32.3 bits (72), Expect = 0.96,   Method: Composition-based stats.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 1/25 (4%)

Query: 390 IWSDLLAKAIDNSNLNELLEMNFTS 414
           I++D+ AKA+DN NLN L+ +NF+S
Sbjct: 40  IYADIFAKALDNQNLNTLM-VNFSS 63

>NDAI0H00170 Chr8 complement(16146..18032) [1887 bp, 628 aa] {ON}
           Anc_4.4 YHL038C
          Length = 628

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 41/76 (53%), Gaps = 9/76 (11%)

Query: 623 PINDKELEWFKEIRNQVLK-FNSFVHNQRDA-----QEELNHLKKDLAR-ISKETSQLRD 675
           P N KELE  K  R  ++K FN  +HN+R+A     + EL  LK+ L R IS +T   R 
Sbjct: 251 PCNHKELEKIKNERTSLIKGFNKSIHNRREAKIKPPKGELTSLKRLLERTISHKTLWSRA 310

Query: 676 EKSDK--EWDELRDIL 689
           +  D+    D LR IL
Sbjct: 311 KSEDRTCPADVLRCIL 326

>AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR247C
          Length = 1539

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 31/63 (49%)

Query: 192  YALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTDRDVKRNVIRQVQ 251
            Y  SI+D   I+A   CL + L  + E ITS     +    SL  D   D  R +++QVQ
Sbjct: 1018 YENSINDQDKIFALLDCLERILSNRDEIITSDEEVRIPKVSSLVKDVTSDYHRELLKQVQ 1077

Query: 252  FVN 254
            FV 
Sbjct: 1078 FVG 1080

>Smik_4.155 Chr4 complement(286254..286574) [321 bp, 106 aa] {ON}
           YDL081C (REAL)
          Length = 106

 Score = 31.6 bits (70), Expect = 1.7,   Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 21/26 (80%), Gaps = 1/26 (3%)

Query: 389 HIWSDLLAKAIDNSNLNELLEMNFTS 414
           +IW+D+ AKA+D  NL +LL +NF++
Sbjct: 39  NIWADIFAKALDGQNLKDLL-INFSA 63

>Kpol_1024.9 s1024 complement(34561..41358) [6798 bp, 2265 aa] {ON}
            complement(34561..41358) [6798 nt, 2266 aa]
          Length = 2265

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 28/46 (60%)

Query: 534  KEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLR 579
            +++ +K+GQ  N    +H   L +++EL R+L+ +HT  SK   LR
Sbjct: 1666 RKIDTKVGQLANFFDQMHFDALSKEFELQRELERLHTNKSKYQSLR 1711

>Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 30/45 (66%), Gaps = 4/45 (8%)

Query: 615 NSPKLKEYPINDKELEWF-KEIRNQVLKFNSFVHNQRDAQEELNH 658
           +SP+ K+ P   K+LE+F +E+RN ++K NS   N   A EELNH
Sbjct: 633 SSPRKKDSP---KKLEFFTEELRNLIIKENSLKSNLFPAVEELNH 674

>Ecym_5345 Chr5 complement(699527..703627) [4101 bp, 1366 aa] {ON}
           similar to Ashbya gossypii AER045C
          Length = 1366

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 68/148 (45%), Gaps = 11/148 (7%)

Query: 563 RQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEY 622
           R LK+     +K   L   SEE+     +Q   +++ I+ L D +AK+ ++  +  LK  
Sbjct: 734 RSLKVAKEEYTKDISL---SEEKYSELSNQLDEANKRIRELSDKNAKLDDLKKN-HLKSI 789

Query: 623 PINDKELEWFKE-IRNQVLKFNSFVHNQRDAQEELNHLKKDLARISKETSQLRDE----- 676
             N   L  FK+ I +     +S    ++ A+E +N + ++L  +SKE S L  E     
Sbjct: 790 ENNKSRLAEFKDRIISLEKSLHSITEEKKKAEEGINKMSRELFSLSKEKSLLSTEMDKLK 849

Query: 677 -KSDKEWDELRDILKHDAQIIQECNKEL 703
             SDKE  +L  ++      I +   EL
Sbjct: 850 SASDKEKSKLSQVVGEREAHIAKMKTEL 877

>Kpol_2002.104 s2002 complement(246226..248355) [2130 bp, 709 aa]
           {ON} complement(246226..248355) [2130 nt, 710 aa]
          Length = 709

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 6/83 (7%)

Query: 279 RLIRGQGPFTIDPYPERLYSATALEISTLPI----NSNNELMCMIFDDGSIALLFKDLPL 334
           +LI GQ PF +      +Y + AL I   PI    N+N ELM ++    +I   F D  L
Sbjct: 297 QLIFGQDPFPLTK--AIVYMSNALAIFIDPILRDSNTNTELMSVVIMKNTILYAFMDNLL 354

Query: 335 TMSWDVDNYVHNNSFSLVELMQL 357
            M  + +    ++ +SL++L+++
Sbjct: 355 KMWVESNAKSESDLYSLLDLVKI 377

>YDL081C Chr4 complement(309802..310122) [321 bp, 106 aa] {ON}
           RPP1ARibosomal stalk protein P1 alpha, involved in the
           interaction between translational elongation factors and
           the ribosome; accumulation of P1 in the cytoplasm is
           regulated by phosphorylation and interaction with the P2
           stalk component
          Length = 106

 Score = 30.0 bits (66), Expect = 7.2,   Method: Composition-based stats.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 1/25 (4%)

Query: 389 HIWSDLLAKAIDNSNLNELLEMNFT 413
           +IW+D+ AKA+D  NL +LL +NF+
Sbjct: 39  NIWADIFAKALDGQNLKDLL-VNFS 62

>KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 663

 Score = 31.6 bits (70), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 48/114 (42%), Gaps = 10/114 (8%)

Query: 584 EQSRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQV--LK 641
           E  RR D   + +  L +R Q L+   +E NN   +      D E E   +  NQV   +
Sbjct: 288 ETLRRQDTSAAIAIMLAERKQKLNTSDIENNNGTTI------DAEAELPDQ--NQVDDAR 339

Query: 642 FNSFVHNQRDAQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQI 695
           F     +Q ++QEEL  ++   + I     +  D   D    +L  I  HD +I
Sbjct: 340 FLEEAASQYESQEELKKIRSHTSTICTNIPENNDAVYDTHVPQLSKIRTHDTKI 393

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,205,215
Number of extensions: 3637700
Number of successful extensions: 15420
Number of sequences better than 10.0: 277
Number of HSP's gapped: 16033
Number of HSP's successfully gapped: 322
Length of query: 710
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 593
Effective length of database: 40,065,477
Effective search space: 23758827861
Effective search space used: 23758827861
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)