Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0A032205.698ON61161130860.0
YKR093W (PTR2)5.698ON60158721080.0
Smik_11.3565.698ON60260320970.0
Suva_11.3295.698ON60158820810.0
NDAI0E050205.698ON61959520820.0
KNAG0C065705.698ON59054920110.0
KAFR0H002405.698ON59155219670.0
ZYRO0G06688g5.698ON61361019680.0
CAGL0G02453g5.698ON59758219590.0
KAFR0H00230singletonON59657219450.0
TPHA0N01960singletonON59153519180.0
TBLA0A091205.698ON63361719160.0
Kpol_529.285.698ON61055219140.0
TPHA0O02000singletonON62059718830.0
TDEL0B022305.698ON57455618780.0
SAKL0E14828g5.698ON59259218700.0
KLLA0E12915g5.698ON65453318170.0
TBLA0E01140singletonON61153417870.0
TBLA0B04710singletonON61553117320.0
Skud_11.3315.698ON39938414950.0
Kwal_47.16930na 1ON6115665764e-65
KLTH0D16544gna 1ON6265205232e-57
AGL365Cna 2ON5994994975e-54
Ecym_2823na 2ON6135794888e-53
AFR228WsingletonON5765414438e-47
ADL156Cna 3ON483180810.36
KNAG0G007605.132ON30295790.48
KLLA0F21692gna 4ON1525175780.84
Kwal_33.133241.69ON131068708.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0A03220
         (611 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {O...  1193   0.0  
YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integ...   816   0.0  
Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093...   812   0.0  
Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093...   806   0.0  
NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5...   806   0.0  
KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5...   779   0.0  
KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}...   762   0.0  
ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {...   762   0.0  
CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly...   759   0.0  
KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON}      753   0.0  
TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {...   743   0.0  
TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa] ...   742   0.0  
Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}...   741   0.0  
TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {...   729   0.0  
TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {O...   728   0.0  
SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} simi...   724   0.0  
KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]...   704   0.0  
TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {O...   692   0.0  
TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON}            671   0.0  
Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093...   580   0.0  
Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093...   226   4e-65
KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]...   206   2e-57
AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON} NOH...   196   5e-54
Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar...   192   8e-53
AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-synteni...   175   8e-47
ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON} S...    36   0.36 
KNAG0G00760 Chr7 complement(139276..140184) [909 bp, 302 aa] {ON...    35   0.48 
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    35   0.84 
Kwal_33.13324 s33 complement(170638..174570) [3933 bp, 1310 aa] ...    32   8.8  

>NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {ON}
           Anc_5.698
          Length = 611

 Score = 1193 bits (3086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/611 (95%), Positives = 582/611 (95%)

Query: 1   MFFHREHEKDGADVVTEKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEE 60
           MFFHREHEKDGADVVTEKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEE
Sbjct: 1   MFFHREHEKDGADVVTEKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEE 60

Query: 61  CEPGYEIPTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTP 120
           CEPGYEIPTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTP
Sbjct: 61  CEPGYEIPTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTP 120

Query: 121 AGVLELNSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFIT 180
           AGVLELNSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFIT
Sbjct: 121 AGVLELNSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFIT 180

Query: 181 SIPSIASKDTSLXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLKSGERVVED 240
           SIPSIASKDTSL                 KANLSVLIADQLPKRKPRVKTLKSGERVVED
Sbjct: 181 SIPSIASKDTSLGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPRVKTLKSGERVVED 240

Query: 241 PNITLQNVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQY 300
           PNITLQNVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQY
Sbjct: 241 PNITLQNVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQY 300

Query: 301 VKEGKREKSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVF 360
           VKEGKREKSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVF
Sbjct: 301 VKEGKREKSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVF 360

Query: 361 LFYPIYWVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRF 420
           LFYPIYWVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRF
Sbjct: 361 LFYPIYWVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRF 420

Query: 421 TPFKPITKIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVL 480
           TPFKPITKIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVL
Sbjct: 421 TPFKPITKIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVL 480

Query: 481 IAFSEILASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFG 540
           IAFSEILASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFG
Sbjct: 481 IAFSEILASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFG 540

Query: 541 GLGVAXXXXXXXXXXXXRKYNDTEEEMNAMDYEDEEDLREMESAGANDLELNSTQSLTQR 600
           GLGVA            RKYNDTEEEMNAMDYEDEEDLREMESAGANDLELNSTQSLTQR
Sbjct: 541 GLGVACFIGGCIFWIIFRKYNDTEEEMNAMDYEDEEDLREMESAGANDLELNSTQSLTQR 600

Query: 601 RTGESSEEKNI 611
           RTGESSEEKNI
Sbjct: 601 RTGESSEEKNI 611

>YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integral
           membrane peptide transporter, mediates transport of di-
           and tri-peptides; conserved protein that contains 12
           transmembrane domains; PTR2 expression is regulated by
           the N-end rule pathway via repression by Cup9p
          Length = 601

 Score =  816 bits (2108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/587 (66%), Positives = 463/587 (78%), Gaps = 4/587 (0%)

Query: 7   HEKDGADVVTEKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEECEPGYE 66
           H   G+D   +++  D     +EKTQ +TLK++   S++V +  E Y++    E E  +E
Sbjct: 4   HPSQGSDDAQDEKQGDFPVIEEEKTQAVTLKDSY-VSDDVANSTERYNLSPSPEDE-DFE 61

Query: 67  IPTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLEL 126
            PTEE+M+TLRHV GKIP+RCWLIA+VEL+ERFSYYGLSAPFQNYME GPND+P GVL L
Sbjct: 62  GPTEEEMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSL 121

Query: 127 NSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIA 186
           NS GATGLSYFFQFWCYVTPVFGG++ADT+WGKYNTIC GT IY+AGIFILFITSIPS+ 
Sbjct: 122 NSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVG 181

Query: 187 SKDTSLXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQ 246
           ++D+++                 KANLSVLIADQLPKRKP +K LKSGERV+ D NITLQ
Sbjct: 182 NRDSAIGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQ 241

Query: 247 NVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKR 306
           NVFM+FY M+NVGSLS++ATTELE HK FWAA+LLPFCFFWIAVV L+ G+ QY++    
Sbjct: 242 NVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIG 301

Query: 307 EKSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIY 366
           +K I KSFK+ WI++KNKFD  +AKPS HPEKNYPW DKFVDE  RAL+ACKVF+FYPIY
Sbjct: 302 DKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIY 361

Query: 367 WVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPI 426
           W  YGTMIS+F+TQ SMMELHG+PND  QA DS ALIIFIPI E+F+YPFIRR+TP KPI
Sbjct: 362 WTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPI 421

Query: 427 TKIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLIAFSEI 486
           TKIFFGFMF + AM W+ VLQSF+YKAGP+Y+ PL    PN +HV WQ+PAYVLI+FSEI
Sbjct: 422 TKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSEI 481

Query: 487 LASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVAX 546
            ASITGLEYAYSKAP SMKSFIMS+FL +NA GS +G ALSPV+VDPKFTWLF GL VA 
Sbjct: 482 FASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVAC 541

Query: 547 XXXXXXXXXXXRKYNDTEEEMNAMDYEDEE--DLREMESAGANDLEL 591
                      RKYNDTEEEMNAMDYE+E+  DL  + +  AND+E+
Sbjct: 542 FISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISAPKANDIEI 588

>Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093W
           (REAL)
          Length = 602

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/603 (65%), Positives = 469/603 (77%), Gaps = 7/603 (1%)

Query: 7   HEKDGADVVTEKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEECEPGYE 66
           H    +D V +++  D     +EKT  +TLK++   S++V +  E Y++ H  E E  +E
Sbjct: 4   HPSRSSDEVQDEKQGDFPVIEEEKTHAVTLKDSY-VSDDVANSTEQYNLSHSPEDE-DFE 61

Query: 67  IPTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLEL 126
            PTEE+ +TLRHV GKIP+RCWLIA+VEL+ERFSYYGLSAPFQNYME GPND+P GVL L
Sbjct: 62  APTEEETKTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGL 121

Query: 127 NSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIA 186
           NS GATGLSYFFQFWCYVTPVFGG++ADT+WGKYNTIC GT IY+AGIFILFITSIPS+ 
Sbjct: 122 NSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVG 181

Query: 187 SKDTSLXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQ 246
           ++D+++                 KAN+SVLIADQLPKRKP +K LKSGERV+ D NITLQ
Sbjct: 182 NRDSAIGGFIAAIILIGIATGMIKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQ 241

Query: 247 NVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKR 306
           NVFM+FY M+NVGSLS++ATTELE HK FWAA+LLPFCFFWIAVV L+ G+ QY++    
Sbjct: 242 NVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIG 301

Query: 307 EKSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIY 366
           +K + KSF++ WI++KNKFD  +AKPS HPE+NYPW DKFVDE  RAL+ACKVF+FYPIY
Sbjct: 302 DKVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIY 361

Query: 367 WVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPI 426
           W  YGTMIS+F+TQ SMMELHG+PND  QA DS ALI+FIPI E+F+YPFIRR+TP KPI
Sbjct: 362 WTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPI 421

Query: 427 TKIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLIAFSEI 486
           TKIFFGFMF + AM W+ VLQSF+YKAGP+Y+ PL    PN IHV WQ+PAYVLI+FSEI
Sbjct: 422 TKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFSEI 481

Query: 487 LASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVAX 546
            ASITGLEYAYSKAP SMKSFIMS+FL +NA GS +G ALSPV+VDPKFTWLF GL VA 
Sbjct: 482 FASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVAC 541

Query: 547 XXXXXXXXXXXRKYNDTEEEMNAMDYE--DEEDLREMESAGANDLE-LNSTQSLTQRRTG 603
                      RKYNDTEEEMNAMDYE  DE DL  + +  AND+E L  T+SL  R T 
Sbjct: 542 FISGCLFWLCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTESL--RSTA 599

Query: 604 ESS 606
           + S
Sbjct: 600 KYS 602

>Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093W
           (REAL)
          Length = 601

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/588 (65%), Positives = 461/588 (78%), Gaps = 4/588 (0%)

Query: 6   EHEKDGADVVTEKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEECEPGY 65
            H   G+D + +++  +     +EK Q +TLK++   S++  +  E +++    E +  +
Sbjct: 3   NHLSQGSDDIQDEKQGEFPVVEEEKNQTVTLKDSY-VSDDAANSTERFNLSPSPE-DNEF 60

Query: 66  EIPTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLE 125
           E PT+E++ +LRHV GKIP+RCWLIA+VEL+ERFSYYGLSAPFQNYME GPNDTP G+L 
Sbjct: 61  EAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLS 120

Query: 126 LNSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSI 185
           LNSSGATGLSYFFQFWCYVTPVFGG++ADT+WGKYNTIC GT IY+AGIFILFITSIPS+
Sbjct: 121 LNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180

Query: 186 ASKDTSLXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITL 245
            ++D++L                 KANLSVLIADQLPKRKP +K LKSGERV+ED NITL
Sbjct: 181 GNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITL 240

Query: 246 QNVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGK 305
           QNVFM+FY M+NVGSLS++ATTELE HK FWAA+LLPFCFFW+AVV LV G+ QY++   
Sbjct: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPI 300

Query: 306 REKSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPI 365
            +K I KSFK+ WI++KNKFD  +AKPS HPEK+YPW DKFVDE  RAL+ACKVF+FYPI
Sbjct: 301 GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPI 360

Query: 366 YWVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKP 425
           YW  YGTMIS+F+TQ SMMELHG+PND  QA DS ALIIFIPI E+F YPFIRR+TPFKP
Sbjct: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKP 420

Query: 426 ITKIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLIAFSE 485
           ITKIFFGFMF + AM W+ VLQSF+YKAGP+Y  PL    PN +HV WQ+PAYVLI+FSE
Sbjct: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFSE 480

Query: 486 ILASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVA 545
           I ASITGLEYAYSKAP +MKSFIMS+FL +NA GS +G ALSPV+VDPKFTWLF GL VA
Sbjct: 481 IFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540

Query: 546 XXXXXXXXXXXXRKYNDTEEEMNAMDYEDEE--DLREMESAGANDLEL 591
                       RKYNDTEEEMNAMDYE+E+  DL  +    AND+E+
Sbjct: 541 CFISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISQPKANDIEI 588

>NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON}
           Anc_5.698
          Length = 619

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/595 (66%), Positives = 457/595 (76%), Gaps = 20/595 (3%)

Query: 15  VTEKETVDISEKAQEKTQEITLKE-----TTGSSEEVHDELETYHIHH----------DE 59
           +   E  DI  K  EK +EIT  +     TT S+EE   ++ETY++ +          D+
Sbjct: 8   INTPEIRDIVLK-DEKIEEITTTKKETNATTSSTEEKLHDVETYNLSNSANDSTNDFDDD 66

Query: 60  ECEPGYEIPTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDT 119
           E E GYE PT+E++ TL+ V GKIPLRCWLI +VELAERFSYYGLSAPFQNYM+NGPND+
Sbjct: 67  EMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQNGPNDS 126

Query: 120 PAGVLELNSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFI 179
           P GVL LNSSGATGLSYFFQFWCYVTPVFGGF+ADTYWGKYN+I VGTG Y+ GIFILFI
Sbjct: 127 PKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFI 186

Query: 180 TSIPSIASKDTSLXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLKSGERVVE 239
           T+IPSIAS++ SL                 KANLSVLIADQLPKRKPRVK LKSGERV+E
Sbjct: 187 TAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKSGERVIE 246

Query: 240 DPNITLQNVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQ 299
           DPNITLQNVFM FYLM+N+GS+SV+ATTELE HK FWAA+LLPFCFFWIAVV+LV GR  
Sbjct: 247 DPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVILVFGRKY 306

Query: 300 YVKEGKREKSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKV 359
           YVKE   +  +QKSFK+ WIV+KNK D  +AKPSYHPE+NYPW D+FVDE  R ++ACKV
Sbjct: 307 YVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRTIAACKV 366

Query: 360 FLFYPIYWVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRR 419
           F+FYPIYWV YG+MISTFVTQGS MELHG+PND  Q  DS ALIIFIPI E F+YPFIRR
Sbjct: 367 FVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYPFIRR 426

Query: 420 FTPFKPITKIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYV 479
           FTP +PITKI  GF     AM W+ VLQ FIY  GP YDHPL+   PN+IHV WQ+PAYV
Sbjct: 427 FTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSCDTPNKIHVAWQIPAYV 486

Query: 480 LIAFSEILASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLF 539
           LIAFSEI ASITGLEYAYSKAP SMKSF+MS+FL +NA GSILGIALS V+VDPKF WLF
Sbjct: 487 LIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWLF 546

Query: 540 GGLGVAXXXXXXXXXXXXRKYNDTEEEMNAMDYE---DEEDLREMESAGANDLEL 591
           GGL V+            R  N TEEEMNAMDY+   DE+  R + S+GA+DLE+
Sbjct: 547 GGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAEIDEQSKRHL-SSGADDLEI 600

>KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON}
           Anc_5.698 YKR093W
          Length = 590

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/549 (66%), Positives = 435/549 (79%)

Query: 25  EKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEECEPGYEIPTEEDMETLRHVSGKIP 84
           +   +K   +  KE + + EE    ++     ++++   GYE+PTEE++ TL+HV G IP
Sbjct: 13  DSLDKKNDLVLTKENSHTIEEDSRIVDDLASQYEDDIPEGYEVPTEEELRTLKHVGGHIP 72

Query: 85  LRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELNSSGATGLSYFFQFWCYV 144
           +RCWLIA+VEL+ERFSYYGLSAPFQNYM NGP+D P G+L+LNS GATGLSYFFQFWCYV
Sbjct: 73  MRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSYFFQFWCYV 132

Query: 145 TPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIASKDTSLXXXXXXXXXXXX 204
           TP+FGG+MADT+WGKYNTI VGTGIY+ GIFILF+TSIPSI +K+  L            
Sbjct: 133 TPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFIVAIILIGI 192

Query: 205 XXXXXKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLMVNVGSLSVI 264
                K+NLSVLIADQLPKRKP VKT K+GERV+ED N+TLQNVFM+FYLM+N+GSLSVI
Sbjct: 193 ATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSLSVI 252

Query: 265 ATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFKILWIVSKNK 324
           AT+ELE H+ FWAA+LLPFCFFWIAVVVLV G+NQYVK    +K I K FK+LWI++KN+
Sbjct: 253 ATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVLWILTKNR 312

Query: 325 FDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMISTFVTQGSMM 384
           F+  + KPS +P KNYPW+DKFVDE  RAL ACKVFLFYPIYW  YG M+S FVTQGSMM
Sbjct: 313 FNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGFVTQGSMM 372

Query: 385 ELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMFATGAMVWSC 444
           ELHGLPND FQ IDS A+I+FIP+CE  +YPFIR++TPF+PITKI+FGFMFA+G M+W+ 
Sbjct: 373 ELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFASGCMIWAA 432

Query: 445 VLQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLIAFSEILASITGLEYAYSKAPMSM 504
           VLQS+IYKAGP+Y  PL   GPNRIHV  QVPAYVL+AFSEI ASITGLEYAYSKAP SM
Sbjct: 433 VLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITGLEYAYSKAPASM 492

Query: 505 KSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVAXXXXXXXXXXXXRKYNDTE 564
           KSFIMS+FL +NA GS +G ALSPVS DP +TWL+ GL VA            RKYND E
Sbjct: 493 KSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVCFRKYNDIE 552

Query: 565 EEMNAMDYE 573
           EEMNAMDYE
Sbjct: 553 EEMNAMDYE 561

>KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}
           Anc_5.698 YKR093W
          Length = 591

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/552 (65%), Positives = 433/552 (78%), Gaps = 9/552 (1%)

Query: 34  ITLKET-TGSSEEVHDELETYHIH-------HDEECEPGYEIPTEEDMETLRHVSGKIPL 85
           I LK T   SS+  H + E Y +        H++  E GYEIPT+++M+TLR V G+IP 
Sbjct: 23  IELKNTKVSSSDGEHKDTEAYTLQDGSIEPDHEDYQEEGYEIPTQDEMKTLRRVGGRIPF 82

Query: 86  RCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELNSSGATGLSYFFQFWCYVT 145
           RC+L+ALVELAERFSYYGLSAPFQNYM+NGP D+P GVL+LNSSGATGLSYFFQFWCY+T
Sbjct: 83  RCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLSYFFQFWCYIT 142

Query: 146 PVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIASKDTSLXXXXXXXXXXXXX 205
           P+FGG++ADT WG+YNTI VGT IY+ GIFILFITS  ++A +D +L             
Sbjct: 143 PIFGGYLADTKWGRYNTIGVGTVIYIIGIFILFITSFKTVAGRDGALAGFILALILIGFA 202

Query: 206 XXXXKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLMVNVGSLSVIA 265
               K+NLSVLIADQ+P ++PRVKTLKSGERV+ED ++T+QNVFM+FYLM+N+GSLSVIA
Sbjct: 203 TGLIKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVIA 262

Query: 266 TTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFKILWIVSKNKF 325
           TTELE +  FWAA+LLPFCFFWIAV+V+V G+ QY+ +   ++ I KSFK+ WI+ KNKF
Sbjct: 263 TTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCWILCKNKF 322

Query: 326 DLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMISTFVTQGSMME 385
           D+TSAKPSYHPE  +PW DKFVDE  RAL+ACKVFLFYPIYW  YG M++ F+T GSMM+
Sbjct: 323 DITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMGSMMQ 382

Query: 386 LHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMFATGAMVWSCV 445
           LHGLPNDIFQAI+S +LIIFIPICE+F+YPFIRRFTP +P+T+IF GF+FA  AMVWSCV
Sbjct: 383 LHGLPNDIFQAINSISLIIFIPICEKFLYPFIRRFTPLRPVTRIFCGFIFAAMAMVWSCV 442

Query: 446 LQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLIAFSEILASITGLEYAYSKAPMSMK 505
           LQ FIY  GP Y+ PL  G  N IHVGWQVPAYV IAFSEI ASITGLEYAYSKAP +MK
Sbjct: 443 LQHFIYSTGPNYNRPLELGA-NDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAPANMK 501

Query: 506 SFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVAXXXXXXXXXXXXRKYNDTEE 565
           SFIM+LFLF NA GS +G ALSPVS DP +TWL+G L VA            RKYN  E+
Sbjct: 502 SFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYNKIED 561

Query: 566 EMNAMDYEDEED 577
           EMNA+D+ D E+
Sbjct: 562 EMNALDFTDSEE 573

>ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {ON}
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 613

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/610 (61%), Positives = 448/610 (73%), Gaps = 32/610 (5%)

Query: 17  EKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEECEPGYEIPTEEDMETL 76
           EK  V I +K+ E          +GS E    + + Y + +D+E       PTEE++ +L
Sbjct: 12  EKNKVIIEDKSLE---------VSGSHERGELDFDEYEVPNDDE-------PTEEELRSL 55

Query: 77  RHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELNSSGATGLSY 136
           RHV G IP RCWLIA+VEL+ERFSYYGLSAPFQNYM+NG +D PAGVL+L S GATGL+Y
Sbjct: 56  RHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAY 115

Query: 137 FFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIASKDTSLXXXX 196
           FFQFWCYVTPVFGG++ADTYWGKY TICVGTG+Y+ GIFILFITS+PS+ SK+T+L    
Sbjct: 116 FFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFI 175

Query: 197 XXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLMV 256
                        KANLSVLIADQ PKRKPR+KT K GERV+EDPNIT+QNVFM+FYLM+
Sbjct: 176 TAIVLIGIATGMIKANLSVLIADQFPKRKPRIKTTKRGERVIEDPNITIQNVFMFFYLMI 235

Query: 257 NVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFKI 316
           N+GSLSVIATTELEEHK FWAA+LLPFCFFWIAV+VL  GR  YV+    +K I KSF++
Sbjct: 236 NIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRV 295

Query: 317 LWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMIST 376
           L  + K++FD  + KPS HPE++YPW D FV+E  RAL ACKVF+FYPIYWV YG M ST
Sbjct: 296 LGQLIKHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTST 355

Query: 377 FVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMFA 436
           FV+ G  M+LHGLPND FQAIDS ALI+FIPICE ++YPFIRR+TPFKPITKIFFGFM+ 
Sbjct: 356 FVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWC 415

Query: 437 TGAMVWSCVLQSFIYKAGPYYDHPLNG-GGPNRIHVGWQVPAYVLIAFSEILASITGLEY 495
           + +M+W+ VLQ FIYK GP YDHP++   GPN IH+GWQVPAYVLIAFSEI ASITGLEY
Sbjct: 416 SASMIWAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEY 475

Query: 496 AYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVAXXXXXXXXXX 555
           AYSKAP SMKSFIMS+FL +NA GS +G ALSPV  DPK+ W+F GL VA          
Sbjct: 476 AYSKAPTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWL 535

Query: 556 XXRKYNDTEEEMNAMDYEDEE------------DLREMESAGANDL--ELNSTQSLTQRR 601
                NDTEEEMNAMDYE+ +            DL E E AGA+D    + S  +   R 
Sbjct: 536 TFHHLNDTEEEMNAMDYEENQEKIDDGLQKGTSDL-EFEPAGADDKLDHIGSHGATGFRH 594

Query: 602 TGESSEEKNI 611
            GE  EE  +
Sbjct: 595 DGELGEEGEL 604

>CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093w PTR2
          Length = 597

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/582 (62%), Positives = 437/582 (75%), Gaps = 6/582 (1%)

Query: 2   FFHREHEKDGADVVTEKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEEC 61
           F  R  EK+  +V  +K+   I + + ++  EI  +E      +  +    + +  D++ 
Sbjct: 5   FSKRNDEKNAVEV--QKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDDD- 61

Query: 62  EPGYEIPTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPA 121
              +E PTEE+++TLRHV+G IPLRCWLIA+VEL+ERFSYYGLSAPFQNYM+NGPND P 
Sbjct: 62  ---FEAPTEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPK 118

Query: 122 GVLELNSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITS 181
           G+L L S GATGLSYFFQFWCYVTPVFGG+++DTYWGKYNTICVGT IY+ GIFILFITS
Sbjct: 119 GLLGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITS 178

Query: 182 IPSIASKDTSLXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLKSGERVVEDP 241
           IP + + D +L                 K+NLSVLIADQLP +KPRV   K GERV+EDP
Sbjct: 179 IPGVTNSDGALGGFIAAIILIGIATGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDP 238

Query: 242 NITLQNVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYV 301
           N+TLQNVFM+FY  +NVGSLSV+ATTELE HK FWAA+LLPFCFFW+AV VLV GRNQY+
Sbjct: 239 NLTLQNVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYI 298

Query: 302 KEGKREKSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFL 361
           K    +K I KSFK+L+I+SKNKF+  +AKPS++P+KN+PW+DKFVDE  RAL ACKVF+
Sbjct: 299 KPPVGDKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFV 358

Query: 362 FYPIYWVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFT 421
           FYP+YWV YGTM++ FVTQG  MELH LPND  QA DS ALIIFIPI ERF+YPFIRR+T
Sbjct: 359 FYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYT 418

Query: 422 PFKPITKIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLI 481
           P +PITKIFFGFM  +GAMVW+ VLQ FIY  GP+YDHPL+   PN IHV WQ+PAYVLI
Sbjct: 419 PLRPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVLI 478

Query: 482 AFSEILASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGG 541
           A SEI ASITGLEYAYSKAP SMKSFIMS+FL +NA GS +G ALSPVSVDPKF W + G
Sbjct: 479 AISEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTG 538

Query: 542 LGVAXXXXXXXXXXXXRKYNDTEEEMNAMDYEDEEDLREMES 583
           L  A               ND EE MNA+DYE +E + +  S
Sbjct: 539 LACACFIAGWVFWFIYSGLNDEEEAMNALDYEHDEFMYKHHS 580

>KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON} 
          Length = 596

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/572 (63%), Positives = 437/572 (76%), Gaps = 14/572 (2%)

Query: 17  EKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEECEP--------GYEIP 68
           EK +V   EK       I LK+TT SSE+   + E+Y + +D E +P        GYE+P
Sbjct: 11  EKLSVITDEK-----NNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMP 65

Query: 69  TEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELNS 128
           TEE++ TLRHVSG+IP RC+LIA+VEL+ERFSYYGLSAPFQNYM N P+D+P GVL+LNS
Sbjct: 66  TEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNS 125

Query: 129 SGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIASK 188
            GATGLSYFFQFWCY+TPV GG++ADT WG+YNTI VGTGIY+ GIF+LFITS  SIA K
Sbjct: 126 DGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGK 185

Query: 189 DTSLXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQNV 248
           + +L                 KANLSVLIADQ+P ++PRVKTLKSGERV+ED +IT+QNV
Sbjct: 186 NGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNV 245

Query: 249 FMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREK 308
           FM+FYLM+N+GSLSVIATTELE+H  FWAA+LLPFCFFWIAV+VLV GR  Y  +   ++
Sbjct: 246 FMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDR 305

Query: 309 SIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYWV 368
            I+KSFK  W ++KNKF+ ++  P+ +PE  + W DKFV+E   AL+ACKVFLFYPIYW 
Sbjct: 306 VIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWT 365

Query: 369 IYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPITK 428
            YG M + FVT GSM++LHGLPNDIFQAIDS ALI+FIPICE+F YPFIRRFTPF+PITK
Sbjct: 366 CYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITK 425

Query: 429 IFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLIAFSEILA 488
           I +GF  A+ +MVW+CVLQ FIYK GP Y HPL   GPN +HV WQVPAYVLIAFSEI A
Sbjct: 426 ITYGFWLASASMVWACVLQYFIYKTGPNYKHPL-ADGPNNVHVAWQVPAYVLIAFSEIFA 484

Query: 489 SITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVAXXX 548
           SITGLEYAYSKAP SMKSFIM+LFLF NA GS +G ALSPVS DP +TWL+ GL V    
Sbjct: 485 SITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFI 544

Query: 549 XXXXXXXXXRKYNDTEEEMNAMDYEDEEDLRE 580
                    R YND E+EMNA++YEDE+ + E
Sbjct: 545 TGCAFWFCFRHYNDIEDEMNALNYEDEDIITE 576

>TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {ON}
           
          Length = 591

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/535 (65%), Positives = 417/535 (77%), Gaps = 5/535 (0%)

Query: 68  PTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELN 127
           PTEE+++TLRHVSG IPLRCWLIA+VELAERFSYYGLSAPFQNYM NGPNDTP G+L+LN
Sbjct: 57  PTEEELKTLRHVSGYIPLRCWLIAIVELAERFSYYGLSAPFQNYMANGPNDTPKGLLQLN 116

Query: 128 SSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIAS 187
           SSGAT +SYFFQFWCYVTP+FGG+MADT+WGKYNTIC GTGIY++GIFILF+TSI SI +
Sbjct: 117 SSGATAISYFFQFWCYVTPIFGGYMADTHWGKYNTICTGTGIYVSGIFILFMTSIESITT 176

Query: 188 KDTSLXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQN 247
           ++ +                  K+N+SVLIA+Q+PKRK RV T   GERV+EDP +T+QN
Sbjct: 177 QNAARGGYIAAIILIGIATGMIKSNISVLIAEQVPKRKIRVITTSKGERVIEDPKLTVQN 236

Query: 248 VFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKRE 307
           +FM+FYLM+N+GSLSVIATTELE HK FWAA+LLPFCFFWIAVVVL+ G+ QYV++   +
Sbjct: 237 IFMFFYLMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWIAVVVLIVGKKQYVRKPVGD 296

Query: 308 KSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYW 367
           K I K F I WI  KNK D  SAKPS HPE NYPWTDKFV+E  RA+ ACKVFLFYPIYW
Sbjct: 297 KVISKCFTITWIAFKNKLDFDSAKPSCHPEANYPWTDKFVEEVRRAIRACKVFLFYPIYW 356

Query: 368 VIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPIT 427
            +YG M++ FVTQ   MELHGLPND  QAIDS A+I+FIPICE+F+YPFIR+FTPF+ IT
Sbjct: 357 CVYGQMLNNFVTQAGTMELHGLPNDFLQAIDSIAIIVFIPICEKFLYPFIRKFTPFRSIT 416

Query: 428 KIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLNGGG-----PNRIHVGWQVPAYVLIA 482
           KIF+GFMF + AM+W+ VLQSFIYKAGP +D PL         PN++H+ WQVPAYVLIA
Sbjct: 417 KIFWGFMFGSAAMIWAAVLQSFIYKAGPCFDKPLACAAQYAHTPNQVHIAWQVPAYVLIA 476

Query: 483 FSEILASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGL 542
           FSEI ASITGLEYAYS AP SMKSFIMS+FL + A GS LGIA+SP SVDPKFTW F GL
Sbjct: 477 FSEIFASITGLEYAYSNAPESMKSFIMSIFLLTTAFGSALGIAISPTSVDPKFTWAFTGL 536

Query: 543 GVAXXXXXXXXXXXXRKYNDTEEEMNAMDYEDEEDLREMESAGANDLELNSTQSL 597
            V+            RKYN+TE+ M+ +D+ DE+       A +    + ST+S+
Sbjct: 537 AVSCFIAGCLFWICFRKYNNTEDSMDEIDFIDEKVTDMANKASSFISPVLSTKSV 591

>TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa]
           {ON} Anc_5.698 YKR093W
          Length = 633

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/617 (59%), Positives = 455/617 (73%), Gaps = 20/617 (3%)

Query: 3   FHREHEKDGADVVTEKETVDISEKAQEKTQEIT----LKETTGSSEEVHDELETYH---- 54
           F  E+E+     V +  T+D+++  Q   Q +     +       E+   + ET+     
Sbjct: 13  FETENEQ-----VNDVTTIDVTDNNQNVVQMVNGGGDIDYIPTQDEKRDQKFETFQEDSS 67

Query: 55  IHHDEE--CEPGYEIPTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYM 112
           I +DE       +E PTEE++ TL+HV GKIPLRCWL+A++ELAERFSYYGLSAPFQNYM
Sbjct: 68  IINDENEVITEDFEEPTEEELRTLKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYM 127

Query: 113 ENGPNDTPAGVLELNSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLA 172
           +NGPND+P G L L+SSGATGLSYFFQFWCY+TPVF G+MADTYWGK+ TIC+GTGIY+ 
Sbjct: 128 QNGPNDSPPGALSLDSSGATGLSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIV 187

Query: 173 GIFILFITSIPSIASKDTSLXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLK 232
           GIFILFITS+PSI S +T++                 KANLSV+IA+Q+PKRK RV T K
Sbjct: 188 GIFILFITSLPSITSHNTAMGGFIVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKK 247

Query: 233 SGERVVEDPNITLQNVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVV 292
           +G RV+EDP+IT+QNVFM FY M+N+GSLSVIATTELE HK FWAA+LLPFCFFW+AV+V
Sbjct: 248 NGTRVIEDPDITIQNVFMTFYFMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIV 307

Query: 293 LVGGRNQYVKEGKREKSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSR 352
           L+ G   Y+K    +K I K FK+L I+ +N+F+  SAKP+++P+KNYPW+DKFVDE  R
Sbjct: 308 LIVGNKTYIKTPVGDKVISKCFKVLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMR 367

Query: 353 ALSACKVFLFYPIYWVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERF 412
           AL ACKVF+FYPIYWV YG M++ FV+QG  MELHGLPND FQAIDS ALI+FIPICERF
Sbjct: 368 ALQACKVFVFYPIYWVCYGQMLNNFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERF 427

Query: 413 IYPFIRRFTPFKPITKIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLN-GGGPNRIHV 471
           +YPFIR++TPFKPITKIF+GF F   +M W+CVLQ FIYKA P YDHP     GPN IHV
Sbjct: 428 VYPFIRKYTPFKPITKIFWGFTFGALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIHV 487

Query: 472 GWQVPAYVLIAFSEILASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSV 531
             QVPAY L+A SEI ASITGLEYAYSKAP SMK+FIMS+FL +NA G+ +G ALSPVS 
Sbjct: 488 ALQVPAYCLLALSEIFASITGLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSK 547

Query: 532 DPKFTWLFGGLGVAXXXXXXXXXXXXRKYNDTEEEMNAMDYEDEEDLREMESAGANDLEL 591
           DPK+ WL+GGL VA            +KYND EEE+N +D+E+ +D+ E + AG  D+E+
Sbjct: 548 DPKYVWLYGGLAVACFVGGCLFWIIFKKYNDMEEELNNLDFEEGDDMLETKHAG--DIEM 605

Query: 592 NSTQSLTQRRTGESSEE 608
              Q ++ RR+   S E
Sbjct: 606 --IQPISSRRSSLKSNE 620

>Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}
           complement(82303..84135) [1833 nt, 611 aa]
          Length = 610

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/552 (63%), Positives = 430/552 (77%), Gaps = 8/552 (1%)

Query: 42  SSEEVHDELETYHIHHDE---ECEPGYEIPTEEDMETLRHVSGKIPLRCWLIALVELAER 98
           +S +  D+LE   +  D+   +    +  PTEE+M+TL+HVSGKIP+RCWLIA+VEL+ER
Sbjct: 39  TSLQNSDQLEITKVGDDDIEYDDNQDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSER 98

Query: 99  FSYYGLSAPFQNYMENGPNDTPAGVLELNSSGATGLSYFFQFWCYVTPVFGGFMADTYWG 158
           FSYYGL+APFQNYM NGPNDTP GVL L++ GA+ LSYFFQFWCY+TP+FGG+MADTYWG
Sbjct: 99  FSYYGLAAPFQNYMANGPNDTPKGVLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWG 158

Query: 159 KYNTICVGTGIYLAGIFILFITSIPSIASKDTSLXXXXXXXXXXXXXXXXXKANLSVLIA 218
           KYNTIC GTGIY+ GIF+LFITS+PSI +++T+L                 KAN+SVLIA
Sbjct: 159 KYNTICAGTGIYVVGIFLLFITSLPSIDTRETALGGYVTAIILIGIATGMIKANISVLIA 218

Query: 219 DQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLMVNVGSLSVIATTELEEHKNFWAA 278
           +Q+P+ KPRV T K G+RV+EDPNIT QNVFM+FY+M+NVGSLS++ATTELE HK FWAA
Sbjct: 219 EQIPRTKPRVITQKGGKRVIEDPNITTQNVFMFFYMMINVGSLSLMATTELESHKGFWAA 278

Query: 279 FLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFKILWIVSKNKFDLTSAKPSYHPEK 338
           +LLPFCFFWIAVVVLV GRNQY+     +K I KSFK++WI+ KNK +  +AKPS +PEK
Sbjct: 279 YLLPFCFFWIAVVVLVIGRNQYIMVPVGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEK 338

Query: 339 NYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMISTFVTQGSMMELHGLPNDIFQAID 398
           NYPW DKFV+E  RAL ACKVF+FYPIYW +YG MI+ FVTQ   MELH LPND  QA D
Sbjct: 339 NYPWNDKFVEEIRRALRACKVFVFYPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFD 398

Query: 399 SFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMFATGAMVWSCVLQSFIYKAGPYYD 458
           S A+I+FIPI ERFIYPF+RRFTPF+PITKIF+GFMF +GAM+W+ VLQSFIYKAGP Y+
Sbjct: 399 SIAIIVFIPIFERFIYPFVRRFTPFRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYN 458

Query: 459 HPLN-----GGGPNRIHVGWQVPAYVLIAFSEILASITGLEYAYSKAPMSMKSFIMSLFL 513
            P+         PN++HV WQVPAYVLIA SEILAS+TGLEYAYS AP SMKSFIMS+FL
Sbjct: 459 MPMKCAPEYANTPNQVHVAWQVPAYVLIAISEILASVTGLEYAYSNAPASMKSFIMSIFL 518

Query: 514 FSNAGGSILGIALSPVSVDPKFTWLFGGLGVAXXXXXXXXXXXXRKYNDTEEEMNAMDYE 573
            +NA GS +GIA+SP + DPK+TW F GL VA            R YN+TE+ MN +D+ 
Sbjct: 519 VTNAFGSAIGIAISPTAQDPKYTWTFTGLAVACFIAGCLFWICFRSYNNTEDAMNDIDFM 578

Query: 574 DEEDLREMESAG 585
           D++D + M +AG
Sbjct: 579 DDDDDKIMPTAG 590

>TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {ON}
           
          Length = 620

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/597 (58%), Positives = 441/597 (73%), Gaps = 29/597 (4%)

Query: 25  EKAQEKTQEITL----KETTGSSEEVHDELETYHIHHDEECEP-----GYEIPTEEDMET 75
           EK  + + ++T     K    ++EE  DE        D+E +P     GY  PTEE+M T
Sbjct: 29  EKELDSSHDVTFNIDDKVENDTNEEELDEFAV-----DDEADPYNDEWGYVEPTEEEMAT 83

Query: 76  LRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELNSSGATGLS 135
           L+HV+G IP RCWLIA+VEL+ERFSYYGLSAPFQNYM NGPNDTP G+L+LN++GATGLS
Sbjct: 84  LKHVAGHIPYRCWLIAVVELSERFSYYGLSAPFQNYMANGPNDTPKGILQLNTNGATGLS 143

Query: 136 YFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIASKDTSLXXX 195
           YFFQFWCY+TP+FGG+MADTYW KYNTI VGT IY+ GIFILFIT+IPSIA+K+T+    
Sbjct: 144 YFFQFWCYITPIFGGYMADTYWNKYNTIAVGTVIYIIGIFILFITAIPSIATKETATGGF 203

Query: 196 XXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLM 255
                         KANLSVL+A+Q+PKRK RV T K GERV+EDP+IT+QNVFM+FYLM
Sbjct: 204 VTAIILIGIGTGMIKANLSVLVAEQIPKRKHRVITTKKGERVIEDPDITMQNVFMFFYLM 263

Query: 256 VNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFK 315
           +N+G+LSV+ATTELE HK FWAA+LLPFCFFWIAVV+LV GRN Y+ +   +K I K FK
Sbjct: 264 INIGALSVLATTELESHKGFWAAYLLPFCFFWIAVVILVMGRNSYIIKPVGDKVISKCFK 323

Query: 316 ILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMIS 375
           + +IV KNKF+  SAKPS +PE  YPW+DKFVDE +R++ ACKVF+FYPIYW +YG MI+
Sbjct: 324 VTFIVCKNKFNFDSAKPSLNPEMQYPWSDKFVDEINRSIKACKVFIFYPIYWCVYGQMIN 383

Query: 376 TFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMF 435
            F+TQ   MELH +PND  Q  DS  +I+FIPI ERF+YP IRRFTP KPITKIF GFM 
Sbjct: 384 NFITQAGTMELHNIPNDFLQVFDSIGIIVFIPIFERFVYPTIRRFTPLKPITKIFLGFMC 443

Query: 436 ATGAMVWSCVLQSFIYKAGPYYDHPLNGGG-----PNRIHVGWQVPAYVLIAFSEILASI 490
            + AMVW+ VLQSFIYKAGP YDHP+  G      PNR+HV WQ+PAYV+IA+SEI AS+
Sbjct: 444 GSCAMVWAAVLQSFIYKAGPCYDHPMACGPEYTNIPNRVHVAWQIPAYVIIAWSEIFASV 503

Query: 491 TGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVAXXXXX 550
           TGLE+AYS AP SMK+FIMS+FLF+NA G+ LG+A+SP SVDPK+TW+F GL V+     
Sbjct: 504 TGLEFAYSNAPDSMKAFIMSIFLFTNAIGAALGVAISPTSVDPKYTWVFTGLAVSCFVAG 563

Query: 551 XXXXXXXRKYNDTEEEMNAMDYEDEE------DLREMESAGANDLE----LNSTQSL 597
                    YND + +M A+D+ +++      D+ +  S+G + +E    + S +SL
Sbjct: 564 CLFWICFHHYNDIDADMKAIDFVEDDMINASGDVEKTASSGFSTVEPIISMRSAKSL 620

>TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {ON}
           Anc_5.698 YKR093W
          Length = 574

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/556 (62%), Positives = 423/556 (76%), Gaps = 1/556 (0%)

Query: 31  TQEITLKETTGSSEEVHDEL-ETYHIHHDEECEPGYEIPTEEDMETLRHVSGKIPLRCWL 89
           T  +   E   + E V D+L E    H+  E E   + PTEE+M+TL+HV+G IP RCWL
Sbjct: 9   TDGVDSVEKQKAVEVVDDKLVEVISSHNGLEVESYDDEPTEEEMKTLKHVAGTIPFRCWL 68

Query: 90  IALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELNSSGATGLSYFFQFWCYVTPVFG 149
           IA+VEL+ERF+YYGLS PFQNYM+NGP+DTPAG+L L S GATGLSYFFQFWCYVTP+FG
Sbjct: 69  IAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFWCYVTPIFG 128

Query: 150 GFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIASKDTSLXXXXXXXXXXXXXXXXX 209
           G+++DTY GKYNTIC GTG+Y+ GI ILF+TSIPSI +++ +                  
Sbjct: 129 GWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNAATGGFIAAIILIGIATGMI 188

Query: 210 KANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLMVNVGSLSVIATTEL 269
           K+N+SVLIADQ PK++ RV T K G RV+EDPNITLQNVFM FYLM+N+GSLSVIATTEL
Sbjct: 189 KSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSLSVIATTEL 248

Query: 270 EEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFKILWIVSKNKFDLTS 329
           E H  FWAA+LLPFCFFWIAV+VL  G+N YVK    +K I K FK++ I  KNKF+  +
Sbjct: 249 EAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAIKNKFNFEA 308

Query: 330 AKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMISTFVTQGSMMELHGL 389
           AKPS  P++ +PWTDKFVDE  R+LSACKVFLFYP+YWV YG M++TFV+ G  MELHGL
Sbjct: 309 AKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVGGTMELHGL 368

Query: 390 PNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMFATGAMVWSCVLQSF 449
           PND FQAIDS ALI+FIPICE F+YP+IR+FTPF+PITKIF+GFMF   AMVW+ VLQ F
Sbjct: 369 PNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMVWAAVLQHF 428

Query: 450 IYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLIAFSEILASITGLEYAYSKAPMSMKSFIM 509
           IYK+GP+Y +P+    PN IH+ WQVPAYVLIAFSEI ASITGLEYAYSKAP++MKSFIM
Sbjct: 429 IYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVTMKSFIM 488

Query: 510 SLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVAXXXXXXXXXXXXRKYNDTEEEMNA 569
           ++FL +NA GS +G ALSPV+ DP + WL+ GLGVA            + YNDTEE MNA
Sbjct: 489 AIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYNDTEEAMNA 548

Query: 570 MDYEDEEDLREMESAG 585
           +DY+++  + +    G
Sbjct: 549 LDYDEDPTMLKHSKDG 564

>SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32901 Saccharomyces cerevisiae YKR093W PTR2
           Functions in transport of small peptides into the cell
           Peptide transporter
          Length = 592

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/592 (61%), Positives = 440/592 (74%), Gaps = 19/592 (3%)

Query: 16  TEKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEECEPGYEIPTEEDMET 75
           TE E V ++   +   ++I   E   S  +V D+ +  +   D   EP     T+E+M+T
Sbjct: 11  TETEVV-VTSSPENSVEKIARPE---SFVDVLDKNQYINADSDHGREP-----TDEEMKT 61

Query: 76  LRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELNSSGATGLS 135
           LRHVS +IP+RCWL+A+VELAERFSYYGLSAPFQNYM+NGPNDTP G+L L + GAT LS
Sbjct: 62  LRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALS 121

Query: 136 YFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIASKDTSLXXX 195
           YFFQFWCYV+P+ GGF+ADTYWGKY TICVGTGIY+ GIFILFITS+PSI     SL   
Sbjct: 122 YFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGF 181

Query: 196 XXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLM 255
                         KAN+SVLIADQ+PK +P VK LKSGERV+EDPNIT+QN+FM+FYLM
Sbjct: 182 ITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLM 241

Query: 256 VNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFK 315
           +N+GSLSVIATTE+E H  FWAA+LLPFCFF++AV VL+ GRNQYVK    +K I KSFK
Sbjct: 242 INIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFK 301

Query: 316 ILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMIS 375
           + WIV +NKF   +A+PS +PE  YPW+DKF+DE  RA++ACKVF+FYPIYWV YG M+S
Sbjct: 302 VCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLS 361

Query: 376 TFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMF 435
            FV+Q  MMELHGLPND  QAIDS ALI+FIPICERF+YPFIRRFTPF+PITKIF+GF+F
Sbjct: 362 NFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIF 421

Query: 436 ATGAMVWSCVLQSFIYKAGPYYDHPLNGG-----GPNRIHVGWQVPAYVLIAFSEILASI 490
              AM W+ VLQ FIYKAGP Y +P+         PNRIH+ WQVPAYVLIAFSEI ASI
Sbjct: 422 GALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASI 481

Query: 491 TGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVAXXXXX 550
           TGLEYAYSKAP+SM+SFIMS+FL + A GS LGIALS VSV+PKF W F GL V+     
Sbjct: 482 TGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAG 541

Query: 551 XXXXXXXRKYNDTEEEMNAMDYEDEEDLREMESAGANDLE----LNSTQSLT 598
                   KYNDTEE MNA+DYE E+D+     +   DLE    +NS + +T
Sbjct: 542 CLFWAFFHKYNDTEEAMNAIDYE-EDDVLNYGVSIHYDLEPIASVNSDKRIT 592

>KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 654

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/533 (62%), Positives = 398/533 (74%), Gaps = 6/533 (1%)

Query: 58  DEECEPGYEIPTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPN 117
           D + E G E PTEE++ TLRHVS +IP  CWLIA+VELAERFSYYGLSAPFQNYM+NGPN
Sbjct: 88  DNQNENGRE-PTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPN 146

Query: 118 DTPAGVLELNSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFIL 177
           DTP GVL+L S GAT LSYFFQFWCYVTP+ GG++ADT+WGKYNTICVG   Y+ GI IL
Sbjct: 147 DTPKGVLQLKSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILIL 206

Query: 178 FITSIPSIASKDTSLXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLKSGERV 237
           F+T+IPSI  K++SL                 KANLSVLIADQ+PK +PR+K LK+GE+V
Sbjct: 207 FMTAIPSINDKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKV 266

Query: 238 VEDPNITLQNVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGR 297
           +EDPN+T+QNVFM+FYLM+N+GSLSV+ATT LE    FWAA+LL FCFFW+ +VVLV GR
Sbjct: 267 IEDPNVTMQNVFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGR 326

Query: 298 NQYVKEGKREKSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSAC 357
            +YV+    +  I + FKI WI   N F+L  A PS +PEK YPW D F+DE  RA  AC
Sbjct: 327 KKYVRRPIGDHVIARCFKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKAC 386

Query: 358 KVFLFYPIYWVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFI 417
           KVF FYPIYWV+YG M++ FVTQ   MELHGLPND  QAI+S ALI+FIPI E+FIYPFI
Sbjct: 387 KVFAFYPIYWVVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFI 446

Query: 418 RRFTPFKPITKIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLN-----GGGPNRIHVG 472
           RRFTPF+P+TKIF GF F + AMV++ VLQ FIYKAGP YD P++        PNR+H+G
Sbjct: 447 RRFTPFRPVTKIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIG 506

Query: 473 WQVPAYVLIAFSEILASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVD 532
           WQVPAYVLI+ SEI ASITGLEYAYSKAP +MK+FIMS+FL +NA GS LGIALSP + +
Sbjct: 507 WQVPAYVLISLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAEN 566

Query: 533 PKFTWLFGGLGVAXXXXXXXXXXXXRKYNDTEEEMNAMDYEDEEDLREMESAG 585
           PK+ W F GL VA              YN  EE +NA+DY+ EE  + +   G
Sbjct: 567 PKYVWTFSGLAVACFIAGCLFWLCFHHYNKDEEALNALDYKTEEQEQMLSGVG 619

>TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/534 (62%), Positives = 399/534 (74%), Gaps = 4/534 (0%)

Query: 68  PTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELN 127
           PTEE+M TL+ V G IP RCWL+A++EL+ERFSYYGLSAPFQNYM+NGP DTP G L LN
Sbjct: 71  PTEEEMRTLKRVGGYIPARCWLMAVIELSERFSYYGLSAPFQNYMQNGPYDTPPGALSLN 130

Query: 128 SSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIAS 187
           + GATGLSYFFQFWCY+TP+FGG+MADTYWGKYNTI VG   Y+ GIFILF+TS+P + S
Sbjct: 131 TQGATGLSYFFQFWCYITPIFGGYMADTYWGKYNTIWVGVISYICGIFILFMTSLPKLTS 190

Query: 188 KDTSLXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQN 247
              ++                 KANLSV+IA+Q+PKRK R+ T K G RV+EDP+ITLQN
Sbjct: 191 YSAAMGGFIVSIIIIGLGTGMIKANLSVMIAEQVPKRKRRIITRKDGTRVIEDPDITLQN 250

Query: 248 VFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKRE 307
           VFM FY M+NVGSLSV+ATTELE  K FWAA+LLPFCFFW+AVVVL+ G  +++K    +
Sbjct: 251 VFMAFYFMINVGSLSVMATTELEARKGFWAAYLLPFCFFWVAVVVLMIGNKRFIKVPIGD 310

Query: 308 KSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYW 367
           K+I KSFK++ I+ KNKF+  SAKPS HPE NYPWTDKFV+E  RA+ AC VF FYPIYW
Sbjct: 311 KTISKSFKVVGILIKNKFNYESAKPSIHPECNYPWTDKFVEEIRRAIKACNVFYFYPIYW 370

Query: 368 VIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPIT 427
           V YG M++ FVTQG  MELH LPND  Q IDS ALI+FIPICER IYPF+RRFTP +PIT
Sbjct: 371 VCYGQMLNNFVTQGGQMELHDLPNDFLQVIDSIALIVFIPICERLIYPFVRRFTPLRPIT 430

Query: 428 KIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLNG-GGPNRIHVGWQVPAYVLIAFSEI 486
           KI  GF F + +MVW+ VLQ F+Y+  P Y HP N   GPN IHV WQVPAY LIA SEI
Sbjct: 431 KITIGFFFGSFSMVWAAVLQWFVYQKPPCYYHPTNCPNGPNHIHVCWQVPAYCLIALSEI 490

Query: 487 LASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVAX 546
            ASITGLEYAYSKAP SMKSFIMS+FLF+ A GS LG ALSPVS+DPKFTW + GL V+ 
Sbjct: 491 FASITGLEYAYSKAPASMKSFIMSIFLFTTAIGSALGAALSPVSIDPKFTWQYVGLAVSC 550

Query: 547 XXXXXXXXXXXRKYNDTEEEMNAMDYEDEEDLREMESAGANDLELNSTQSLTQR 600
                       +YND E+E+N +D  D+ D+ ++ S   ND +L +  S+  R
Sbjct: 551 FIAGIAFWLCFSRYNDEEDELNNID--DQPDVIQISSENEND-DLEAKNSIRSR 601

>TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/531 (62%), Positives = 406/531 (76%), Gaps = 2/531 (0%)

Query: 68  PTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELN 127
           PTEE+++TL   +G IP  CWL+A++ELAERFSYYGLSAPFQNYM+N P+D P G L LN
Sbjct: 67  PTEEELKTLPREAGHIPFNCWLLAIIELAERFSYYGLSAPFQNYMQNNPSDNPPGALSLN 126

Query: 128 SSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIAS 187
           S+GATGLSYFFQFWCYVTP+F GFMADTYWGK+NT+C+GT IY+ GIFILFITS+P+I S
Sbjct: 127 STGATGLSYFFQFWCYVTPIFAGFMADTYWGKFNTLCIGTIIYIIGIFILFITSLPAITS 186

Query: 188 KDTSLXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLK-SGERVVEDPNITLQ 246
            +T+L                 KANLSV+IADQLPK+K RV T K SG+RV+EDP +T+Q
Sbjct: 187 YNTALGGFIVAIILIGIATGMIKANLSVMIADQLPKKKLRVVTKKKSGKRVIEDPQLTIQ 246

Query: 247 NVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKR 306
           NVFM FY M+NVGSLSVIATTELE H  FWAA+LLPFCFFWIAV+VL  G  ++VK+   
Sbjct: 247 NVFMAFYFMINVGSLSVIATTELELHVGFWAAYLLPFCFFWIAVLVLAFGNRKFVKKPIG 306

Query: 307 EKSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIY 366
           ++ I K F I+ I+ KN F+   AKP+Y+PEKNYPW+DKFVDE  R+L ACKVFLFYPIY
Sbjct: 307 DRVISKCFTIIGILIKNNFNFQKAKPTYNPEKNYPWSDKFVDEIQRSLKACKVFLFYPIY 366

Query: 367 WVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPI 426
           WV YG M++ FVTQGS M+LHGLPND FQAI+S ALI+FIPI E+F+YPFIR+FTP KPI
Sbjct: 367 WVCYGQMLNNFVTQGSTMQLHGLPNDFFQAINSIALIVFIPIVEKFVYPFIRKFTPLKPI 426

Query: 427 TKIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLNG-GGPNRIHVGWQVPAYVLIAFSE 485
           TK+  GF+F + AMVW+ VLQ FIY+AGP YDHP+    GPN +HV WQVPAY LI+ SE
Sbjct: 427 TKVTIGFVFGSLAMVWAAVLQHFIYQAGPCYDHPVKCPNGPNHVHVAWQVPAYCLISLSE 486

Query: 486 ILASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVA 545
           I ASITGLE AYSKAP SMKSFIMS+FL +NA G+ +G ALS VS DPK+ WL+ GL V 
Sbjct: 487 IFASITGLEIAYSKAPESMKSFIMSMFLVTNAFGAAIGCALSSVSEDPKYVWLYTGLAVT 546

Query: 546 XXXXXXXXXXXXRKYNDTEEEMNAMDYEDEEDLREMESAGANDLELNSTQS 596
                       + YND E+ MN +D+E + +  + E +   +LEL+ T++
Sbjct: 547 CFCAGIAFWFTFKHYNDEEDAMNNIDFESDNENEKNEYSQIENLELSQTKT 597

>Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093W
           (REAL)
          Length = 399

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/384 (71%), Positives = 316/384 (82%), Gaps = 2/384 (0%)

Query: 210 KANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLMVNVGSLSVIATTEL 269
           KANLSVLIADQLPKRKP +K LKSGERVV DPNITLQNVFM+FY M+NVGSLS++ATTEL
Sbjct: 3   KANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATTEL 62

Query: 270 EEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFKILWIVSKNKFDLTS 329
           E HK FWAA+LLPFCFFWIAVV L+ G+ QY++    +K I KSF++ WI++KNKFD  +
Sbjct: 63  EYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDFNA 122

Query: 330 AKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMISTFVTQGSMMELHGL 389
           AKPS HPE++YPW DKFVDE  RAL+ACKVF+FYPIYW  YGTMIS+F+TQ SMMELHG+
Sbjct: 123 AKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHGI 182

Query: 390 PNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMFATGAMVWSCVLQSF 449
           PND  QA DS ALIIFIPI E+FIYPFIRR+TPFKPITKIFFGFMF + AM W+ VLQSF
Sbjct: 183 PNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQSF 242

Query: 450 IYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLIAFSEILASITGLEYAYSKAPMSMKSFIM 509
           IYKAGP+YD PL    PNR+HV WQ+PAYVLI+FSEI ASITGLEYAYSKAP SMKSFIM
Sbjct: 243 IYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFIM 302

Query: 510 SLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVAXXXXXXXXXXXXRKYNDTEEEMNA 569
           S+FL + A GS +G ALSPV+VDPKFTWLF GL VA            RKYNDTEEEMNA
Sbjct: 303 SIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTEEEMNA 362

Query: 570 MDYEDEE--DLREMESAGANDLEL 591
           MDYE+E+  DL  + +  AND+E+
Sbjct: 363 MDYEEEDEFDLNPISAPKANDIEI 386

>Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093W
           (PTR2) - Peptide transporter [contig 219] FULL
          Length = 611

 Score =  226 bits (576), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 167/566 (29%), Positives = 251/566 (44%), Gaps = 68/566 (12%)

Query: 27  AQEKTQEITLKETTGSSEEVHDELETYHIHHDEECEPGYEIPTEEDMETLRHVSGKIPLR 86
           + EK  +  + E  G SE+  DEL+T            +  PTE +   LR V G     
Sbjct: 2   SSEKKNQYAVAEIDGHSED-FDELDTQT----------FPEPTERERSELRRVLGHPKWY 50

Query: 87  CWLIALVELAERFSYYGLSAPFQNYMEN-------------GPNDTPAGVLELNSSGATG 133
            + I L+E +ER SYYG      N+++                ++  AG L +    AT 
Sbjct: 51  VYFICLIEFSERASYYGTGDRLNNFIQKPLPAGGNGAGAPAPGSEATAGALGMGLQVATA 110

Query: 134 LSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIASKDTS-L 192
           L+    F  Y  P+  G++AD YWG+   + +G  + +    +  I S+P +    ++ L
Sbjct: 111 LNLLLTFLAYCFPLITGYVADRYWGRMRMLWIGVFVGIVSHVVFIIGSLPVVLGHGSAAL 170

Query: 193 XXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWF 252
                            K  L   +  Q P     VKTL SGERV+ D + +LQ + M F
Sbjct: 171 APCIIGIITLAIATAFVKPILLPTLLSQYPHATDVVKTLPSGERVIIDRDASLQRMTMTF 230

Query: 253 YLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREKS-IQ 311
           Y  +NVGS   +AT+       +W AFL+P   F I   VL+  R     E    +S I 
Sbjct: 231 YWSINVGSFLSVATSYSARDVGYWLAFLIPLALFMIMPAVLLVLRRYIKDEPPSGRSLIA 290

Query: 312 KSFKILWIV------------------------SKNKFDLTSAKPSYHPEKNYPWTDKFV 347
              K+L +                         S  +     +KP ++PE         V
Sbjct: 291 DCLKVLKVCFERNWWSRYRAGTFWDYAKPSNLRSLGRQGWRKSKPGFYPE-------SLV 343

Query: 348 DECSRALSACKVFLFYPIYWVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIP 407
            +    +SAC +FL+Y IY +  G + S   +Q + +   G+PND+    +   +I+F+P
Sbjct: 344 QDARVTISACTIFLYYVIYNINDGGIGSIMNSQTASLTSKGVPNDLMSNFNPLCIIVFMP 403

Query: 408 ICERFIYPFIRRFT-PFKPITKIFFGFMFATGAMVWSCVLQSFIYKAGP---YYDHPLNG 463
           I +R +YP +R+    F+P+ +IF GFM A  A     ++Q  IY+  P   Y      G
Sbjct: 404 ILDRVVYPLLRKLRWNFRPVFRIFAGFMVAALASAVGAIIQHAIYQTSPCGNYATECEKG 463

Query: 464 GGPNRIHVGWQVPA-YVLIAFSEILASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSIL 522
             P  +   W V   Y L  FSE LA  TG E A+ ++P  MK+F+M+LFLF +A  + L
Sbjct: 464 VSPISM---WVVAIEYALTGFSECLAMTTGYEIAFERSPPHMKTFVMALFLFMSALSAAL 520

Query: 523 GIALSPVSVDPKFTWLFG---GLGVA 545
           G  ++P  VDP     FG   GLG A
Sbjct: 521 GEIVTPSLVDPHLVIPFGVLAGLGAA 546

>KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 626

 Score =  206 bits (523), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 149/520 (28%), Positives = 231/520 (44%), Gaps = 47/520 (9%)

Query: 68  PTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMEN------------- 114
           PTE +  TLR V        + I L+E +ER SYYG      N+++              
Sbjct: 37  PTEHERTTLRRVLEHPKWYVYFICLIEFSERASYYGTGDRLNNFIQQPLPAGGNGAGAPA 96

Query: 115 ---GPNDTPAGVLELNSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYL 171
                +   AG L +    AT L+    F  Y  P+  G++AD YW +   + +G  + +
Sbjct: 97  HGAAGDSATAGALGMGLQTATALNLLLTFLAYCFPLVTGYIADRYWSRMRMLWIGVFVGI 156

Query: 172 AGIFILFITSIPSI-ASKDTSLXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKT 230
               I  I ++P +  +   +L                 K  L   +  Q P     V+T
Sbjct: 157 ISHVIFIIGALPPVLGNGQAALAPCVIGIITLAIATSFVKPVLLPTLLSQYPHETDVVRT 216

Query: 231 LKSGERVVEDPNITLQNVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIA- 289
           L SGERV+ D + +LQ + M FY  +N+GS   +AT+       +W AFL+P   + I  
Sbjct: 217 LASGERVLVDRDASLQRMTMTFYWSINIGSFLSVATSYAARDIGYWLAFLIPLILYLIMP 276

Query: 290 VVVLVGGRNQYVKEGKREKSIQKSFKIL--------WIVSKNKFDLTSAKPSYHPEKNYP 341
            V+LV GR    +       +    K+L        W   ++      A+PS   +    
Sbjct: 277 AVLLVLGRYLRDEPPSGRSMLADCCKVLRVCFERGWWRRYRSGDFWNYARPSRLRQAGRA 336

Query: 342 ----------WTDKFVDECSRALSACKVFLFYPIYWVIYGTMISTFVTQGSMMELHGLPN 391
                     + +  V +    LSA  +FL+Y IY +  G + S   +Q + +  +G+PN
Sbjct: 337 GWRRKGAGGFYAESLVQDTRVTLSASAIFLYYVIYNINDGGIGSIMNSQTASLTSNGVPN 396

Query: 392 DIFQAIDSFALIIFIPICERFIYPFIRRFT-PFKPITKIFFGFMFATGAMVWSCVLQSFI 450
           D+    +   +I+F+P+ +  +YP +R+    FKP+ +IF GFM A  A     ++Q+ I
Sbjct: 397 DLISNFNPLCIIVFMPVLDHVLYPVLRKMRWNFKPVYRIFCGFMIAALASAVGAIIQTVI 456

Query: 451 YKAGP---YYDHPLNGGGPNRIHVGWQVPA-YVLIAFSEILASITGLEYAYSKAPMSMKS 506
           Y   P   Y      G  P  +   W V   Y L   SE LA  TG E A+ ++P  MKS
Sbjct: 457 YNTSPCGRYATECDKGVSPVSM---WVVAVEYALTGLSECLAMTTGYEIAFERSPAHMKS 513

Query: 507 FIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFG---GLG 543
           F+M+LFLF++A  + LG  ++P  VDP     FG   GLG
Sbjct: 514 FVMALFLFTSALSAALGEIVTPSLVDPHLVIPFGVLAGLG 553

>AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON}
           NOHBY725; No homolog in Saccharomyces cerevisiae
          Length = 599

 Score =  196 bits (497), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 147/499 (29%), Positives = 225/499 (45%), Gaps = 44/499 (8%)

Query: 74  ETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYME-----------NGPNDTPAG 122
           + LRHV        ++I L+ELAER SYYG      N+ +            GP+D   G
Sbjct: 44  KRLRHVVAAPKWTVYMICLIELAERASYYGTGDRLYNFFQYPLPQGGNGAGAGPDDQNPG 103

Query: 123 VLELNSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVG--TGIYLAGIFILFIT 180
            L      AT L+   +F  Y  P+  G++AD Y G+   + +G  TG+    IF+  I 
Sbjct: 104 ALGRGLQVATSLNLVLKFTSYFFPLVTGYVADMYVGELKMLWLGIWTGVVSHVIFV--IA 161

Query: 181 SIPS-IASKDTSLXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLKSGERVVE 239
           ++P+ I   +  +                 K  L  ++  Q P     VKTL +GERV+ 
Sbjct: 162 ALPAVIKHNNLCMALAVLGLLTLSLCTAFVKPVLLPMLLRQYPHETNVVKTLPTGERVIL 221

Query: 240 DPNITLQNVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQ 299
           + + +LQ + M FY  +NVGS   +AT    +   +W +FL+P   F I   +L+  +N 
Sbjct: 222 NRDASLQRMSMTFYWCINVGSFVSLATGYSAQRVGYWLSFLIPLVLFLIMPAILLTLKNV 281

Query: 300 YVKEGKREKSIQKSFKIL-----------------WIVSKNKFDLTSAKPSYHPEKNYPW 342
            V     E    +  K++                 W  +K        +  +   K   +
Sbjct: 282 KVTPPLGESLFAECLKVIKVCFEPGWFKRYRSGSFWRYAKPSNLRALGRTGWRRSKEGFY 341

Query: 343 TDKFVDECSRALSACKVFLFYPIYWVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFAL 402
            +  V++    L+AC +FL+Y IY +    + S    Q   M   G+PND+    +  A+
Sbjct: 342 KESLVEDTRITLAACVIFLYYVIYNMNDNQLSSIINNQAGSMTGEGVPNDVISNFNPLAI 401

Query: 403 IIFIPICERFIYPFIRRF-TPFKPITKIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHP- 460
           II +PI +  + P +RR    FKP+ +IFFGFM A  A V   ++Q+ IY   P   H  
Sbjct: 402 IITMPIIDYGLNPLLRRLRINFKPVYRIFFGFMLAVLASVAGAIIQAAIYNTSPCGKHAS 461

Query: 461 -----LNGGGP-NRIHVGWQVPAYVLIAFSEILASITGLEYAYSKAPMSMKSFIMSLFLF 514
                +    P +R  VG +   YVL   SE  A  TG E A+ ++P  MK+F+MSLFL 
Sbjct: 462 TCSETIRQVSPLSRWLVGVE---YVLSGVSECFAMPTGYEIAFERSPKDMKAFVMSLFLV 518

Query: 515 SNAGGSILGIALSPVSVDP 533
           + A  SIL    + +  DP
Sbjct: 519 TTALSSILTQIFNGIMTDP 537

>Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar to
           Ashbya gossypii AGL365C
          Length = 613

 Score =  192 bits (488), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 160/579 (27%), Positives = 264/579 (45%), Gaps = 56/579 (9%)

Query: 67  IPTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYME-------NGPNDT 119
           +PTEE+  TLR +        +LI  +ELAER SYYG      NY         NG   T
Sbjct: 43  LPTEEEERTLRRIVVHPSWYVYLICFIELAERASYYGTGDRLNNYYTYPLPEGGNGAGAT 102

Query: 120 P------AGVLELNSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAG 173
                  +G L    + AT L    +F  Y  P+  G++ D Y G   T+  G    +A 
Sbjct: 103 AHGSEANSGALGKGLATATSLGLLLKFTSYFFPLVTGYLCDMYMGHVRTLWYGIWTGVAS 162

Query: 174 IFILFITSIPSIASK-DTSLXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLK 232
             I  ++++P +    D ++                 K  L  L+  Q P     VKTL+
Sbjct: 163 HIIFILSALPVVLKHPDAAMALSLIGLITLSVCTAFVKPVLLPLLLQQYPHETNVVKTLE 222

Query: 233 SGERVVEDPNITLQNVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVV 292
           +GERV+ D + +LQ + M FY  +N+G+   +AT+   +   FW AFL+P   + +A+ V
Sbjct: 223 TGERVIIDRDASLQRMTMTFYWAINIGAFMSLATSYAAKEVGFWLAFLIPLIIY-MAMPV 281

Query: 293 LVGGRNQYVKEGKREKS----IQKSFKILWIVSKNKFDLTS--------AKPSYHPE--- 337
           +      ++K+  R  S    +    K+L++     ++           A PS   +   
Sbjct: 282 VFSLVQPHIKD--RAPSGYSLLADCMKVLYVAFGKGWNARRKEGVFWDYALPSNQRQMGK 339

Query: 338 ----KNYP-WTDKFVDECSRALSACKVFLFYPIYWVIYGTMISTFVTQGSMMELHGLPND 392
               K  P + +  V +    LSAC +F +Y IY +    + +   +Q   M  +G+PND
Sbjct: 340 VGWRKKSPFYKESLVQDTKITLSACFIFCYYIIYNMNDNQLTTIINSQTGSMTKNGVPND 399

Query: 393 IFQAIDSFALIIFIPICERFIYPFIRRF-TPFKPITKIFFGFMFATGAMVWSCVLQSFIY 451
           +    +  ++I+ IPI +  +YP +RR    FKP+ +IF GFM A  + V   ++Q  IY
Sbjct: 400 VISNFNPLSIIVLIPILDYGLYPLLRRLRINFKPVYRIFTGFMLAVASSVAGALIQWRIY 459

Query: 452 KAGPYYDHPLN----GGGPNRIHVGWQVPA-YVLIAFSEILASITGLEYAYSKAPMSMKS 506
           +      H       G G + +   W V   Y L   SE LA  T  E AY ++P  MKS
Sbjct: 460 ETSSCGYHATTCSEKGLGVSPLS-SWIVAVEYTLSGASECLAMTTAYEIAYDRSPEHMKS 518

Query: 507 FIMSLFLFSNAGGSILGIALSPVSVDPKFT---WLFGGLGVAXXXXXXXXXXXXRKYNDT 563
           F+++LFLF++A  + +   ++P+  DP       LF G+G               K+ + 
Sbjct: 519 FVLALFLFTSAVSAAITQIVNPILKDPLLIVPFALFAGIGFISGCHFLW------KFRNL 572

Query: 564 EEEMNAMDYEDEEDLREMESAGANDLELNSTQSLTQRRT 602
           ++EM  +  + E +L + ES+ +++LE+   + +   R+
Sbjct: 573 DKEM--LQEKRERELLQ-ESSESDELEVVEIKDVKGSRS 608

>AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKR093W (PTR2)
          Length = 576

 Score =  175 bits (443), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 141/541 (26%), Positives = 238/541 (43%), Gaps = 43/541 (7%)

Query: 66  EIPTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYME------------ 113
           +IPTE +  TLR +     +  + I L+E AER S+YG      N+ +            
Sbjct: 29  QIPTEHEELTLRRIVTSPKIHLYFICLIEFAERGSFYGTGNRMGNFYQYPLPIGGNGAGA 88

Query: 114 NGPNDTPAGVLELNSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAG 173
            GP +   G L    + AT +    +F  Y   +  G+++D Y G+   + +G  + +  
Sbjct: 89  PGPGEQDPGALGKGLAVATAMGLLLKFTSYTFSIITGYISDVYIGQIKMLWIGVWLGVGS 148

Query: 174 IFILFITSIPSI-ASKDTSLXXXXXXXXXXXXXXXXXKANLSVLIADQLPKRKPRVKTLK 232
             +  I ++PS+ A  + +                  K  L  L+  Q P +   VKTL 
Sbjct: 149 HILFIIAALPSVLAHTNVAYALSVVALLSLSLCTSFVKPVLLPLLLQQYPYKTNIVKTLL 208

Query: 233 SGERVVEDPNITLQNVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVV 292
           SGERV+ D + +LQ + M FY  +NVG+   +AT    +   +W AF +P   + +  +V
Sbjct: 209 SGERVIVDRDASLQRMTMVFYWAINVGAFLSLATAYSAQRVGYWLAFTVPLIIYLLMPIV 268

Query: 293 LVGGRNQY-VKEGKREKSIQKSFKIL-----------------WIVSKNKFDLTSAKPSY 334
           L   +      E  RE  + +S K+L                 W  +K    +   +  +
Sbjct: 269 LWKLQEDIKTNEPSRESVLAESLKVLKVCYEWGWIKRYWSGQFWDYAKPTNLIQQGRIGW 328

Query: 335 HPEKNYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMISTFVTQGSMMELHGLPNDIF 394
             +K   + +K+V +    +SAC +FL+Y IY  ++  +     +Q   ME  G+PND+F
Sbjct: 329 RKKKAGFYDEKYVYDTKLTISACTIFLYYVIY-QMHSNLDEPMRSQAGSMEGEGVPNDLF 387

Query: 395 QAIDSFALIIFIPICERFIYPFIRRF-TPFKPITKIFFGFMFATGAMVWSCVLQSFIYKA 453
              +  ++I+ +PI +  +YP +RR+   FKP+ +IF GFM          ++Q  +Y  
Sbjct: 388 SNFNPISIIVVMPILDYVLYPLLRRYRINFKPVYRIFCGFMIGCLGSTVGAIIQWRVYNT 447

Query: 454 GPYYDHPLNGGGPNRIHVG-----WQVPA-YVLIAFSEILASITGLEYAYSKAPMSMKSF 507
            P   +      P   H       W V   Y L   SE LA  TG E A+ ++P  MK F
Sbjct: 448 SP-CGYMGATTCPELHHKKSPLSRWLVAIEYALGGTSECLAMTTGYEIAFERSPKKMKGF 506

Query: 508 IMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVAXXXXXXXXXXXXRKYNDTEEEM 567
           +++LF+F+ A  S + + ++P   DP   +L     V              +Y D +++M
Sbjct: 507 VLALFMFTVAISSAIILPITPFFKDP---YLIQPFAVCAGVGALTAIIFLWRYWDLDKQM 563

Query: 568 N 568
            
Sbjct: 564 K 564

>ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL119C
           (MCH4); Tandem gene duplication in this genome
          Length = 483

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 73/180 (40%), Gaps = 34/180 (18%)

Query: 6   EHEKDGADV--VTEKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEECEP 63
           +HEK G  +  VT+    D       +T+E+ +K      +   + L       DE+   
Sbjct: 11  DHEKAGGRLPLVTDDYMRD------GQTRELRMKPPVADEDGAEEVLAA-----DEKAAT 59

Query: 64  GYEIPTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLS---APFQNYMENGPNDTP 120
             E   E D+E      G    R WL  L      F  +G +     ++ Y+ N      
Sbjct: 60  --EATNELDVEEEYPDGGY---RAWLTVLGSFVGIFPIWGTANALGAYEGYISNH----- 109

Query: 121 AGVLELNSSGATGLSYFFQFW---CYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFIL 177
               +L SSGA  +S+ F      C+V  VF G   D   G+   I VG+ +Y+ GIF++
Sbjct: 110 ----QLASSGAGEVSWIFALHMIACFVGCVFSGSYFDRNGGQ-KAIIVGSVLYVFGIFMM 164

>KNAG0G00760 Chr7 complement(139276..140184) [909 bp, 302 aa] {ON}
           Anc_5.132 YGR205W
          Length = 302

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 12/95 (12%)

Query: 455 PYYDHPLNGGGPNRIHVGWQVPAYV--------LIAFSEILASITGLE----YAYSKAPM 502
           P YD  L+GG  +R+    +VP  V         + F+ IL+  +G E     A     +
Sbjct: 136 PQYDKSLHGGAGDRLSCERRVPVPVDIFILEGWFLGFNPILSGRSGPETETPLAGDMVDV 195

Query: 503 SMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTW 537
           + K F+ S  +++N     LGI L+   +D  + W
Sbjct: 196 NAKLFMYSDLMWNNPEIHSLGIVLAADQLDDVYLW 230

>KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa]
            {ON} uniprot|Q96WM8 Kluyveromyces lactis KLLA0F21692g
            Pdr5 Multidrug pump KlPDR5
          Length = 1525

 Score = 34.7 bits (78), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 74/175 (42%), Gaps = 17/175 (9%)

Query: 360  FLFYPIYWVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIR- 418
            +++  ++  I+  +   F    + + + GL N +F AI +F  +IF P C++++  F+  
Sbjct: 1195 YIWSKLFLTIFSQLFIGFTFFKANLSIQGLQNQLF-AIFTFT-VIFNPACQQYLPLFVSQ 1252

Query: 419  ------RFTPFKPITKIFFGFMFATGAMVWSCVLQS-----FIYKAGPYYDHPLNGGGPN 467
                  R  P +  + + F F   T  +  +    +     F Y  G Y +    G    
Sbjct: 1253 RDLYEARERPSRTFSWLAFIFSQITVEIPLNICFGTIAFFVFYYPIGFYNNASYAGQLNE 1312

Query: 468  RIHVGW--QVPAYVLIAFSEILASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGS 520
            R  + W   V  YV I+    L  I GL+YA +   M+   F MSL      GGS
Sbjct: 1313 RGVLFWLFSVSFYVFISSMGQLC-IAGLQYAEAAGNMASLMFTMSLNFCGVFGGS 1366

>Kwal_33.13324 s33 complement(170638..174570) [3933 bp, 1310 aa]
           {ON} YLR189C (UGT51) - UDP-glucose:sterol
           glucosyltransferase [contig 118] FULL
          Length = 1310

 Score = 31.6 bits (70), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%)

Query: 8   EKDGADVVTEKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEECEPGYEI 67
           EK+   VV EKE     E+ + K  E+  +    SSEE   +LET         EP   +
Sbjct: 154 EKEDRGVVKEKEDTSEKEETRAKEDEVEFQSGRRSSEEDSKKLETAVHQSPLALEPSQGV 213

Query: 68  PTEEDMET 75
             ++ +E+
Sbjct: 214 TRKDSLES 221

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,499,687
Number of extensions: 2775006
Number of successful extensions: 11407
Number of sequences better than 10.0: 48
Number of HSP's gapped: 11629
Number of HSP's successfully gapped: 50
Length of query: 611
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 495
Effective length of database: 40,180,143
Effective search space: 19889170785
Effective search space used: 19889170785
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)