Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0A032005.702ON1788177587270.0
ZYRO0G06600g5.702ON1820182123340.0
SAKL0E14916g5.702ON1779177923210.0
Suva_11.3315.702ON1898179622680.0
YKR095W (MLP1)5.702ON1875178922520.0
TDEL0B021905.702ON1810177922400.0
Skud_11.3345.702ON1885179622440.0
Smik_11.3585.702ON1878179522100.0
NDAI0E050405.702ON1973181222050.0
Ecym_40185.702ON1769175520940.0
KLTH0E01056g5.702ON1771167020380.0
Kwal_55.196975.702ON1760164118860.0
CAGL0G02497g5.702ON1780134217860.0
KLLA0A00594g5.702ON1748152317580.0
AFR286W5.702ON1758163216680.0
TBLA0E017305.702ON1820144212661e-144
NCAS0G002305.702ON1735139910441e-115
Skud_9.195.702ON1680180510391e-115
KAFR0D022205.702ON1674156510261e-113
KNAG0C065905.702ON1651166610061e-111
Suva_9.395.702ON168218109571e-104
YIL149C (MLP2)5.702ON167918129331e-101
Smik_9.205.702ON168218109181e-100
KNAG0L021405.702ON160814717973e-85
KAFR0H002105.702ON145410775992e-61
NDAI0F002905.702ON15545565501e-55
Kpol_1043.705.702ON13216364712e-46
TPHA0E002305.702ON12847193371e-30
TPHA0D046105.702ON11832432512e-20
Kpol_2001.755.702ON10064522108e-16
KAFR0G032004.238ON1869196970.020
KNAG0C015701.285ON79045890.14
TDEL0C009608.68ON1222164870.26
Kpol_274.88.125ON477157850.35
TDEL0H00530singletonON558130830.61
Ecym_50207.21ON790237830.67
ZYRO0B16610g5.715ON18378781.2
TDEL0A020302.427ON21275781.4
ZYRO0D16016g7.202ON228102772.0
Skud_7.3684.221ON86967782.8
NDAI0J009608.331ON2409114773.7
SAKL0B02288g8.68ON122897774.1
Kwal_47.166744.364ON64061764.4
NDAI0B037202.253ON1474128765.5
TBLA0E044108.259ON1422211765.5
Skud_2.557.488ON1390115756.6
NCAS0B050608.276ON237218736.7
NCAS0B04430singletonON18045727.2
Kpol_479.38.604ON795156747.9
KLTH0B08316g2.16ON95028747.9
AGR229W8.604ON705174748.9
Kpol_1031.155.414ON929155749.2
TBLA0B09930singletonON222106729.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0A03200
         (1788 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...  3366   0.0  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   903   0.0  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   898   0.0  
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   878   0.0  
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   872   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   867   0.0  
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   868   0.0  
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   855   0.0  
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   853   0.0  
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   811   0.0  
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   789   0.0  
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   731   0.0  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   692   0.0  
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   681   0.0  
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   647   0.0  
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   492   e-144
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   406   e-115
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   404   e-115
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   399   e-113
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   392   e-111
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   373   e-104
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   363   e-101
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   358   e-100
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   311   3e-85
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   235   2e-61
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   216   1e-55
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   186   2e-46
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...   134   1e-30
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...   101   2e-20
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    86   8e-16
KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {...    42   0.020
KNAG0C01570 Chr3 (310309..312681) [2373 bp, 790 aa] {ON} Anc_1.2...    39   0.14 
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....    38   0.26 
Kpol_274.8 s274 complement(13824..15257) [1434 bp, 477 aa] {ON} ...    37   0.35 
TDEL0H00530 Chr8 complement(88314..89990) [1677 bp, 558 aa] {ON}       37   0.61 
Ecym_5020 Chr5 complement(43098..45470) [2373 bp, 790 aa] {ON} s...    37   0.67 
ZYRO0B16610g Chr2 (1348784..1349335) [552 bp, 183 aa] {ON} simil...    35   1.2  
TDEL0A02030 Chr1 (367215..367853) [639 bp, 212 aa] {ON} Anc_2.42...    35   1.4  
ZYRO0D16016g Chr4 complement(1338068..1338754) [687 bp, 228 aa] ...    34   2.0  
Skud_7.368 Chr7 complement(618751..621360) [2610 bp, 869 aa] {ON...    35   2.8  
NDAI0J00960 Chr10 complement(214481..221710) [7230 bp, 2409 aa] ...    34   3.7  
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...    34   4.1  
Kwal_47.16674 s47 complement(57126..59048) [1923 bp, 640 aa] {ON...    34   4.4  
NDAI0B03720 Chr2 (930486..934910) [4425 bp, 1474 aa] {ON} Anc_2....    34   5.5  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...    34   5.5  
Skud_2.55 Chr2 complement(111625..115797) [4173 bp, 1390 aa] {ON...    33   6.6  
NCAS0B05060 Chr2 complement(940241..940938,941045..941060) [714 ...    33   6.7  
NCAS0B04430 Chr2 (801789..802331) [543 bp, 180 aa] {ON}                32   7.2  
Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)...    33   7.9  
KLTH0B08316g Chr2 (673602..676454) [2853 bp, 950 aa] {ON} some s...    33   7.9  
AGR229W Chr7 (1177911..1180028) [2118 bp, 705 aa] {ON} Syntenic ...    33   8.9  
Kpol_1031.15 s1031 (38596..41385) [2790 bp, 929 aa] {ON} (38596....    33   9.2  
TBLA0B09930 Chr2 (2372624..2373292) [669 bp, 222 aa] {ON}              32   9.4  

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score = 3366 bits (8727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1721/1775 (96%), Positives = 1721/1775 (96%)

Query: 1    MSTAADTLTKEELTLIGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLE 60
            MSTAADTLTKEELTLIGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLE
Sbjct: 1    MSTAADTLTKEELTLIGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLE 60

Query: 61   ELQKTSQGRINDLRTQLEDLIEQNAXXXXXXXXXXXXXXXXXXXXFQLSSTRDNLRAELK 120
            ELQKTSQGRINDLRTQLEDLIEQNA                    FQLSSTRDNLRAELK
Sbjct: 61   ELQKTSQGRINDLRTQLEDLIEQNASASEEKKKIEKELSDEKKESFQLSSTRDNLRAELK 120

Query: 121  EIQEKFDNLQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKY 180
            EIQEKFDNLQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKY
Sbjct: 121  EIQEKFDNLQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKY 180

Query: 181  NDSLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLEN 240
            NDSLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLEN
Sbjct: 181  NDSLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLEN 240

Query: 241  NCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMIDVLQT 300
            NCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNT              MIDVLQT
Sbjct: 241  NCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQEMIDVLQT 300

Query: 301  QVQKLQDDYTRILNTKQPIVQNDEERNLEVEELKQKLIETETQLNKELEERRNITMQTES 360
            QVQKLQDDYTRILNTKQPIVQNDEERNLEVEELKQKLIETETQLNKELEERRNITMQTES
Sbjct: 301  QVQKLQDDYTRILNTKQPIVQNDEERNLEVEELKQKLIETETQLNKELEERRNITMQTES 360

Query: 361  STLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKEL 420
            STLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKEL
Sbjct: 361  STLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKEL 420

Query: 421  TDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQN 480
            TDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQN
Sbjct: 421  TDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQN 480

Query: 481  DSNGPLSAEEVRFIQDILXXXXXXXXXXXQQVISERLVTFQNIVELQQKNIDLLKSVREL 540
            DSNGPLSAEEVRFIQDIL           QQVISERLVTFQNIVELQQKNIDLLKSVREL
Sbjct: 481  DSNGPLSAEEVRFIQDILDNESNEESSDSQQVISERLVTFQNIVELQQKNIDLLKSVREL 540

Query: 541  ARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSLPKP 600
            ARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSLPKP
Sbjct: 541  ARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSLPKP 600

Query: 601  DTKVETEHLRLNEENTDLIKELETRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQN 660
            DTKVETEHLRLNEENTDLIKELETRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQN
Sbjct: 601  DTKVETEHLRLNEENTDLIKELETRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQN 660

Query: 661  ERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEYVSCKVA 720
            ERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEYVSCKVA
Sbjct: 661  ERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEYVSCKVA 720

Query: 721  LSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQTEREQIFNST 780
            LSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQTEREQIFNST
Sbjct: 721  LSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQTEREQIFNST 780

Query: 781  KLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAIKEKRDAYQDE 840
            KLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAIKEKRDAYQDE
Sbjct: 781  KLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAIKEKRDAYQDE 840

Query: 841  LLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMETLQNELEKSKINLS 900
            LLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMETLQNELEKSKINLS
Sbjct: 841  LLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMETLQNELEKSKINLS 900

Query: 901  EAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLDTKSILSEQIT 960
            EAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLDTKSILSEQIT
Sbjct: 901  EAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLDTKSILSEQIT 960

Query: 961  DLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYAN 1020
            DLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYAN
Sbjct: 961  DLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYAN 1020

Query: 1021 IAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQRK 1080
            IAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQRK
Sbjct: 1021 IAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQRK 1080

Query: 1081 SYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNEDLVLSLRSDRDIL 1140
            SYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNEDLVLSLRSDRDIL
Sbjct: 1081 SYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNEDLVLSLRSDRDIL 1140

Query: 1141 QTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEEHDNIMXXXXXXX 1200
            QTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEEHDNIM       
Sbjct: 1141 QTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEEHDNIMNQLNQLN 1200

Query: 1201 XXRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKE 1260
              RESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKE
Sbjct: 1201 LLRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKE 1260

Query: 1261 ECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAH 1320
            ECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAH
Sbjct: 1261 ECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAH 1320

Query: 1321 ERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTALRS 1380
            ERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTALRS
Sbjct: 1321 ERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTALRS 1380

Query: 1381 QLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNNEATVTGQPDL 1440
            QLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNNEATVTGQPDL
Sbjct: 1381 QLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNNEATVTGQPDL 1440

Query: 1441 SNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISAQRE 1500
            SNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISAQRE
Sbjct: 1441 SNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISAQRE 1500

Query: 1501 QWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELL 1560
            QWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELL
Sbjct: 1501 QWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELL 1560

Query: 1561 SSEENKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQ 1620
            SSEENKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQ
Sbjct: 1561 SSEENKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQ 1620

Query: 1621 LQGSNAANENKNDVEVLLKTPSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGTTLALN 1680
            LQGSNAANENKNDVEVLLKTPSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGTTLALN
Sbjct: 1621 LQGSNAANENKNDVEVLLKTPSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGTTLALN 1680

Query: 1681 QSRAPSSLQNGSDSSNPFTSPFQQTKNDANIPAVTQPAFLLREPSEPNMSVSTISRQSTS 1740
            QSRAPSSLQNGSDSSNPFTSPFQQTKNDANIPAVTQPAFLLREPSEPNMSVSTISRQSTS
Sbjct: 1681 QSRAPSSLQNGSDSSNPFTSPFQQTKNDANIPAVTQPAFLLREPSEPNMSVSTISRQSTS 1740

Query: 1741 ETNTESELPVSSEGLATPSSKRPAQEDTEEEKLDA 1775
            ETNTESELPVSSEGLATPSSKRPAQEDTEEEKLDA
Sbjct: 1741 ETNTESELPVSSEGLATPSSKRPAQEDTEEEKLDA 1775

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  903 bits (2334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/1821 (35%), Positives = 1052/1821 (57%), Gaps = 79/1821 (4%)

Query: 3    TAADTLTKEELTLIGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEEL 62
            T+ D      L  + +F  VP +QL  I+  IL+ L+ KV  F EL+SQ+L+  V+++E+
Sbjct: 13   TSGDNHNDVSLGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEI 72

Query: 63   QKTSQGRINDLRTQLEDLIEQNAXXXXXXXXXXXXXXXXXXXXFQLSSTRDNLRAELKEI 122
            +  S  R   L+ ++E+L++ N                      ++ +  ++L+ +L ++
Sbjct: 73   KTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDL 132

Query: 123  QEKFDNLQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYND 182
             ++ + L++  ++ + +L+ KI + E  +  + K  +  +    +  +LE  +Q+LK  +
Sbjct: 133  DQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKE 192

Query: 183  SLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNC 242
               ++ +  ++Q L  + +  + LE E+ +K +++         E+  L  +  + +N  
Sbjct: 193  LRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNEL 252

Query: 243  SIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMIDVLQTQV 302
             + KS N  +  +N  ++ +L EK  ++++L++                  +ID+L+ QV
Sbjct: 253  QLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQV 312

Query: 303  QKLQDDYTRILNTKQPIVQNDEERNLEVEELKQKLIETETQLNKELEERRN--------- 353
            + LQ +    L+     +    ERN E E+L Q+LI  +    +   ER           
Sbjct: 313  KSLQGELNASLDKDNVELLASGERNTENEKLIQELITLKENFEESERERLRLEALVQELI 372

Query: 354  ---------------ITMQTESSTLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVE 398
                           I+++ + S+L      D+  +KKELI+ER+QKE+LQ QVE FIVE
Sbjct: 373  PGDDSQDDINNTSSFISLRNKDSSL-----RDMGILKKELIKERHQKERLQRQVESFIVE 427

Query: 399  LEKKVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSL 458
            LE K+P INSFK+RT MLEKEL D  LLL++   EK +   E +AL +  K  +    +L
Sbjct: 428  LEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTL 487

Query: 459  TKQRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILXXXXXXXXXXXQQVISERLV 518
            T+QR DLAHQ+Q++L++ SVQ DS G LSAEEV FI+ I+           Q+VISERLV
Sbjct: 488  TRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLV 547

Query: 519  TFQNIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNT 578
             F NI  LQ+KN++LLK+VR+LA KLE +E+      Q  E   I EAKEAI+SLQ YN 
Sbjct: 548  EFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNA 607

Query: 579  KLEDKIKTLNDELDCYKSLPKPDTKVETEHLRLN--------EENTDLIKELETRLATSR 630
             LE K++ L  E D +K++   +   +   L  N          + + ++ LE RL +  
Sbjct: 608  NLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLT 667

Query: 631  EESNKTFASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQ 690
             ES++    LNNEI ++ R+ +Q   E + ER+S+ L E+RLKLIQ++L L++ EN+QL 
Sbjct: 668  VESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLV 727

Query: 691  KRLEILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDIT 750
            KR + LQ I  +QD RT ET+ E ++C   L+  + ++  ++++  + +++E++ +++  
Sbjct: 728  KRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYL 787

Query: 751  IVSKERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIK 810
             +S+ERN L+ +VSQLQ+LQ+ERE+     +   +  LD++E+E  D   +L  K +E +
Sbjct: 788  KLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAE 847

Query: 811  ELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVT 870
            ++E+++ ++I+WYQ+K+D++  +    + EL  KT  + +L  E++KL+K ++ SE+R+ 
Sbjct: 848  DMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQ 907

Query: 871  AYKVLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEET 930
            +Y+VL+ S+   +   +L+ ELEK+KINLS+ YAE+DQYK   S  EE L          
Sbjct: 908  SYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEESLSQLTQDYASG 967

Query: 931  KKEFIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQ 990
            K+E   ++ETLQ ++ +L D  + L+E +T L   L   NKA   EK+ + KK+  L  +
Sbjct: 968  KQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETE 1027

Query: 991  NHNIEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTY 1050
            +    ++  +Y+ ++  LQ DLEQQAS+AN AQ NYE+ELQK + ++KTIS+LRE +   
Sbjct: 1028 SKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKD 1087

Query: 1051 RKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLL 1110
            R  +  ++ +     ++L +NEK W  Q++ YE Q+   ++ +EDLS+QN LL+DQ++L 
Sbjct: 1088 RIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELF 1147

Query: 1111 SKSENSYNQQSSATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRA 1170
            SK +NS           +++ +LR +RDIL T+L+V++ E + LR  L+SV  EL  T+ 
Sbjct: 1148 SK-DNSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKR 1206

Query: 1171 KLTEIRQQYENTKISVEEHDNIMXXXXXXXXXRESNITLRNEANDSREKAKQLQEDLETL 1230
            +L++ +++       + +H+ I+         RESNITLRN A +  +K ++LQE+L  L
Sbjct: 1207 QLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQEELNQL 1266

Query: 1231 REKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAE 1290
            RE++LPLE+E N L   + E +QQLN YKEE NRWK+RSQ+IL KH +IDP +H++L+ +
Sbjct: 1267 RERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEK 1326

Query: 1291 IATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSL 1350
            ++ L+  L +  KEN+EL+DRFNR+KKQAHE+LNSSK  Q TL +Q+ +L +  + ++  
Sbjct: 1327 VSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGK 1386

Query: 1351 LETERGNIQNTEEKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVKSSDEISSHL 1410
             E E   +   +E+       +E V +++ +L +AL  S+E E   +A+++ ++EI+  L
Sbjct: 1387 FEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHSRELEQNLSATLQQNEEITKKL 1446

Query: 1411 NDVIDSLNNELTHLKESKNNEATVTGQ--PDLSNVVEEMKKSFEEEKIKFVQDQTTEFKE 1468
            ND IDSL  EL  LKE   + AT  G+   DLSNVVE M++SFEEEKI F++++T E K+
Sbjct: 1447 NDEIDSLKLELHSLKE--QSAATAKGEISEDLSNVVESMRRSFEEEKINFLKEKTEELKK 1504

Query: 1469 KLAEEVKRIEAQATDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLP 1528
               EE   ++    + Q + V   ++I   + QWE E EE +LKRI +AEENLK+RIRLP
Sbjct: 1505 L-EEEKHTLQVNGNEPQQQPVN-YEEI---KRQWESEQEESILKRIAEAEENLKKRIRLP 1559

Query: 1529 TEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSEENKTFIEDLKNDIKKELERNIDQEL 1588
            TEE+I  V++KKK  LE+ Y +K+ +    L SS+ N +   DLK  ++K+L+   + E+
Sbjct: 1560 TEERIKQVVEKKKAALEELYKKKLEESKSSLESSDGNNS---DLKKQLEKDLQEKFEAEV 1616

Query: 1589 KNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSNAANENKNDVEVLLKTPSDENNVP 1648
            +  K KAFEEGKQQA MK+T LE+KISKLESQL G   + +  +     +  P    N+P
Sbjct: 1617 QAVKKKAFEEGKQQAAMKSTLLERKISKLESQLHGKVDSPDKSSSETSSVPKP----NLP 1672

Query: 1649 SKQEETLSKPQLSKIQIANPLLSTGGTTLALNQSRAPSSLQNGSDSSNPFTSPFQQTKND 1708
            SK +E   K   +   + NPL+S G   L L+ S+   +  + S   NPFTS  Q     
Sbjct: 1673 SKIDE---KSVTTNQSVPNPLVS-GEKVLKLDPSKPTFNFSSFS-GGNPFTSSPQNNDTM 1727

Query: 1709 ANIPAVTQPAFLLR------------------EPSEPNMSVS-TISRQSTSETNTESELP 1749
                   +P F L                   +P+ P  S + T +     E++  +  P
Sbjct: 1728 GTSAFGFKPTFTLSNNSNKSSGTKIDSSSTENKPANPFSSFTETGASSPERESSNTAMTP 1787

Query: 1750 VSSEGLATPSSKRPAQEDTEE 1770
               EG +TP SKR A++D  E
Sbjct: 1788 TPGEGASTP-SKRAAEDDDNE 1807

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  898 bits (2321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/1779 (35%), Positives = 1039/1779 (58%), Gaps = 92/1779 (5%)

Query: 3    TAADTLTKEELTLIGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEEL 62
            T    + + ++T I SFL +   +++ ++ +++  L  K  QF +L++Q+LK  V+L+EL
Sbjct: 8    TTPSVIGEIDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDEL 67

Query: 63   QKTSQGRINDLRTQLEDLIEQNAXXXXXXXXXXXXXXXXXXXXFQLSSTRDNLRAELKEI 122
            + +S+ R    + QLE + E                          S   + L+++L E+
Sbjct: 68   KSSSERRSEAFKLQLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLLKSQLTEL 127

Query: 123  QEKFDNLQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYND 182
            +++ +  +   QD ++LL+ KI   E  ++   +L    +    +  +LE+E+Q+ K ND
Sbjct: 128  KQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSND 187

Query: 183  SLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNC 242
               +  M +L+Q++  +    + LE EL +K ++   Y     +E+QT   +++++ +  
Sbjct: 188  LRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNSIRSEL 247

Query: 243  SIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMIDVLQTQV 302
             I +S +  LK     +S  L +K ++++ L +  +               +ID+L+ Q+
Sbjct: 248  EIERSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQI 307

Query: 303  QKLQDDYTRILNTKQPIVQNDEERNLEVEELKQKLIETETQLN------KELEERRNITM 356
            +  +   T + + +   V N +  + E E++ ++LIET+ +L        +LEE  +  +
Sbjct: 308  ESFK---TELESARNKSVSNSDHVDAEREKIIEELIETKKKLEISESKAVKLEETVDELL 364

Query: 357  QTES---------------STLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEK 401
             T+                +++  +   D+  +KK LIQER QKE+LQ QVE F++ELE 
Sbjct: 365  STDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEH 424

Query: 402  KVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQ 461
            KVP +NSFK+RT+MLEKEL+D  L+LE   ++K +  +EL +++      + +  SL +Q
Sbjct: 425  KVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQ 484

Query: 462  RNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILXXXXXXXXXXXQQVISERLVTFQ 521
            R+DLAHQ+Q++LI  SV+NDSNGPL+ EE  FI+ I+           Q++ISERLV F+
Sbjct: 485  RSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERLVRFE 544

Query: 522  NIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLE 581
            ++VELQ+KN++LL S+R LA KLE +E+  +S S+ VE + + EAKEAI++LQ YN  LE
Sbjct: 545  SMVELQEKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAILTLQEYNKSLE 604

Query: 582  DKIKTLNDELDCYKSL---------PKPDTKVETEHLRLNEENTDLIKELETRLATSREE 632
             +++ +  E D +K L         P      E  HL L EE    IKELE  L++  EE
Sbjct: 605  SQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEK---IKELENHLSSLTEE 661

Query: 633  SNKTFASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKR 692
            S K    LN EI  + R  + T    + ER+SR LAE R KLI N+L ++K+EN++L+KR
Sbjct: 662  SAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKR 721

Query: 693  LEILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIV 752
               LQ+  LKQD +TQ+T++  +SCK  LS  Q++LN  QS+ ++ ++ +++LK +   +
Sbjct: 722  FHSLQENILKQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQENLKKENESL 781

Query: 753  SKERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKEL 812
            S+ERN ++ L++QLQ+LQTERE +   T+ + Q + + +E EL D  EKL  K +EI + 
Sbjct: 782  SEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDY 841

Query: 813  ESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAY 872
             S + S+ +WYQ K D + E+ +  +++L  K  +I  L  +++ L   L+ SE+R+ A+
Sbjct: 842  ISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAF 901

Query: 873  KVLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKK 932
              LN S++V ++ ETL+ ELEK++I L++AY++++QYK  A   EE     ++ +E++K 
Sbjct: 902  NALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKA 961

Query: 933  EFIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNH 992
            E+  KIETL K+RD   D   IL +QI++LNNEL+HQ      + S+ ++ L +L A+  
Sbjct: 962  EYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQS 1021

Query: 993  NIEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTYRK 1052
             ++ +  +YE K+S +Q DL QQ SYAN AQ NYEQELQKHA+++K IS LR +A  Y+ 
Sbjct: 1022 ELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKS 1081

Query: 1053 KMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSK 1112
            + ++++  A   ++ L ++E  WE+Q   YED++    +RIEDL++Q+K+L+DQ+D LSK
Sbjct: 1082 ETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLSK 1141

Query: 1113 SE--NSYNQQSSATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRA 1170
             +  +S +    +T   +L+ SLR ++DIL+T+L V+  E K LR KL  + ++L  +R 
Sbjct: 1142 GKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRI 1201

Query: 1171 KLTEIRQQYENTKISVEEHDNIMXXXXXXXXXRESNITLRNEANDSREKAKQLQEDLETL 1230
            +L+++++       ++++ + IM         RESNITLRNEA  + E++++L+ +L+ L
Sbjct: 1202 ELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDAL 1261

Query: 1231 REKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAE 1290
              KV PLE++   L+  ++E + Q++   EE  RWKQRSQDIL K+++IDP EH+KL  +
Sbjct: 1262 YGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADK 1321

Query: 1291 IATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSL 1350
            ++ L+Q +  K  ENEEL+ RF R+K+QAHE+LN++K  Q TL  Q+  L+     +++ 
Sbjct: 1322 VSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLEND 1381

Query: 1351 LETERGNIQNTEEKFRQMNK-QSEDVTALRSQLEEALLSSKEFENKFNASVKSSDEISSH 1409
            L +++  ++N E K   + K +S +   L+ QLE +     E ENK      SS  +   
Sbjct: 1382 LGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKE 1441

Query: 1410 LNDVIDSLNNELTHLKESKNNEATVTGQP-----------DLSNVVEEMKKSFEEEKIKF 1458
            LN+ I+SL N++  L+E  + E   T  P           + S +VE +K  FEEEK K 
Sbjct: 1442 LNERIESLMNKIKLLEE--DLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKM 1499

Query: 1459 VQDQTTEFKEKLAEEVKRI-EAQATDTQNKNVT----PLQDISAQREQWEKEYEEIVLKR 1513
            + D+ +E +E+  EE   I EA+  + + +  T    P  +I   +++WE+EYE+   +R
Sbjct: 1500 ISDKESELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYEQKTSQR 1559

Query: 1514 IEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKEL---------LSSEE 1564
            I ++ E LK+RIRLPTEEKIN +++KK+ ELE E++  V ++A+E+          S+E 
Sbjct: 1560 IRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIAKSKSASNSNSTEV 1619

Query: 1565 NKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGS 1624
             +   +DL+N +K+E+++  D+++   K +AFEEGKQQA MK+TFLEKKI+KLE+Q++  
Sbjct: 1620 LEKHKQDLEN-LKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAH 1678

Query: 1625 NAANENKNDVEVLLKTPSDENNVPSKQEETLSKPQLSKIQIANPLLST-----GGTTLAL 1679
            ++A             P ++N+  +  E   S P    ++   P+L+       G  L  
Sbjct: 1679 DSA------------IPINDNSSATPAE---SGPTTQDVKQLTPILNNQAAILPGKPLPF 1723

Query: 1680 NQSRAPSSLQNGSDSSNPFTSPF-----QQTKNDANIPA 1713
            N +     +  G  +SN F +PF     +QT N    P+
Sbjct: 1724 NPAHFAFGMPFGQTTSNSFQNPFNSQPPEQTPNSPKRPS 1762

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/1796 (35%), Positives = 1021/1796 (56%), Gaps = 113/1796 (6%)

Query: 2    STAADTLTKEELTLIGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEE 61
            ST  D  T E L  I SF    +EQ+ +I+  I+++L  K+ QF EL+S++++  V+L+E
Sbjct: 10   STQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDE 69

Query: 62   LQKTSQGRINDLRTQLEDLIEQNAXXXXXXXXXXXXXXXXXXXXFQLSSTRDNLRAELKE 121
            L+  S  +IN L+T++ED++ QN                       LS+  ++++ +L +
Sbjct: 70   LKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRKLSD 129

Query: 122  IQEKFDNLQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYN 181
            + E+   +Q   Q T+K+LD ++ + E+ K  +    ++ ++  +   +LE + Q+   N
Sbjct: 130  LSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISN 189

Query: 182  DSLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENN 241
            D  +++ + + +Q+L  +   K+ LE EL +K+++   Y       I  +R  ++ + N+
Sbjct: 190  DLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRND 249

Query: 242  CSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMIDVLQTQ 301
              + K+ ND L+++N  +S +L EK  +++ L++  N+              +ID+L++Q
Sbjct: 250  FQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQ 309

Query: 302  VQKLQDDYTRILNTKQPIVQNDEERNL--EVEEL-------KQKLIETETQLNKELEERR 352
            +  ++++      +    V +D+ + L  E E+L       K KL++ E     E     
Sbjct: 310  LNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCEN----ECLRLS 365

Query: 353  NITMQT--ESSTLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFK 410
            +IT +   E   L+++   D   +KK+LI+E+  KE LQNQ+E FIVELE KVP INSFK
Sbjct: 366  SITEEAGKEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIINSFK 425

Query: 411  QRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQ 470
            +RTD LE EL +A LLLE+   EKN    EL    +     K E   L+KQR DL  Q+Q
Sbjct: 426  ERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCRQIQ 485

Query: 471  YILIHTSVQNDSNGPLSAEEVRFIQDILX-XXXXXXXXXXQQVISERLVTFQNIVELQQK 529
            Y+L+  SV NDS GPL  EE++FIQ+IL            Q++++ERLV F++I++LQ+K
Sbjct: 486  YLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDIIQLQEK 545

Query: 530  NIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLND 589
            N +LL+  R LA KLE  E   ++  + +E + I+EAKEAI++LQS   +LE KI  L  
Sbjct: 546  NSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKIHELEK 605

Query: 590  ELDCYKSLP-----KPDTKVETEHLRLNEENTDLIKELETRLATSREESNKTFASLNNEI 644
            E + +K+        P+  V  +      E     ++L+ R++    ES +  + LN E+
Sbjct: 606  EREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSLLNKEL 665

Query: 645  DDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQD 704
             D+  + S    E   E++SR LAE+R KL+ N+L L+K EN+QL+KR   LQ+   KQD
Sbjct: 666  QDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNAISKQD 725

Query: 705  QRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVS 764
             +TQETL +YVSCK  LS  + EL+ ++ +  +    EK+LK +++ +S E+  L  +V+
Sbjct: 726  SKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIELEKNLKQELSELSSEKTSLHIMVT 785

Query: 765  QLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQ 824
            QLQ+LQ ERE + + TK   Q ++D ++    ++  +   KD+ IK+LE +  S+IEWYQ
Sbjct: 786  QLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSKIEWYQ 845

Query: 825  NKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTK 884
            NKI+ +++  ++    L EK  E+    YEIK L+K+++ ++ R+  Y VL+ S N    
Sbjct: 846  NKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDESIND--- 902

Query: 885  METLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKD 944
             ++L+ ELEKSKINL++AY+++ +YK+     ++ L+   + ++E+ K F  +I+ L  +
Sbjct: 903  -DSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTDE 961

Query: 945  RDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELK 1004
            +  L D  S+L EQ+++LNNELD QN+A  +EK+E  KK++ L   N  IE V  +YE K
Sbjct: 962  KTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAEFKKKISILQNNNKEIEAVKTEYESK 1021

Query: 1005 LSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTN 1064
            LS +Q DL+QQ  YAN AQNNYEQELQKHA+++KTIS+LRE  HTY+ +++++       
Sbjct: 1022 LSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQF 1081

Query: 1065 EELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSEN-SYNQQSSA 1123
            E+ L++NE  W  Q++S  +Q+     RIEDLSSQNKLL+DQ++L + + N   + +S +
Sbjct: 1082 EKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSGS 1141

Query: 1124 TPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTK 1183
              N D++++LR +RDIL T+++V E + K LR K+S ++ EL   R KL   + + E   
Sbjct: 1142 VLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKRS 1201

Query: 1184 ISVEEHDNIMXXXXXXXXXRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNR 1243
              +++HD +M         RESN TLRNE + S  K K+LQ +LE LR  + P+E+E   
Sbjct: 1202 FIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELAA 1261

Query: 1244 LKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKK 1303
            LK  I+E EQ++   KEE +RWK+RSQDI+ KH+++   ++EKLE EI +LK  L DK +
Sbjct: 1262 LKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKTQ 1321

Query: 1304 ENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEE 1363
            +  +  ++FNR+++QA E+L +SK +Q + I+Q+ +L+D    ++  L      IQ  E+
Sbjct: 1322 QGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELED 1381

Query: 1364 -KFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELT 1422
             K  +   Q   +  L+   EE   +SKE E K   +  S D     LN+ I  L  EL 
Sbjct: 1382 AKVAENRNQLSMIKKLQEDTEE---NSKELETKLEENAISYDSTVKKLNEEIGILKEELE 1438

Query: 1423 HLKESKNNEATVTG--QPDLSNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQ 1480
              ++ +       G  Q DLS VVE MK+SFEE+KIKF++++T E  +K+ E  +  EA+
Sbjct: 1439 KQRQIQQQFQAAAGTEQDDLSKVVESMKRSFEEDKIKFIEEKTREVNQKIREFQEAQEAE 1498

Query: 1481 ATDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKK 1540
             T  +  N+    +I   ++QWE E+ E V K+I +AEE LK+RIRLPTEEKI+ +I++K
Sbjct: 1499 ETGLKPSNI----NIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTEEKISKIIERK 1554

Query: 1541 KNELEKEYDEKVNQRAKEL------------------------LSSEENKTFIEDLKN-- 1574
            K +LEKE+DEKV +R K +                        L +E NK   E L+   
Sbjct: 1555 KEDLEKEFDEKVEERLKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELP 1614

Query: 1575 ---------------DIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLES 1619
                           DI+ +L    + EL+  K K+FEEGKQQAMMKTT LE+K++K+ES
Sbjct: 1615 SSDIISSDDKDKLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMES 1674

Query: 1620 QLQGSNAANENKNDVEV----LLKTPSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGT 1675
            QL      +E K  V+     L K P+    +P K EE  + P        NPLLS    
Sbjct: 1675 QL------SETKQSVDSPPKHLSKMPNPLLGLPRKIEENSNPP-------YNPLLSGEKL 1721

Query: 1676 TLALNQSRAPSSLQNGSDSSNPFTSPF------------QQTKNDANIPAVTQPAF 1719
                ++S +           NPFTSP             + + N+   P    P+F
Sbjct: 1722 LKLNSKSSSSGGF-------NPFTSPSPNKPLQGDEAEREPSSNETEPPTHLAPSF 1770

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  872 bits (2252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/1789 (36%), Positives = 1036/1789 (57%), Gaps = 125/1789 (6%)

Query: 11   EELTLIGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQGRI 70
            E L  I SF    +EQ+ + +  ++ +L  K+ QF EL+S++LK  VS +EL+ +S  +I
Sbjct: 19   ERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKI 78

Query: 71   NDLRTQLEDLIEQNAXXXXXXXXXXXXXXXXXXXXFQLSSTRDNLRAELKEIQEKFDNLQ 130
            + L+T++E++I +N                      +LSS  + ++ +L ++ E+    Q
Sbjct: 79   DGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSELEFVKRKLDDLTEEKKETQ 138

Query: 131  KQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYNDSLTETTMN 190
               Q T+K+LD ++ + E+ +    +  ++ ++  +   DLE + Q    ND  + T + 
Sbjct: 139  SNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLNSRTELE 198

Query: 191  KLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSIIKSEND 250
            + +Q+L  +    + LE EL +K+++   Y       I  +R +++ L N+  + ++ ND
Sbjct: 199  RKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERTNND 258

Query: 251  ALKKENRIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMIDVLQTQVQKLQDDYT 310
             LK++N  +S +L EK  +++ L++  N+              ++D+L++Q+  ++++  
Sbjct: 259  VLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEELN 318

Query: 311  RI--LNTKQPIVQNDEERNLEVEELKQKLIETE---TQLNKELEERRNITMQTE--SSTL 363
             I  LNT + I  + +++  E E+L ++L  T+    Q  KE     +IT + +  +  L
Sbjct: 319  SIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKECLRLSSITDEADEDNENL 378

Query: 364  SNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTDA 423
            S +   D   +KK+LI+ER  KE LQNQ+E FIVELE KVP INSFK+RTDMLE EL +A
Sbjct: 379  SAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINSFKERTDMLENELNNA 438

Query: 424  TLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSN 483
             LLLE+   EKN    EL+A  Q     + + ++LTKQR DL  Q+QY+LI  SV NDS 
Sbjct: 439  ALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQYLLITNSVSNDSK 498

Query: 484  GPLSAEEVRFIQDILXXXXXX-XXXXXQQVISERLVTFQNIVELQQKNIDLLKSVRELAR 542
            GPL  EE++FIQ+I+            Q+V++ERLV F+NI++LQ+KN +LLK VR LA 
Sbjct: 499  GPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQLQEKNAELLKVVRNLAD 558

Query: 543  KLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYK-SLPKPD 601
            KLE +E+  + + Q +E + ++EAKEAII+L+S    LE +I+ L  EL+  K S+P  D
Sbjct: 559  KLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLESRIEELQKELEELKTSVPNED 618

Query: 602  TKVETEHLR-LNEENTDL---IKELETRLATSREESNKTFASLNNEIDDIRRNHSQTVKE 657
                   ++ L E   DL   +++L+TR++    ES +  + LN EI D+  + S    +
Sbjct: 619  ASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSLLNKEIQDLYDSKSDISIK 678

Query: 658  CQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEYVSC 717
               E++SR LAE+R KL+ N+L L+K EN+QL+KR + LQ+  LKQD +T ETL EYVSC
Sbjct: 679  LGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSC 738

Query: 718  KVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQTEREQIF 777
            K  LS  + EL  ++ +  +    EK+LK ++  +S E++ L+ +V+QLQ+LQ ERE + 
Sbjct: 739  KSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDSLRIMVTQLQTLQKEREDLL 798

Query: 778  NSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAIKEKRDAY 837
              T+   Q ++D +E  L ++ ++   KD  IK+LE +  S IEWYQNKI+A+K+  ++ 
Sbjct: 799  EETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESV 858

Query: 838  QDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMETLQNELEKSKI 897
               +  K  +I +L Y++K L+K+++  + R+  Y V++ + N     ++L+ ELEKSKI
Sbjct: 859  ITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETIND----DSLRKELEKSKI 914

Query: 898  NLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLDTKSILSE 957
            NL++AY+++ +YK       + L+   + ++E+ K+F  +I+ L  ++  L D  S+L E
Sbjct: 915  NLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKE 974

Query: 958  QITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQQAS 1017
            Q+ +LNNELD Q K   +EK++  K+++ L   N  +E V ++YE KLS +QNDL+QQ  
Sbjct: 975  QMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTI 1034

Query: 1018 YANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKNEKLWEE 1077
            YAN AQNNYEQELQKHA+++KTIS+LRE  HTY+ ++ ++  +    E  L++NEK W  
Sbjct: 1035 YANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQLENALKENEKSWSS 1094

Query: 1078 QRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNEDLVLSLRSDR 1137
            Q++S  +Q+     RIEDLSSQNKLL+DQ+ + + ++   N  ++     +++++LR +R
Sbjct: 1095 QKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNGPGLNNILITLRRER 1154

Query: 1138 DILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEEHDNIMXXXX 1197
            DIL T+++V E + K LR K+S ++ EL + R KL   R + EN    +++HD+IM    
Sbjct: 1155 DILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHSSIIQQHDDIMEKLN 1214

Query: 1198 XXXXXRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNA 1257
                 RESNITLRNE  ++  K K+LQ +L+ L++ V P+E+E   LK  ++E EQ+L  
Sbjct: 1215 QLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIESELTALKYSMQEKEQELKL 1274

Query: 1258 YKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKK 1317
             KEE +RWK+RSQDIL KH+++   ++EKLE+EI  LK+ L +K+++  E  ++FNR+++
Sbjct: 1275 AKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKEELENKERQGAEAEEKFNRLRR 1334

Query: 1318 QAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTE-EKFRQMNKQSEDVT 1376
            QA ERL +SK +Q +L +Q+  L D    +++ L      I+  +  K  Q N Q E   
Sbjct: 1335 QAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNAKVAQGNNQLE--- 1391

Query: 1377 ALRSQLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNNEATVTG 1436
            A+R   E+A  +S+E + K   S  S +   + LN+ I +L  E+   ++ +      + 
Sbjct: 1392 AIRKLQEDAEKASRELQAKLEESTTSYESTINGLNEEITTLKEEIEKQRQIQQQLQATSA 1451

Query: 1437 --QPDLSNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQD 1494
              Q DLSN+VE MKKSFEE+KIKF++++T E  EK+      +EAQ    Q  N+  +++
Sbjct: 1452 NEQNDLSNIVESMKKSFEEDKIKFIKEKTQEVNEKI------LEAQERLNQPSNIN-MEE 1504

Query: 1495 ISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVI----------------- 1537
            I   +++WE E+E+ V ++I +AEE LK+RIRLPTEEKIN +I                 
Sbjct: 1505 I---KKKWESEHEQEVSQKIREAEEALKKRIRLPTEEKINKIIERKKEELEKEFEEKVEE 1561

Query: 1538 -----------------------QKKKNELEKEYDEKVNQRAKELLSSEENKTFIED--- 1571
                                   Q+K+ ELE EY++K+ +  K++  S    + I D   
Sbjct: 1562 RIKSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHS----SHISDDER 1617

Query: 1572 --LKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSNAANE 1629
              L+ +I+  L    + EL+  K K+F+EGKQQAMMKTT LE+K++K+ESQL  +  + E
Sbjct: 1618 DKLRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQSAE 1677

Query: 1630 NKNDVEVLLKTPSDENNV-------PSKQEETLSKPQLSKIQIANPLLSTGGTTLALNQS 1682
            +          P   NNV       P K EE  + P        NPLLS G   L LN  
Sbjct: 1678 S---------PPKSVNNVQNPLLGLPRKIEENSNSP-------FNPLLS-GEKLLKLNS- 1719

Query: 1683 RAPSSLQNGSDSSNPFTSP----FQQTKND--------ANIPAVTQPAF 1719
                  ++ S   NPFTSP      Q  ND         + P   +P+F
Sbjct: 1720 ------KSSSGGFNPFTSPSPNKHLQNDNDKRESLANKTDPPTHLEPSF 1762

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  867 bits (2240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/1779 (34%), Positives = 1023/1779 (57%), Gaps = 73/1779 (4%)

Query: 2    STAADTLTKEELTLIGSFLSVPVEQLNAI-ETSILSN-LKTKVEQFTELQSQSLKNEVSL 59
            S+  D L++     I  FL +  ++L  +    +LS+ L  K+++F  LQS +L+   ++
Sbjct: 10   SSGTDELSQR----IAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATV 65

Query: 60   EELQKTSQGRINDLRTQLEDLIEQNAXXXXXXXXXXXXXXXXXXXXFQLSSTRDNLRAEL 119
            +EL+     +++ L+ + E LI +N                            +N++ EL
Sbjct: 66   DELKALCTSKVDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFEL 125

Query: 120  KEIQEKFDNLQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLK 179
            +   E+ + L+   Q+ +KLL+ KIS+ E  K  + +L N  +    +  + ++E+Q+LK
Sbjct: 126  QNTIEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLK 185

Query: 180  YNDSLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLE 239
             N    ++ +  + Q +  +++  E LE E+ +K +++ +Y      E+Q   ++++ L+
Sbjct: 186  CNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLK 245

Query: 240  NNCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMIDVLQ 299
            N+  + KS  + L K+N+ +S +L  K  ++++L++  NT              ++D+  
Sbjct: 246  NDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQD 305

Query: 300  TQVQKLQDDYTRILNTKQPIVQNDEERNLEVEELKQKLIETETQLNKELEERRNITMQTE 359
             Q+Q  +++  R+   K    + D   NL+  + + + ++   Q+ ++LEE  +  ++ +
Sbjct: 306  EQLQSFKEEL-RLTEEKHNSTEAD---NLQSTQ-QARFMDDLAQVRQQLEESNHERLRLQ 360

Query: 360  S---STLSNQQQEDLDT---------------IKKELIQERYQKEKLQNQVEIFIVELEK 401
            +     + + ++ DLD+               +KK+LI+ER+QKE LQ Q+E F+VELE 
Sbjct: 361  AVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEY 420

Query: 402  KVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQ 461
            KVP INS K+R+  LEKEL+D  LLLE+   EK + T EL++     K ++  T +L +Q
Sbjct: 421  KVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQ 480

Query: 462  RNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILXXXXXXXXXXXQQVISERLVTFQ 521
            R+DLA Q+Q++L + ++QNDS GPL+A+EV FI+ I+           Q +I+ERLV F+
Sbjct: 481  RSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFK 540

Query: 522  NIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLE 581
            +I  LQ++N +LLK+ R LA +LE +E++       +E++ IDEAKEAII+LQ  N+++E
Sbjct: 541  DIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIE 600

Query: 582  DKIKTLNDELDCYKSL-----PKPDTKVETEHLRLNEENTDLIKELETRLATSREESNKT 636
             K+ T+  E D YK++        D   + + ++ ++EN +LIK LE +L+T   E++K 
Sbjct: 601  SKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKN 660

Query: 637  FASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEIL 696
               LN EI ++ ++ +Q     + ER+SR LAE RLKL+Q++L ++K EN +L +R   L
Sbjct: 661  NELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHEL 720

Query: 697  QDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKER 756
            Q I  KQ+ R  ET+ +Y+SC+  LS  +     + ++ ++ +++  SL+ +I  +S ER
Sbjct: 721  QSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKSLLQSSSDSLRREIQKISVER 780

Query: 757  NELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNR 816
            N L  +V+QLQ+LQ+ERE +   ++   +  +  +E +  ++  ++ +KD EIK  E  +
Sbjct: 781  NSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAK 840

Query: 817  LSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLN 876
             ++ +W+Q KID +       +DEL  KT  + +L  E+  L+K ++ S+SR+ +YK LN
Sbjct: 841  RAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLN 900

Query: 877  NSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIR 936
            ++ N  T    L+ +LEK+ I L  AY++ +++KQ +S  EE L+N  N  EE  +    
Sbjct: 901  DAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKS 960

Query: 937  KIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEE 996
              E    ++ +L    S L + I  LNNE   Q     EEK+EI KKL  L +  H++ +
Sbjct: 961  NAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQ 1020

Query: 997  VSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDS 1056
            V  +Y+ KL  LQ DLEQQ +YANIAQ NYE+ELQKHAE++K ISQLR +  + R ++  
Sbjct: 1021 VKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQ 1080

Query: 1057 MQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENS 1116
            ++A+    +E+L   EK W  Q+   +  I  LK++++++SSQNKLLF QV+LLSKSE  
Sbjct: 1081 LKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSERE 1140

Query: 1117 YNQQSSATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIR 1176
            +  +     +E L++SLR +RDIL+T+L+V++ E K L  K  ++  EL   R KL +++
Sbjct: 1141 FENKLLPGSSE-LLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQ 1199

Query: 1177 QQYENTKISVEEHDNIMXXXXXXXXXRESNITLRNEANDSREKAKQLQEDLETLREKVLP 1236
            +   N     ++H++IM         RESN+TLRN  N ++EK   LQ +L  L+ K+LP
Sbjct: 1200 ENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILP 1259

Query: 1237 LEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQ 1296
            L +E +  ++ I+E +Q++    +E +RWK+RS DIL +H+KIDP E+ KLE EI+ LK+
Sbjct: 1260 LNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKK 1319

Query: 1297 NLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERG 1356
             L  K KEN +LNDRF R+KKQAHE+LN+SK  Q  L  ++ +L+     ++ +L+  + 
Sbjct: 1320 ELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQT 1379

Query: 1357 NIQNTEEKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDS 1416
             + N E+   + + +S +   LR +L++AL   KE E K   +V SS+ ++S LN+ I+S
Sbjct: 1380 KVLNLEKLLTERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINS 1439

Query: 1417 LNNELTHLKESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKR 1476
            L  ++   KE K N++T+ G   LSNVVE MKK+FEEEKIKF+Q++T E+ +K  EE  +
Sbjct: 1440 LKEQVRIFKE-KENDSTLEGSQGLSNVVESMKKAFEEEKIKFIQEKTEEYNKKFEEEKAK 1498

Query: 1477 IEAQATDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSV 1536
            + ++          P  D+++ ++QWE+EYE I  +RI++AEENLK+RIR+PTEE+I  V
Sbjct: 1499 LSSENGSPAEPVSAP--DVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKV 1556

Query: 1537 IQKKKNELEKEYDEKV--NQRAKELLSSEENKTFIEDLKNDIKKELERNIDQELKNAKAK 1594
            + K+K ELE+E+  ++  N    E   ++E     E+LK  ++ E E    + L + K K
Sbjct: 1557 LDKRKTELEEEFQRRLKENNLQPEGGDAKER----EELKKQLESEFEAKYKEILASTKKK 1612

Query: 1595 AFEEGKQQAMMKTTFLEKKISKLESQLQGSNAANENKNDVEVLLKTPSDENNVPSKQEET 1654
            AFEEGKQQA MK+T LE+KISKLESQL  SN             K  +    +P+K +E+
Sbjct: 1613 AFEEGKQQAAMKSTLLERKISKLESQLNSSNNPTPE--------KAAATSVGLPTKIDES 1664

Query: 1655 LSKPQLSKIQIANPLLSTGGTTLALNQSRAPSSLQNGSDSSNPFTSPFQQTKNDANI--- 1711
             ++       +A    + G   L L  S  P+     S  SNPFTS      N   +   
Sbjct: 1665 RTE------NMATGTPAFGEKVLKL--SDKPAFSFQPSSKSNPFTSALPGNNNVFGMKPT 1716

Query: 1712 ----PAVTQPAFLLREPSEPNMSVSTISRQSTSETNTES 1746
                P  +QP       S P    +  +  +  E+N  S
Sbjct: 1717 FSFTPGSSQP------ESRPTFGSTGFNTTAEPESNRSS 1749

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  868 bits (2244), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/1796 (36%), Positives = 1036/1796 (57%), Gaps = 119/1796 (6%)

Query: 2    STAADTLTKEELTLIGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEE 61
            ST  +    E L +I SF    +EQ+ +I+T I++ L  K+ QF EL+S++L+  VS +E
Sbjct: 10   STQNEEGASERLNVIASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDE 69

Query: 62   LQKTSQGRINDLRTQLEDLIEQNAXXXXXXXXXXXXXXXXXXXXFQLSSTRDNLRAELKE 121
            L+  S  +I+ L+T++E+++ QN                      QLS+  ++++ +L +
Sbjct: 70   LKTNSLKKIDGLKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLND 129

Query: 122  IQEKFDNLQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYN 181
            + E+   +Q   Q T+K+LD ++ + E+ K    +  N+ R   +   +LE + Q+   N
Sbjct: 130  LTEEKKEIQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITN 189

Query: 182  DSLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENN 241
            D  + + + + +Q+L  +   K+ LE EL +K ++   Y     A I  +R +++ L+N+
Sbjct: 190  DLNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKND 249

Query: 242  CSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMIDVLQTQ 301
              + K+ ND LK++N  +S++L EK   ++ L++  NT              +ID+L+TQ
Sbjct: 250  FQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQ 309

Query: 302  VQKLQDDYTRILNTKQPIVQNDEERNL--EVEEL-------KQKLIETETQLNKELEERR 352
            +  ++++   I  +    V +D+ R L  E E L       K+KL + E+    E     
Sbjct: 310  LNAVKEELKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCES----ECLRLS 365

Query: 353  NITMQT--ESSTLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFK 410
            +IT +T  ES TL+++   D   +KK+ I+E+  KE+LQNQ+E FIVELE KVP INSFK
Sbjct: 366  SITEETGEESGTLTSRSSTDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFK 425

Query: 411  QRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQ 470
            +RTDMLE EL ++ LLLE+   EKN    EL+   +     + +   LT+QR DL  Q+Q
Sbjct: 426  ERTDMLENELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQ 485

Query: 471  YILIHTSVQNDSNGPLSAEEVRFIQDILXXX-XXXXXXXXQQVISERLVTFQNIVELQQK 529
            Y+LI  SV NDS GPL  EE++FIQ+IL            Q++++ RLV F+N++ELQ+K
Sbjct: 486  YLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQEK 545

Query: 530  NIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLND 589
            N +LL+  R LA KLE  E   +     +E + I+EAKEAI+SLQS    LE K++ L  
Sbjct: 546  NTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMSLESKVEELER 605

Query: 590  ELDCYKS-LPKPDTKVETEHLR-LNEENTDL---IKELETRLATSREESNKTFASLNNEI 644
            E +  KS + K  +      ++ L +   +L   +++L+ R++    ES +  + LN EI
Sbjct: 606  ERETLKSSISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSLLNKEI 665

Query: 645  DDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQD 704
             DI  + S    E   E++SR LAE+R KL+ N+L L+K EN+QL+KR + LQ    KQD
Sbjct: 666  QDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISKQD 725

Query: 705  QRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVS 764
             +T ETL EY+SCK  LS ++  L+ ++ +  +   +EKSLK ++  +S E+  L+ +V+
Sbjct: 726  SKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRIMVT 785

Query: 765  QLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQ 824
            QLQ+LQ ERE + +  +   Q +++ VE    ++  +  +KD+ I +LE +  S+IEWYQ
Sbjct: 786  QLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEWYQ 845

Query: 825  NKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTK 884
            NKI+ +K+  D+  + + EK  EI +L Y++K L+K+++ ++ R+  Y V++ + N    
Sbjct: 846  NKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETIND--- 902

Query: 885  METLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKD 944
             ++L+ ELE SKINL+EAY+++ +YK+      + L    + ++E+ + F  +I++L  +
Sbjct: 903  -DSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDE 961

Query: 945  RDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELK 1004
            +  L D  S+L EQ  +LNNELD Q     ++K E  K +  L   N  IE V ++YE K
Sbjct: 962  KINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYESK 1021

Query: 1005 LSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTN 1064
            LS +Q+DL+QQ  YAN AQNNYEQELQKHA+++KTIS+LRE  HTYR ++ ++  + +  
Sbjct: 1022 LSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSEL 1081

Query: 1065 EELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSY-NQQSSA 1123
            E +L++NEK W  Q++S  +Q+     RIEDLSSQNKLL++Q++L + + N   + ++  
Sbjct: 1082 ENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARNGP 1141

Query: 1124 TPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTK 1183
            T N D++++LR +RDIL T+++V E + K LR K++ ++ EL + R KL   R + +   
Sbjct: 1142 TLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDERS 1201

Query: 1184 ISVEEHDNIMXXXXXXXXXRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNR 1243
              V++HD IM         RESNITLRNE  +  +K K+LQ +L  L+E + P+E+E + 
Sbjct: 1202 SIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELSA 1261

Query: 1244 LKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKK 1303
            LK  ++E EQ++   KEE +RWK+RSQDIL KH+++   ++EKLE+E+ +LK  L DK +
Sbjct: 1262 LKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKMQ 1321

Query: 1304 ENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTE- 1362
            +  E  +RFNR+++QA E+L +SK TQ+TL +Q+ +L+D    ++  L      IQ  E 
Sbjct: 1322 QGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRIQELEG 1381

Query: 1363 EKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELT 1422
            EK  + N +SE +   RSQ E+A  SS+E E K   +  S       LN+ I +L  E+ 
Sbjct: 1382 EKVAEDNNRSEMIK--RSQ-EDAEKSSRELEEKLEENAISYSSTVRKLNEEIATLKEEIE 1438

Query: 1423 HLKESKNNEATVTGQ--PDLSNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQ 1480
               + +    T  G    DLSN+VE MKKSFEE+KIKF++++T E  +K+ E  +R+   
Sbjct: 1439 KQGQIQKQLQTAAGHRDEDLSNIVESMKKSFEEDKIKFIEEKTREVNKKIQEAQERL--- 1495

Query: 1481 ATDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKK 1540
                   N     +I   ++QWE E+EE V +R+ +AEE LK+RIRLPTEEKI+ +I++K
Sbjct: 1496 -------NQPSSVNIDEMKKQWEAEHEEEVAERVREAEEALKKRIRLPTEEKISKIIERK 1548

Query: 1541 KNELEKEYDEKVNQRAKELLSSEENKTFI------------------------------- 1569
            K +LEKE++EK+ ++ K +  SE+ +  +                               
Sbjct: 1549 KEDLEKEFNEKLEEKVKSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVS 1608

Query: 1570 ----------EDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLES 1619
                      ++L+ +I+ +L   ++ EL+N K K+FEEGKQQA MKTT LE+K++K+ES
Sbjct: 1609 HSSSISVNEKDELRAEIEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMES 1668

Query: 1620 QL----QGSNAANENKNDVEVLLKTPSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGT 1675
            QL    Q + +  ++ N+V      P+    +P K EE  + P        N LLS G  
Sbjct: 1669 QLSEIKQSAESPPKHANNV------PNPLLGLPRKIEENSNSP-------FNTLLS-GEK 1714

Query: 1676 TLALNQSRAPSSLQNGSDSSNPFTSPF------------QQTKNDANIPAVTQPAF 1719
             L  N      S  + S + NPFTSP             + + N  + P    P+F
Sbjct: 1715 LLKFN------SKSSSSGAFNPFTSPSPKKLLQKDDVQKETSNNKTDPPTHLAPSF 1764

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  855 bits (2210), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/1795 (35%), Positives = 1027/1795 (57%), Gaps = 140/1795 (7%)

Query: 9    TKEELTLIGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQG 68
            T E L  I SF     EQ+ +I + ++ +L  K+ QF EL+S++L+  VS +EL+  S  
Sbjct: 17   TDERLKAIASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSK 76

Query: 69   RINDLRTQLEDLIEQNAXXXXXXXXXXXXXXXXXXXXFQLSSTRDNLRAELKEIQEKFDN 128
            +I++L+ ++E+LI+QN                      ++S+  ++++    ++ E+   
Sbjct: 77   KIDNLKKEMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKE 136

Query: 129  LQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYNDSLTETT 188
            LQ   Q T+K+LD ++ + E+ +    +  N+ +   +   DLE + Q L  +D  +   
Sbjct: 137  LQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAE 196

Query: 189  MNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSIIKSE 248
            + + +Q+L  +    + LE EL +K+++   Y       I  +R +++ L ++  + K++
Sbjct: 197  LERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEKTK 256

Query: 249  NDALKKENRIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMIDVLQTQVQKLQD- 307
            ND L ++N  +S +L EK  +++ L++  ++              ++D+L++Q+  +++ 
Sbjct: 257  NDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEE 316

Query: 308  -DYTRILNTKQPIVQNDEERNL-EVEELKQKLIETE---TQLNKELEERRNITMQT--ES 360
             D TR L T      ND ++++ E E+L ++L  T+    Q   E     +I  +T  ES
Sbjct: 317  LDSTRGLET-----SNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLSSIIGETDEES 371

Query: 361  STLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKEL 420
             + +++   D   +KK+LI+E+  KE LQNQ+E FI+ELE KVP INSFK+RTD LE EL
Sbjct: 372  GSSTSRSSSDFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTLENEL 431

Query: 421  TDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQN 480
             +A LLLE+   EKN    EL A  +  K  + + ++L KQR DL  Q+QY+LI  SV  
Sbjct: 432  NNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITNSVSK 491

Query: 481  DSNGPLSAEEVRFIQDILX-XXXXXXXXXXQQVISERLVTFQNIVELQQKNIDLLKSVRE 539
            DS GPL  EE+ FIQ+IL            Q++++ERLV F++I+ELQ+KN +LLK VR 
Sbjct: 492  DSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTELLKIVRN 551

Query: 540  LARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSLPK 599
            LA +LE  E   + + Q +E + I+EAKEAI++L++   +LE K++ L  E +  K+L  
Sbjct: 552  LADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKVEELEKECENSKALLS 611

Query: 600  PDTKVETEHL-----RLNEENTDL---IKELETRLATSREESNKTFASLNNEIDDIRRNH 651
             +   ET HL     +LNE   +L   I++L++ ++    ES +  + LN EI D+  + 
Sbjct: 612  NE---ETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQDLYDSK 668

Query: 652  SQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETL 711
            S    +   E++SR LAE+R KL+ N+L L+K EN+QL+KR + LQ   LKQD +TQETL
Sbjct: 669  SDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQETL 728

Query: 712  KEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQT 771
             EY+SCK  L+  + EL  ++ +  +   +E++LK ++  +S E+  L+ +V+QLQ+LQ 
Sbjct: 729  NEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQTLQK 788

Query: 772  EREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAIK 831
            ERE + + T+   Q ++D +E    ++  +  +KD+ IK+LE +  S IEWYQNKI+ +K
Sbjct: 789  ERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIEVLK 848

Query: 832  EKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMETLQNE 891
            +  ++    + +K  EI +L +++K L+K++  ++ R+  Y V++ + N     ++L+ E
Sbjct: 849  KDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTIND----DSLRKE 904

Query: 892  LEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLDT 951
            LEKSKI+L++AY+++ +YK+      + L+   +  EE+ K+F  +I+ L  ++  L + 
Sbjct: 905  LEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLEEK 964

Query: 952  KSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQND 1011
             S+L EQI +LNNELD QNK   EEK+E  KK++ L   N  +E V ++YE KLS +Q D
Sbjct: 965  ISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQKD 1024

Query: 1012 LEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKN 1071
            L+QQ  YAN AQNNYEQELQKHA+++KTIS+LRE  HTYR +++++  +    E  L++N
Sbjct: 1025 LDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTLKEN 1084

Query: 1072 EKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNEDLVL 1131
            E+ W  QRK+  +Q+ +   RIEDL+SQNKLL+DQ++L + ++      +       ++L
Sbjct: 1085 ERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNSILL 1144

Query: 1132 SLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEEHDN 1191
            SLR +RDIL T+++V E + K LR K+S ++ EL   R KL   R + E     +++H++
Sbjct: 1145 SLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQQHED 1204

Query: 1192 IMXXXXXXXXXRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKEN 1251
            IM         RESNITLRNE  ++ E+ + LQ +L+ L++ + P+E+E   LK  ++E 
Sbjct: 1205 IMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESELAALKYSMQEK 1264

Query: 1252 EQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDR 1311
            EQ+L   KEE +RWK+RSQDIL KH+++   ++EKLE EI +LK  L +K ++  E  +R
Sbjct: 1265 EQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEAEER 1324

Query: 1312 FNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTE-EKFRQMNK 1370
            FNR+++QA ERL +SK +  TL +Q+  L++    ++  L+     I+  E  K  Q N 
Sbjct: 1325 FNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELENAKAEQDNN 1384

Query: 1371 QSEDVTALRSQLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNN 1430
            Q + +  L+   E    SSKEF+ K        +E ++  +  I  LN E+  L+E    
Sbjct: 1385 QLDAIKRLQQDAEN---SSKEFKTKL-------EEKATFYDSTIKKLNEEIITLREEIEK 1434

Query: 1431 EATVTGQ----P-----DLSNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQA 1481
            +  +  Q    P     DLS +VE MKK+FEE+KI F++++T E  EK+      +EAQ 
Sbjct: 1435 QRRIQQQLQSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKI------LEAQE 1488

Query: 1482 TDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKK 1541
               Q  N+    +I   + +W+ E+EE V+ RI +AEE LK+RIRLPTEEKI+ +I++K+
Sbjct: 1489 RLNQPSNI----NIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKR 1544

Query: 1542 NELEKEYDEKVNQRAKELL-SSEENKTF--------------IED--------------- 1571
             +LEKE+DEKV +R K L  S + + TF              +ED               
Sbjct: 1545 EDLEKEFDEKVEERIKLLSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSI 1604

Query: 1572 -------LKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGS 1624
                   L+ +I+ ++ + +D EL++ K K+FEEGKQQAMMKTT LE+K++K+ESQL  +
Sbjct: 1605 SIDERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSET 1664

Query: 1625 NAANENKNDVEVLLKTPSDENN--------VPSKQEETLSKPQLSKIQIANPLLSTGGTT 1676
                E          +PS   N        +P K EE  S          NPLLS     
Sbjct: 1665 KKITE----------SPSKHVNHTQNQLLGLPRKIEENSSSS-------FNPLLSGEKLL 1707

Query: 1677 LALNQSRAPSSLQNGSDSSNPFTSPF------------QQTKNDANIPAVTQPAF 1719
               ++S +           NPFTSP             + T N A+ P    P+F
Sbjct: 1708 KLNSKSSSSGGF-------NPFTSPSPNKSSQKVDDQRELTTNKADPPTHLTPSF 1755

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  853 bits (2205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/1812 (36%), Positives = 1037/1812 (57%), Gaps = 133/1812 (7%)

Query: 16   IGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQGRINDLRT 75
            + SFL    + +  ++ +IL +L  + ++F  ++++ +K    LE  +KT+   I  L+ 
Sbjct: 24   VASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTELEVTKKTNNTTIKKLKN 83

Query: 76   QLEDLIEQNAXXXXXXXXXXXXXXXXXXXXFQLSSTRDNLRAELKEI---QEKFDNLQKQ 132
            +L +LI+                        +    RD L ++L +I   +E    LQ +
Sbjct: 84   ELTELID---SYESVCKEKEDAYKKIAEEEEKKIDNRDELESKLIQIHSLEENVSELQSK 140

Query: 133  NQDTIKLLDRKISQ-NEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYNDSLTETTMNK 191
             Q+ IK LD +I++ NE    + L L N+  ++  K   LE+E Q LK ND    T + +
Sbjct: 141  KQELIKSLDDRITELNEYRHNIEL-LNNEKSKTRNKILQLENENQDLKINDLSQRTQLER 199

Query: 192  LSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSIIKSENDA 251
            LSQ+L++I++ K  LE  L  K ++   Y      E Q L+ +++T++N    +KS N  
Sbjct: 200  LSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKSTNCV 259

Query: 252  LKKENRIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMIDVLQTQVQKLQ----- 306
            L++    +S+ L + S+ ++ +    N               +I VLQ+Q+ +LQ     
Sbjct: 260  LQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRENGN 319

Query: 307  ----------------DDYTRILNTKQPIVQNDEERNLEVEELKQKLIETETQLNKELEE 350
                             D+TR +N  +  + + +ERN+E+E           +L K  E+
Sbjct: 320  ELSLTVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELE----------FKLRKS-ED 368

Query: 351  RRNITMQTESSTLSN---QQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTIN 407
               ++  T S  L N   +  +D+D +KK+L  E+ Q+E  +  +E F+ +LE ++PT+ 
Sbjct: 369  YTAVSNSTSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTLE 428

Query: 408  SFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAH 467
            +++ R    E+EL +ATLLLE   +EK+ V++EL+  +   +S++ E K + KQR+DLA+
Sbjct: 429  AYRHRAAAREEELKEATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLAN 488

Query: 468  QLQYILIHTSVQNDSNGPLSAEEVRFIQDILXX--XXXXXXXXXQQVISERLVTFQNIVE 525
            QLQ+ L+H SV NDS GPL+ EEV+FI++I+             Q+VISERL  F++I+E
Sbjct: 489  QLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIE 548

Query: 526  LQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIK 585
            LQQKN++LLK+ RELA KLE +++ +Q+    +E++ I EAKEAI++LQ+YN+ L  KI 
Sbjct: 549  LQQKNMELLKTTRELATKLEEEDKIKQAEKSRIEEETIAEAKEAILTLQNYNSSLTAKIA 608

Query: 586  TLNDELDCYKSLPKP-DTKVETEHLRLNE----ENTDLIKELETRLATSREESNKTFASL 640
             L  EL+ YK L    D+    +  +  E    E+T L+KELETR+A+  +ES +    L
Sbjct: 609  ALTKELETYKVLSNTEDSSTPADFDKQREQREIEHTQLVKELETRIASIIQESKENANIL 668

Query: 641  NNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDIT 700
            N++I  +   ++    E   E+++++LAE+RLKL+Q S+ ++  ENE+LQKRL  L+++ 
Sbjct: 669  NDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNVV 728

Query: 701  LKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELK 760
            ++QD+RT ET+   +  +  L+  +N+ N  Q+++ +  ++E+ LK+++T +++E+N +K
Sbjct: 729  VEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEEKNSMK 788

Query: 761  ELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEI 820
             LV++LQ+LQ+ERE + ++T+       D   +EL D+     +  +++KE E N  S +
Sbjct: 789  LLVTRLQTLQSEREHLLSTTQ-------DKFNKELNDLEGTCNDLRKKLKEAEENYGSLM 841

Query: 821  EWYQNKIDAIKEKRDAYQDEL--LEK-TNEIGELNYEIK----KLQKDLQASESRVTAYK 873
            E      D  ++K+ + ++E+  +EK  +EI E   E K    +L K L+     +  YK
Sbjct: 842  EETTELKDDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELIEKYK 901

Query: 874  VLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKE 933
              ++ +    ++ +LQ EL+  K  L+E+Y++ + Y++      + + +    V   +  
Sbjct: 902  AASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEAA 961

Query: 934  FIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHN 993
            F  +I  ++  ++ + D+ ++L  QI DLNNEL+ Q K + +EK   ++  NEL      
Sbjct: 962  FKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKG 1021

Query: 994  IEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTYRKK 1053
            +E+    YE KL +L  DLE+Q  YAN AQNNYEQELQ HA ++KTISQLRE    YR +
Sbjct: 1022 LEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTE 1081

Query: 1054 MDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKS 1113
            +  +  +AT  + LL +N+  W++QR  YE QI   KKRIE+ S QNK+LF+Q  L +++
Sbjct: 1082 IAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQA 1141

Query: 1114 ENSYNQQSSAT----PNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTR 1169
             +  N +SS       +  LVLSLRS+RD+LQ RL+VTE E K LR +L+S+  +   T 
Sbjct: 1142 NDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATD 1201

Query: 1170 AKLTEIRQQYENTKISVEEHDNIMXXXXXXXXXRESNITLRNEANDSREKAKQLQEDLET 1229
             +L +I+++  N    +E+H  +M         RESNITLRNE  + + K + LQ ++E 
Sbjct: 1202 LELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVEN 1261

Query: 1230 LREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEA 1289
            L +K+LPLE E   L  +I+E ++QL+   EE  RWKQRSQDIL+K+++IDPVEHE L  
Sbjct: 1262 LHDKLLPLETELQTLTNLIEEKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAE 1321

Query: 1290 EIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQS 1349
            E   L+  L +K KENEEL +RF ++KKQAHE+LN+SK +Q +L  QI  LE +   + S
Sbjct: 1322 ERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLS 1381

Query: 1350 LLETERGNIQNTEEKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVKSSDEISSH 1409
             LETE+    + E++     K S D+ +++SQLEEAL+ SK+FE KF  SV+SS +I  +
Sbjct: 1382 QLETEKEGKLSLEKRLEVTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEEN 1441

Query: 1410 LNDVIDSLNNELTHLKESKNNEATVTGQPDLSNV-------------VEEMKKSFEEEKI 1456
            LN  I  L  E + L+E   +E   T   ++ NV             VE MK+SFEEEKI
Sbjct: 1442 LNSEIKKLQEESSKLQEELAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKQSFEEEKI 1501

Query: 1457 KFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQ-DISAQREQWEKEYEEIVLKRIE 1515
            KF+++QTTEFK+KL  E+ +++A+    + K + P+  D +A R+Q E+EYE+   +RI+
Sbjct: 1502 KFIEEQTTEFKKKLQAEINKLKAEY---ETKQIEPVSIDENAIRKQIEEEYEQATSQRIK 1558

Query: 1516 QAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSEENKTFIEDLKND 1575
            +AEENLKRRIRLPTEEKIN VI K++ +LE E+  KV  RAKELL+ +E   F + +K +
Sbjct: 1559 EAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFFDRMKKE 1618

Query: 1576 IKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSNA--------- 1626
            I++EL R  ++EL+  K KAF+EG+QQ +MKT+FLEKKI+KLES LQ + +         
Sbjct: 1619 IQEELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLESDLQNAKSNTGATDNTI 1678

Query: 1627 -ANENKNDVEVLLKTPS--DENNVPSKQEETLSKPQLSKI--QIANPLLSTG-GTTLALN 1680
             + +N+   E   K P   + N V    E    +  ++K    I NPLLS G    L LN
Sbjct: 1679 VSTDNETKYEGSDKKPVTINTNVVSDVGENNAERTPMNKFPRAIMNPLLSNGEHLNLILN 1738

Query: 1681 QSRAPSSLQNGS--------------------------------DSSNPFTSPFQQTKND 1708
             S +       +                                 ++NPFTSPFQ +   
Sbjct: 1739 PSSSSLQPSPSNRNVGGTTTTTTTTNNNNNNNNNNKNKNNSGSGGNNNPFTSPFQLSTTT 1798

Query: 1709 ANIP-AVTQPAF 1719
            A IP +V QP F
Sbjct: 1799 ATIPQSVVQPTF 1810

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  811 bits (2094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/1755 (33%), Positives = 996/1755 (56%), Gaps = 86/1755 (4%)

Query: 4    AADTLTKEELTLIGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQ 63
            A+D+    + + + +FL V   ++  ++ S+++    K  +F+++++ +++  +S++ L+
Sbjct: 6    ASDSSISVDYSKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLK 65

Query: 64   KTSQGRINDLRTQLEDLIEQNAXXXXXXXXXXXXXXXXXXXXFQLSSTRDNLRAELKEIQ 123
               + +IN  + Q+E L+   A                     QLS     LR++++E +
Sbjct: 66   CNFEQKINTFKEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAK 125

Query: 124  EKFDNLQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYNDS 183
            +  + +    QD  KLL+ KIS     KE + +L    +E      DLE  IQ  K  + 
Sbjct: 126  QGMEIIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQEL 185

Query: 184  LTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCS 243
              ++ + +L Q+L  +    + L  ELE+K+++++ +     +E+Q   +++++L++   
Sbjct: 186  REKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLE 245

Query: 244  IIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMIDVLQTQVQ 303
              ++ N  LK +   +S+ L EK  + ++L ++ NT              +ID+L++QV 
Sbjct: 246  FARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVS 305

Query: 304  KLQDDYTRILNTKQPIVQN---------------DEERNLEVEELKQKLIETETQLNKEL 348
             ++ D     N  Q   QN               D ++NLE  + +   I+ E  +N+ L
Sbjct: 306  SMKSDLE---NAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAEN--IKLEATVNELL 360

Query: 349  EERRNITMQTESSTLSNQQQE-----------DLDTIKKELIQERYQKEKLQNQVEIFIV 397
                   +   +S +S+   +           D+  +KK+L+QER QKE+LQNQVE F+V
Sbjct: 361  SVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVV 420

Query: 398  ELEKKVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKS 457
            ELE K+P +NSFK+RTDMLE+EL D TLLLE+  ++++Q T EL+  +    + + +  S
Sbjct: 421  ELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCS 480

Query: 458  LTKQRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILXXXXXXXXXXXQQVISERL 517
            L  QR+DLAHQ+QY+L+  SV++D++GPL+ +EV F++ I+           Q +ISERL
Sbjct: 481  LIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERL 540

Query: 518  VTFQNIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYN 577
            V F++++ELQ KN +LL ++R+LA KLE +E+  +   + VE Q + EAKEAI+SLQ + 
Sbjct: 541  VQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHV 600

Query: 578  TKLEDKIKTLNDELDCYK--------SLPKPDTKVETEHLRLNEENTDLIKELETRLATS 629
             +LED++K ++ E D +K            P +  +++ L       + I ELE RL   
Sbjct: 601  QRLEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSKKL------DEHIMELEKRLKNL 654

Query: 630  REESNKTFASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQL 689
             E+S      LN+EI  + +  S+     + ER+S+ LAE+RLKLIQ++LSL+K EN +L
Sbjct: 655  AEQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLEL 714

Query: 690  QKRLEILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDI 749
             KR + LQ + LKQD++TQ T+ E ++ K  LSN  ++L  + S+ +  +  E  LK++ 
Sbjct: 715  HKRSDDLQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNEN 774

Query: 750  TIVSKERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREI 809
              ++KE    K LVSQLQ+LQ ER+ +    + + +  ++ +E +L++  E L  + RE 
Sbjct: 775  EALTKENTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREY 834

Query: 810  KELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRV 869
            +E   +  S+ +W+Q K+D++ E+ D  +  L EKTN I  L    K L   L+ +E R 
Sbjct: 835  EEQRVSDTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRT 894

Query: 870  TAYKVLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEE 929
             +Y VL N+D++  K+ETL+  LEK+ INL++AY++++QYK  A   E+        +EE
Sbjct: 895  QSYSVLANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEE 954

Query: 930  TKKEFIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLA 989
            ++  + + I  L+++R  L D  ++L++QI DLN+ELDHQ   +  EKSE+ KKL+ L  
Sbjct: 955  SQANYRKNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQG 1014

Query: 990  QNHNIEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHT 1049
               +++E+ ++YE K+S LQ DL QQASYAN AQ NYEQELQKHA++ KTIS LRE++  
Sbjct: 1015 SQRSLDELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQK 1074

Query: 1050 YRKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDL 1109
            Y+ +M+  + +A+  +  L +NE+ W +Q    E Q+   ++R E+L++QN+LL+DQV+L
Sbjct: 1075 YKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVEL 1134

Query: 1110 LSKSENSYNQQSSATPNE--DLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTN 1167
            LSK+ +S ++ +++   E  +L+++LR +RDIL+T+L V+  E K LR +L    TEL N
Sbjct: 1135 LSKATSSDSEAAASMSAESRELIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELEN 1194

Query: 1168 TRAKLTEIRQQYENTKISVEEHDNIMXXXXXXXXXRESNITLRNEANDSREKAKQLQEDL 1227
             R + ++ +    ++  + E  + IM         RESN+TLRNE+    E+++  Q ++
Sbjct: 1195 VRLEFSKTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEI 1254

Query: 1228 ETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKL 1287
              L+E++ PLE++   L   I E +QQ++  KEE +RWKQRSQDIL K+++IDPVEH+KL
Sbjct: 1255 AKLQEQLQPLESQLKSLTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKL 1314

Query: 1288 EAEIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHI 1347
              E+  LK  L  K  EN E  +RF +++KQA+ERL+  KA +  +  + + +    A +
Sbjct: 1315 ADEVTELKNELEKKSLENLESQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQL 1374

Query: 1348 QS-LLETERGNIQNTEEKFRQMNKQSEDVTALRSQLEEA---LLSSKEFENKFNASVKSS 1403
            ++ L +T     +   +     N+++ +  +L+ +LEE     + + E      A   SS
Sbjct: 1375 EAELAQTLDKVSELESKLSSSANEKNGEADSLKEELEELRANFIEANEAVADIKAEAASS 1434

Query: 1404 DEISSH----LNDVIDSLNNELTHLK-ESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKF 1458
            ++   +    L + I +L +E+ H + E+KN+       PD + +VE MKK FEEEK   
Sbjct: 1435 EKDLKNQIQELTEKIKTLESEIEHSELEAKNS----NDSPDFAPIVENMKKKFEEEKQVL 1490

Query: 1459 VQDQTTEFKEKLAEEVKR----------IEAQATDTQNKNVTPLQDISAQREQWEKEYEE 1508
            +Q++  E + KL EE+++           E +A+  ++    PL D    + + E EYE+
Sbjct: 1491 IQEKDEELRMKL-EEIQKQYEEERERELSELKASLVESTPNAPLIDEETLKSKLEAEYEK 1549

Query: 1509 IVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSEENKTF 1568
              L+RI +AEE LK+RIRLP+EE+IN VI++++  L++E++ +V  RA EL   E  ++F
Sbjct: 1550 KTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELF-KENPESF 1608

Query: 1569 IEDLKNDIKK------ELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQ 1622
            + D    IK+      +LE   D++L   + KAFEEGKQQ +MK   LE KI+KLE Q  
Sbjct: 1609 VGDTAKLIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQ-- 1666

Query: 1623 GSNAANENKNDVEVLLKTPSDENN--VPSKQEETLSKPQLSKIQIANPLLSTGGTTLALN 1680
              N  N N +   V  K P D NN   P   +    KP   ++     + +T   +   +
Sbjct: 1667 -PNKINLNNS---VPSKIPIDNNNNSSPQGAQPIAIKPSPFQVAFGKAMENTSFGSFKGS 1722

Query: 1681 QSRAPSSLQNGSDSS 1695
               +   + N +D+S
Sbjct: 1723 LLDSKQFIANTADTS 1737

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/1670 (34%), Positives = 937/1670 (56%), Gaps = 91/1670 (5%)

Query: 19   FLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQGRINDLRTQLE 78
            FL +   +L A++  ++ N+  K  +F +LQ+++L+  V+++EL+ +S+ ++   + Q+ 
Sbjct: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81

Query: 79   DLIEQNAXXXXXXXXXXXXXXXXXXXXFQLSSTRDNLRAELKEIQEKFDNLQKQNQDTIK 138
             L+++                       +  +  + LR   + ++++   L+    D  +
Sbjct: 82   LLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKNDVAR 141

Query: 139  LLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYNDSLTETTMNKLSQDLKS 198
            LL+ KIS+    K+    L  + R    +  DLE E +  K  D   +  +++LSQ+L  
Sbjct: 142  LLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQELSL 201

Query: 199  ISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSIIKSENDALKKENRI 258
                 E LE++L  K+ + + Y    Q+++  L +K+ TLE         N +L++ N  
Sbjct: 202  CRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQASTRTNKSLREHNAR 261

Query: 259  VSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMIDVLQTQVQKLQDDYTRILNTKQP 318
            ++++L  +   V++LT+  N+              ++D+L+ QVQ L+ D    L  +  
Sbjct: 262  ITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSD----LELRST 317

Query: 319  IVQNDEER-----NLEVEELKQK---LIETETQLNKELEERRNITMQTESSTLSNQQQE- 369
              + D+       N   EEL QK   L E+E ++ K  +  +++    + S L +   E 
Sbjct: 318  AGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLKSSAHEY 377

Query: 370  ---------DLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKEL 420
                     D+  +K+++I E+ QKE LQNQVE F+VELE KVP ++SFK R DMLE++L
Sbjct: 378  PASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLEEQL 437

Query: 421  TDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQN 480
             +   +LE++ ++K  V  +L   +      + +   LT+QR+DLA Q+QY+LI  SV++
Sbjct: 438  AETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQASVRS 497

Query: 481  DSNGPLSAEEVRFIQDILXXXXXXXXXXXQQVISERLVTFQNIVELQQKNIDLLKSVREL 540
            DS GPL+ EE+ F++ IL           Q+VISERLV F++IVELQ KN DLL+++R L
Sbjct: 498  DSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSDLLRTIRNL 557

Query: 541  ARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSLPKP 600
            A KLE +EE  +  S+ VE  AI EAKEAII+LQ +  +LE +I+ L  E D YK++ +P
Sbjct: 558  ADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDAYKAI-QP 616

Query: 601  DT----KVETEHLRLNEEN--TDLIKELETRLATSREESNKTFASLNNEIDDIRRNHSQT 654
             T    K+ TEH   N +   +  + +LE  L T REE+ K    LN+EI ++ R  ++ 
Sbjct: 617  STNNGNKI-TEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQKTKL 675

Query: 655  VKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEY 714
              E + ER S+ LAE+RLK+ Q SL L+K ENE+L KR  I+QD  LKQD +TQETL   
Sbjct: 676  AIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQETLSCL 735

Query: 715  VSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQTERE 774
            + C+  L+  ++EL    +++    + +K   + I  ++ ERN L  LV+QLQ+LQ ER+
Sbjct: 736  IECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNLTILVTQLQTLQGERD 795

Query: 775  QIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAIKEKR 834
            ++   T+   + ++D +E E   +  +L  KD E  +      S  +WYQ KID++ E  
Sbjct: 796  KLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKIDSLNETL 855

Query: 835  DAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMETLQNELEK 894
                 +L  +     +L  + K L+  L+  E++  +Y VLN +D+V  + E L+ ELEK
Sbjct: 856  KVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTEALRMELEK 915

Query: 895  SKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLDTKSI 954
            SKI L +AY+++++++      EE L    N  E  K E  +    ++K  DEL+     
Sbjct: 916  SKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKEDELVGQVEA 975

Query: 955  LSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQ 1014
            L  QI++LNNEL HQ K    EK+E+  +L  L +    +  +   YE +L  L  DL Q
Sbjct: 976  LKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLGKLTQDLNQ 1035

Query: 1015 QASYANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKNEKL 1074
            QA++AN AQ NYEQELQ+HA+++KTISQLRE++  Y+ +   +Q++    E+ L +++  
Sbjct: 1036 QAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSSIEQLEKTLDESDGK 1095

Query: 1075 WEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNE---DLVL 1131
            W  Q++ YE Q+ +L +RIEDL+ QN LL DQ+DL +K  NS   QS   P E   +L+ 
Sbjct: 1096 WLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQSE--PQEKVRELIT 1153

Query: 1132 SLRSDRDILQTRLSVTEE-EGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEEHD 1190
            SLR +RDILQT+L V++  E  +LR KL ++  EL+  + +L+ ++       I  +EH+
Sbjct: 1154 SLRRERDILQTKLEVSKRSETVSLR-KLEAIEQELSFAKEELSSLQALSSQNSIMADEHN 1212

Query: 1191 NIMXXXXXXXXXRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKE 1250
             ++         RESNITLR+E     ++ ++L+  ++ L++ + PLE+E   LK  ++ 
Sbjct: 1213 KLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQIDNLQQSLQPLESELASLKRSVRA 1272

Query: 1251 NEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELND 1310
             + Q++   EE NRWKQRSQDIL+K ++IDP EH+KL  E++  K  LA K  +N EL D
Sbjct: 1273 KDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQNSELED 1332

Query: 1311 RFNRIKKQAHERLNSSKATQQTLIDQIKQL--------------EDENAHIQSLLE---- 1352
            RF R+KKQA ERL+++KA Q  L  ++ Q               +D N  +Q  L+    
Sbjct: 1333 RFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESLQRVES 1392

Query: 1353 ------TERGNIQNTEEKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVKSSDEI 1406
                  T +  +++  +K  Q  K+++D+ + R+Q+E+AL S  E        VKS  E 
Sbjct: 1393 EAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKALQSELE-------KVKSHAE- 1444

Query: 1407 SSHLNDVIDSLNNELTHLKESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKFVQDQTTEF 1466
               L   +D    E+  L+E K    T + +      +E+MK+  EE     + ++  E 
Sbjct: 1445 --ELERRLDEARREVESLEEVKQGAFTDSSE------LEKMKRDLEEHSNTLIAEKEAEI 1496

Query: 1467 KEKLAEEVKRIEAQATD----TQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLK 1522
            +    E   R++ +AT      +N   TP+ DI   ++QWE++YE+  +KRIE++ E L+
Sbjct: 1497 RSHYEE--LRLKEKATYEKELEENGKHTPV-DIETLKKQWEEDYEQKTIKRIEESNEILR 1553

Query: 1523 RRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSE-ENKTFIEDLKND------ 1575
            +RIRLPTEEKIN +++ +K+ELE+E++ K+ +RA EL + + +  +F E +K        
Sbjct: 1554 KRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEK 1613

Query: 1576 IKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSN 1625
            +K +L R +D+E+   + KAF+EGKQQA MK+ FLEKKI+KLE+Q++ S 
Sbjct: 1614 LKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASG 1663

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/1641 (33%), Positives = 931/1641 (56%), Gaps = 54/1641 (3%)

Query: 16   IGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQGRINDLRT 75
            + SFL +  E L  +  ++ + +  K+ +F +LQ+++LK  V+++EL+ +S  ++   + 
Sbjct: 21   VASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGACKD 80

Query: 76   QLEDLIEQNAXXXXXXXXXXXXXXXXXXXXFQLSSTRDNLRAELKEIQEKFDNLQKQNQD 135
            Q+  L+++                       +  +  D LRA  + ++++   L+    D
Sbjct: 81   QIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEALEQQKQVLEANKND 140

Query: 136  TIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYNDSLTETTMNKLSQD 195
              +LL+ KI      ++ T +L  + R    +  +LE + +  K  +   +   ++LSQ 
Sbjct: 141  VAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKADFHQLSQK 200

Query: 196  LKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSIIKSENDALKKE 255
            +  ++   E LE++L  K+ + + Y    Q+E+ ++ +++ T E +          L+++
Sbjct: 201  VSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKTIKTLREQ 260

Query: 256  NRIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMIDVLQTQVQKLQDDY----TR 311
            N    S L  +   V++LT+   +              ++++L+ QV  L+ +     + 
Sbjct: 261  NGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSELEFKNSP 320

Query: 312  ILNTKQPIVQNDEERNLEVEELKQKLIETETQLNKELEERRNITMQTESSTLSNQQQ--- 368
              +T     ++  +   E+    Q+L E+E ++ K LE+     +  +  T+S  Q    
Sbjct: 321  QASTDAATTESQSQIEDELVHKTQQLEESELKIQK-LEQTVEQLLSADEKTISGSQSLPD 379

Query: 369  --EDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTDATLL 426
               D+  +KK++I ER QKE LQNQVE F+VELE KVP ++SFK R D+LEKEL +   +
Sbjct: 380  LYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLEKELAETAYM 439

Query: 427  LENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSNGPL 486
            L+++ ++K++   +L   +   + ++ +  +LT+QR+DLA Q+QY+LI  +V+ DS+GPL
Sbjct: 440  LDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQVTVRGDSHGPL 499

Query: 487  SAEEVRFIQDILXXXXXXXXXXXQQVISERLVTFQNIVELQQKNIDLLKSVRELARKLEL 546
            SAEE  F++ ++           Q +ISERLV F+NIVELQ KN DLL +VR LA +LE 
Sbjct: 500  SAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTVRNLANQLET 559

Query: 547  QEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSLPKPDTKVET 606
            +E   +S ++ +E   I EAKEAI++LQ +  +LE +I  +  E D YK++ +  T  E 
Sbjct: 560  EERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERDAYKAI-QSQTSHEG 618

Query: 607  EHLRLNE------ENTDL-IKELETRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQ 659
             +  L +      EN+DL I+ELE  L+ ++ E+      L  E  ++ R+ S+ V   +
Sbjct: 619  SNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMTENQELARSKSELVVNVE 678

Query: 660  NERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEYVSCKV 719
             E++SR LAE+RLK+ ++SL L+K ENE+L KR  +L++   KQD RTQET+ E + CK 
Sbjct: 679  KEKSSRLLAEERLKISKSSLLLTKQENEELNKRGLVLENNLAKQDTRTQETISELIDCKS 738

Query: 720  ALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQTEREQIFNS 779
             L+    EL    ++ N+  T+ + LK+    ++KERNEL  LV+QLQ+LQ ER+ +   
Sbjct: 739  QLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNELTILVTQLQTLQKERDTLLKD 798

Query: 780  TKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAIKEKRDAYQD 839
            +  + + ++D++E E+  +   L  K  E+ +  S   S   WYQ KIDA+ E   +   
Sbjct: 799  SDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQEKIDALNECLKSTTS 858

Query: 840  ELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMETLQNELEKSKINL 899
            +L  KT  I EL  +   L   L+ +E++  +Y VLN +D+V T+ + L++ELEK++INL
Sbjct: 859  DLNSKTQMIQELQSQQSLLTSKLRDAETKSQSYSVLNQTDDVLTQTDALRSELEKTRINL 918

Query: 900  SEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLDTKSILSEQI 959
             +A++++D+YK   +  +E L      +E +K++   ++ETL+K+RD L +  ++L +Q+
Sbjct: 919  KDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERDALSNDAAVLKDQL 978

Query: 960  TDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYA 1019
             +LN+ELD+Q       K E +K   E+ +    +  + +QY+L+LS L  DL QQA YA
Sbjct: 979  ANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQYQLELSKLTEDLNQQAMYA 1038

Query: 1020 NIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQR 1079
            N AQ NYEQELQ+HA+++KTISQLRE+A  ++ K+ S++A+ T  ++ L +NE  W  Q+
Sbjct: 1039 NKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITELKKSLEENESCWAAQK 1098

Query: 1080 KSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNEDLVLSLRSDRDI 1139
            + YE Q     +RIEDLS+QN+LLFDQ+ L        N +  +   E L+ +L+ + DI
Sbjct: 1099 QEYETQASLSSQRIEDLSTQNRLLFDQISLKDTDSIPINDELKSEARE-LISTLKRECDI 1157

Query: 1140 LQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEEHDNIMXXXXXX 1199
            LQT+L + + +   L+ KL     EL+  ++++ + +   +   I +EE+  I+      
Sbjct: 1158 LQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQV 1217

Query: 1200 XXXRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYK 1259
               RESNITLRNE     ++ + L+ ++E L+E + PLE +   L+  +   ++Q++   
Sbjct: 1218 NLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLIT 1277

Query: 1260 EECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQA 1319
            EE NRWKQRSQDIL K++++DP EH+KL  E++  +   A   ++  EL DRF R+KKQA
Sbjct: 1278 EEVNRWKQRSQDILLKYERVDPEEHKKLAEELSQARAEAAANAQQRSELEDRFQRLKKQA 1337

Query: 1320 HERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQMNK-QSEDVTAL 1378
             ERL++++ TQ TL  ++ +  +    ++  L+ ER   ++ +E  +   + + E+ +A 
Sbjct: 1338 RERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIKATEENEIENSSAT 1397

Query: 1379 RSQLEEALLSSKEFENKFN--ASVKSSDE---------ISSHLNDVIDSL---NNELTHL 1424
            R QL++AL   ++ + + N  ++  S +E            H+  + + L    NE+  L
Sbjct: 1398 RDQLQDALQKLEDAQARINEMSTAPSQEEQTLREELERTRQHVKQLEEHLAKTQNEVRVL 1457

Query: 1425 KESKNNEATVTG-QPDLSNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQA-- 1481
            +E+KN    V+G + +++ V    K    +   K + ++  E KEK   E +R+E +A  
Sbjct: 1458 EEAKNQ---VSGTEAEIARV----KTELIDHSNKLLAEKEAEIKEKY--EKQRLEDKAEL 1508

Query: 1482 -TDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKK 1540
                 +       DI   +++WE+EYE+  +KRIE+A E L++RIRLPTEEKIN +I+ +
Sbjct: 1509 EKSLASSESLKSSDIENLKKEWEEEYEQRTIKRIEEANEILRKRIRLPTEEKINKIIENR 1568

Query: 1541 KNELEKEYDEKVNQRAKELLSSEE-NKTFIEDLKND------IKKELERNIDQELKNAKA 1593
            K EL++E++ K+ QR  EL   +    TF E +K        +K +++R +D+E+  AK 
Sbjct: 1569 KRELDEEFEAKLQQRTSELAGEKPLPATFTEVMKRHKQEVEKLKADMKREMDEEVAQAKK 1628

Query: 1594 KAFEEGKQQAMMKTTFLEKKI 1614
            KAF+EGKQQA MK+ FLEKKI
Sbjct: 1629 KAFDEGKQQASMKSMFLEKKI 1649

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1342 (36%), Positives = 803/1342 (59%), Gaps = 36/1342 (2%)

Query: 359  ESSTLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEK 418
            +SS   ++ Q D+  +K++L+QE+ QKEKLQNQVE F++ELE K+P INSF++RT +LEK
Sbjct: 383  DSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVINSFQERTSVLEK 442

Query: 419  ELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSV 478
            ELTD  LLLE+  +E    TNEL +L++       + + L +QR DLAHQLQY+LI+ S+
Sbjct: 443  ELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLEILLRQRTDLAHQLQYLLINISI 502

Query: 479  QNDSNGPLSAEEVRFIQDILXXXXXXXXXXXQQVISERLVTFQNIVELQQKNIDLLKSVR 538
             ND++  L+ +E++FI++++           Q+VISE L+ F++I +LQ+KN++L+K+VR
Sbjct: 503  INDNDHLLNEDEIKFIKNLVSNDNMASTNDSQKVISEHLIKFKDIQQLQEKNMELVKTVR 562

Query: 539  ELARKLELQEEHQQSTSQVV---EQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYK 595
             LA++LE  EE ++STS      + +   EAKEAI++L+  N  LE  ++ +  E D +K
Sbjct: 563  TLAQQLEENEEKKKSTSNNTVDEDNEIFAEAKEAILTLEKVNENLEKNLQIVTKERDAFK 622

Query: 596  SLPKPD--------TKVETEHLRLNEENTDLIKELETRLATSREESNKTFASLNNEIDDI 647
             L   D          V   H  L   N  ++K+LE RL     +SN    +L  E++ +
Sbjct: 623  LLVSEDRERNFKSSNSVHKYH-ELKSYNETVVKDLENRLTQLTNDSNAHSKALTEELNLL 681

Query: 648  RRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRT 707
             +  SQ   + +  R+++ LAE+RLK+ QNS+ L   ENEQL+ R   L+D  L+QD+ T
Sbjct: 682  HKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRIRSSRLEDSLLQQDKET 741

Query: 708  QETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQ 767
            Q+T   YV      S+ +  +  +++++ + K  E SLK +++  ++E+ +L+ +V+QLQ
Sbjct: 742  QKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREISLKSELSNTTEEKTKLRIMVTQLQ 801

Query: 768  SLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKI 827
            SLQ+ERE +    + D + R+  V      + ++L  +  EI ++E  R ++ EWYQ KI
Sbjct: 802  SLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERVHEIDKIEKERNAQYEWYQKKI 861

Query: 828  DAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMET 887
            D   +++   Q +L  K +E+  L+ + K L+K+L+ ++ R+  Y+ +N +++   +   
Sbjct: 862  DEASQQQQQIQGQLQTKNDELERLHLQNKTLEKELEGAQIRIHTYETINQNNSENQEEND 921

Query: 888  LQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDE 947
            +  ELEK+KI L++AY++L+++K  +   E+ L+    +     +++   I+TL +++ E
Sbjct: 922  VIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELNASFNAKDRDYRDAIKTLTEEKTE 981

Query: 948  LLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLST 1007
            +     IL +Q+ ++ NEL  Q++    E+  +++ + EL      IEEV   +E KL  
Sbjct: 982  IEGRFEILKQQLENIKNELTVQSEEAESERKRLTQTIAELQGAAQPIEEVKKMFEEKLQK 1041

Query: 1008 LQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEEL 1067
            L+NDLE+Q  YAN AQ NYEQELQ+HA+++KTIS+LRE     +    S+ A   + ++ 
Sbjct: 1042 LENDLEEQTVYANNAQKNYEQELQRHADVSKTISELREQNQRLKNDTKSLTAELQSLQDQ 1101

Query: 1068 LRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSS---AT 1124
            + +NEK  + +R  Y  QI   ++RI+D++ QN+LL++Q+DLL+++E S N+ SS   A 
Sbjct: 1102 MSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNRAE-SVNENSSDDEAN 1160

Query: 1125 PNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKI 1184
             +  LVLSLR +RDIL T+++V E E  +L+ KL  +  EL NT+     +  +Y     
Sbjct: 1161 GSTALVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNELENTKRSAALLESEYSEHSD 1220

Query: 1185 SVEEHDNIMXXXXXXXXXRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRL 1244
             +  +  I          RESN+TLRNE   + ++  ++ +DL+  R ++LPL++     
Sbjct: 1221 LINNYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIAKDLQICRNELLPLQSNLESA 1280

Query: 1245 KEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKE 1304
              +IKE + ++ +  +E  RWK R ++++ KH+K++  ++ KLE  +   KQ L +K +E
Sbjct: 1281 NNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQE 1340

Query: 1305 NEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLET---ERGNIQNT 1361
              ELNDRFNR+KKQAHE+LN+SK  Q +L +QI  L  E   I+  L+    E   + + 
Sbjct: 1341 TNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNLISEKDDIRKQLDVKTEENSELLSE 1400

Query: 1362 EEKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNEL 1421
               FR+  KQ+ D+  LR +L + +  S+E E K    ++SS   S + N  I+ L   +
Sbjct: 1401 LNNFRE--KQN-DLETLREELNKEISKSEELEVKLQNEIESSSLASRNTNKEIEELQKVI 1457

Query: 1422 THLKESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQA 1481
              LK      +T   +    N VE +K+ FE +K KF+ ++T EF ++L EE ++I  + 
Sbjct: 1458 DDLKTQLAANSTDADEQTNRN-VEAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEF 1516

Query: 1482 TDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKK 1541
             + +  +     D+ A R+QWE++ EE++ KRI +AE+NLK+RIRLP+EEKIN +I+K++
Sbjct: 1517 QENEKPDTELNVDVEALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRR 1576

Query: 1542 NELEKEYDEKVNQRAKELLSSEENKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQ 1601
            +ELE E+D+K+  +A++LL ++ +  F  +LK  ++KEL+   + EL+ A+ KAFEEGKQ
Sbjct: 1577 SELESEFDQKIRDKARDLLMNDHSNEFNNELKEALEKELKERFEDELQAARKKAFEEGKQ 1636

Query: 1602 QAMMKTTFLEKKISKLESQLQGSNAANENKNDVEVLLKTPSDENNVPS--KQEETLSKPQ 1659
            QA MKTT LE+KI KLESQ+Q     +E   DV        +EN+ PS  K  ETL+   
Sbjct: 1637 QATMKTTLLERKIQKLESQIQEKEKDSEETQDV------KPEENSTPSVKKIPETLNSSD 1690

Query: 1660 LS-----KIQIANPLLSTGGTT 1676
             S      +++  P    G T+
Sbjct: 1691 TSFGNSNNVKVLKPSSPFGATS 1712

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/1523 (33%), Positives = 868/1523 (56%), Gaps = 122/1523 (8%)

Query: 191  KLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSIIKSEND 250
            ++ Q++  + E  + L  +L  K  +++E+  +  +E+Q  + K+S +E+   I ++ N 
Sbjct: 185  RMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSNQ 244

Query: 251  ALKKENRIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMIDVLQTQVQKLQDDYT 310
             LK+    +   L +K S+ +E+ + YN               MID L+  ++ L+ +  
Sbjct: 245  KLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKEMD 304

Query: 311  RILNTKQPIVQNDEERNLEVEELKQ-------------KLIETETQL--NKELE--ERRN 353
               N        ++ER+  +EEL               KL ET  +L  N +LE  E  N
Sbjct: 305  ATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLEDSEVGN 364

Query: 354  ITMQTESS-TLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQR 412
             T  +E S ++  +   DL  +KK+L+ E+ QK++L+ QVE F+VELE K+P +NSFK+R
Sbjct: 365  TTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNSFKER 424

Query: 413  TDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYI 472
            ++MLE+EL + T+LLE+  ++++Q +++LD L+   KS + +  SL+KQR DLAHQ+QY+
Sbjct: 425  SEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQIQYL 484

Query: 473  LIHTSVQNDSNGPLSAEEVRFIQDILXXXXXXXXXXXQQVISERLVTFQNIVELQQKNID 532
            L++ S++++  GPLSAEE++F++++            Q +I++RLV F+++VELQQKN +
Sbjct: 485  LVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQKNSE 544

Query: 533  LLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELD 592
            LL ++R LA +LE +E   +S  QV+E + + EAKE I++L  +   LE+++  L+ E D
Sbjct: 545  LLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILSKERD 604

Query: 593  CYKSL----------------PKPDTKVETEHLRLNEENTDLIKELETRLATSREESNKT 636
             YK+L                P PD             N D +K+LETRL    +E+   
Sbjct: 605  AYKALSVNASSGTNTPKAITYPSPD-------------NDDKVKDLETRLTAVIQEAENN 651

Query: 637  FASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEIL 696
                ++E  ++R+   +     ++E+ SR LAE RL L+Q++L LSK + E+LQKR   L
Sbjct: 652  AKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDL 711

Query: 697  QDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKER 756
            QDI  KQD+RTQET+   +  K  LS+ Q+EL+ ++S+       +K LK +    SKE 
Sbjct: 712  QDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKES 771

Query: 757  NELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNR 816
             E K L++QLQ+LQ ERE +   T+   + +L  +E EL    E+L+  ++    + SN+
Sbjct: 772  VEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASNK 831

Query: 817  LSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLN 876
              +  W+Q KID +  +    +  L EK  ++ ++   I +    L+ +E+R  +Y +L+
Sbjct: 832  EHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLS 891

Query: 877  NSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIR 936
            N D+    +ETL+ ELEK  + LS++Y++++ +K  A +  + +       EE +KE  +
Sbjct: 892  NVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQK 951

Query: 937  KIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEE 996
             I TL+ +R++L  T +IL++Q+ DLNNE+ HQ   +  E++   +++++L     +++ 
Sbjct: 952  TIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDR 1011

Query: 997  VSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDS 1056
                YE K++ +Q DLE Q  YAN +Q +YE ELQKHA+++KTI+ LR +A +Y+  +++
Sbjct: 1012 TKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDLET 1071

Query: 1057 MQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENS 1116
            ++  +    E L+ +EKLW EQ+  YED++  L++R+++LS+QNKLL+DQ++LL+K+E+ 
Sbjct: 1072 LKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNKTEDR 1131

Query: 1117 YNQQSSATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIR 1176
             N   S+    DL++SLR +RD+L+T+L V   E   L+ +L    +E+ +   +L++++
Sbjct: 1132 DNSHDSS----DLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVK 1187

Query: 1177 QQYENTKISVEEHDNIMXXXXXXXXXRESNITLRNEANDSREKAKQLQEDLETLREKVLP 1236
                 +   +E+ +NIM         RESN+TLR+E +  +++   L+  L+   +++ P
Sbjct: 1188 NSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAP 1247

Query: 1237 LEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQ 1296
            L++  + L+  IK  EQ+L   KEE  RWK RSQDIL K+++IDP EH KL+ EI  +K 
Sbjct: 1248 LQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKN 1307

Query: 1297 NLADKK-------KENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQS 1349
             L   K        E ++   +F RI+ QA +RLN+SK  +Q+L  +I Q+ +  + +++
Sbjct: 1308 ELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEA 1367

Query: 1350 LLETERGNIQNTEEKFR---------------QMNKQSEDVTALRSQLEEALLSSKEFEN 1394
             L   +   +  EE+ +               Q++K  ED+ +++ Q+E A   SK  +N
Sbjct: 1368 DLGKCKTACKELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQMENA---SKTEQN 1424

Query: 1395 KFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNNEATVTGQ---P----DLSNVVEEM 1447
              NA    SDE    L + ++ LN+++  L+   +N   +  +   P    D  ++V+ +
Sbjct: 1425 --NA---DSDEKIKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNL 1479

Query: 1448 KKSFEEEKIKFVQDQTTEFKEKL-----------AEEVKR----------IEAQATDTQN 1486
            K  FE EK + ++D+  E + K             EE+++           E + T  Q+
Sbjct: 1480 KTEFEAEKEQLIKDKEKELRSKFEAEKESAWNSREEELRKQFEEREKRIREECEKTTVQS 1539

Query: 1487 KNVTPLQ-DISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELE 1545
             +   L  DI A + +WEKEYE+  L++I+ AEE LK+RIRLPT++KI+ +++ +K  LE
Sbjct: 1540 PSQPTLDIDIDALKNEWEKEYEKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVLE 1599

Query: 1546 KEYDEKVNQRAKEL--------LSSEENKTFIEDLKNDIKKELERNIDQELKNAKAKAFE 1597
            + ++EKVN++A++L        ++ E+++  +  LK+ ++K+ E +    L   K K+FE
Sbjct: 1600 ESFEEKVNEKAQKLAGEIGNDAITLEKHRAELNALKDSMRKQFEAD----LAEIKQKSFE 1655

Query: 1598 EGKQQAMMKTTFLEKKISKLESQ 1620
            EGKQQ  +K  FLE KI  LE Q
Sbjct: 1656 EGKQQVSLKLKFLESKIRNLEQQ 1678

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/1632 (32%), Positives = 892/1632 (54%), Gaps = 106/1632 (6%)

Query: 134  QDTIKLLDRKIS-----QNEVEKELTLKLTNQYRESTAKCHDLEDE--IQSLKYNDSLTE 186
            +D  +LL+ KIS     Q E+E+   L +  + R      H++E E  +QS +      +
Sbjct: 133  RDLARLLEEKISDLDASQQELER--VLGVNKELRR-----HEMELEFTVQSQRSQSLREQ 185

Query: 187  TTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSIIK 246
              + +L Q+L  +    E    +L  K+++++ Y      EIQ+ + +++ ++N   +  
Sbjct: 186  AEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEH 245

Query: 247  SENDALKKENRIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMIDVLQTQVQKLQ 306
            +   AL+ +N  +S  L +   + + LT+  ++              +I++L  QV  ++
Sbjct: 246  ANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMK 305

Query: 307  DDYTRILNTKQPIVQNDEERNLEVEELKQKLIETETQLN-------------KELEE--- 350
             D  +  +  +    +D ER    E L   L +T+ +L              KEL E   
Sbjct: 306  QDLEKAYDVAKNGGMSDSER----ERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDN 361

Query: 351  ----------RRNITMQTESSTLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELE 400
                        N+   +  ST+S     DL  ++K+L+QER  KE+LQ QVE F+VELE
Sbjct: 362  VQSGGRNGIEHANVGSPSGGSTISTVYG-DLAALRKQLVQERRHKEELQLQVESFVVELE 420

Query: 401  KKVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTK 460
             K+P +NSFK+R + LEK+L   TLLLE   RE+++   ++   +      + +   L +
Sbjct: 421  HKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQ 480

Query: 461  QRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILXXXXXXXXXXXQQVISERLVTF 520
            QR+DLA Q+Q +LIH SV++DS+GPL+AEEV F++ +            Q +IS RLV F
Sbjct: 481  QRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEF 540

Query: 521  QNIVELQQKNIDLLKSVRELARKLELQEEHQ-QSTSQVVEQQAIDEAKEAIISLQSYNTK 579
            +++VELQQKN +LL ++R+LA+KLE QEEH+ QS  + +EQ  ++EAKEAI+SLQ +   
Sbjct: 541  KSVVELQQKNAELLNAIRQLAQKLE-QEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQM 599

Query: 580  LEDKIKTLNDELDCYK---------SLPKPDTKVETEHLRLNEENTDLIKELETRLATSR 630
            LED+++T+  E D +K         SLP P   V    L+  +E  D I  LE RL    
Sbjct: 600  LEDQLETVTTERDSFKLLVSEGKNNSLPNP---VGAAALQ-PQEVADGIAHLEARLKAMA 655

Query: 631  EESNKTFASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQ 690
            EES +    LN EI  + +++SQ   E + ER+SRELA+++L LIQ SL L K EN  LQ
Sbjct: 656  EESEQHAKMLNEEIKALYKSNSQLAIELERERSSRELADEKLSLIQKSLELVKGENADLQ 715

Query: 691  KRLEILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDIT 750
             R   LQ + L+QD R Q T++E+VS K  L +  ++L  +QS+ +  +  E  LK +  
Sbjct: 716  NRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENE 775

Query: 751  IVSKERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIK 810
             ++K+ N+ + L+ QL++ Q ER+ +   T+   +TR++ ++ EL    ++L+ K RE  
Sbjct: 776  SLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYD 835

Query: 811  ELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVT 870
            EL S+  ++ +W+Q+K+D++KE+  + +  L  KT+E+  L   +      L+ +     
Sbjct: 836  ELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQ 895

Query: 871  AYKVLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEET 930
               ++  SD+  +++++L  +L+++   LS AY+E+++YK +++  E    +Y N V++ 
Sbjct: 896  QSSLVLESDH-ASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSY-NAVQDN 953

Query: 931  KKEFIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQ 990
            K    +   +L+ +  +L    ++ +++I  L +EL+ +   +  E+SE+ +K+N L+  
Sbjct: 954  KDGSKQAAISLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTD 1013

Query: 991  NHNIEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTY 1050
               IEE    Y+ K++ LQ DLE+Q S  N A+  Y+  LQK AE+++ I  LR+ + +Y
Sbjct: 1014 KQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESY 1073

Query: 1051 RKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLL 1110
            + ++   ++ A    ++L +NE+ W++Q+   E  +    +RIE+LS+QN+LL+DQ++LL
Sbjct: 1074 KSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIELL 1133

Query: 1111 SKSENSYNQQSS--ATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNT 1168
            S+S +S  +  +  ++   +L+++LR +RDIL+T++ V++ E K LR +L    +EL N 
Sbjct: 1134 SRSPSSSLEPDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNL 1193

Query: 1169 RAKLTEIRQQYENTKISVEEHDNIMXXXXXXXXXRESNITLRNEANDSREKAKQLQEDLE 1228
            RA+L+E +        S +  + +          RE N++LRNE+    E  + LQ ++ 
Sbjct: 1194 RAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEIL 1253

Query: 1229 TLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLE 1288
            +L+EKV P+E +   L   + E EQ+L   KEE +RWKQRSQDIL K+++IDP E+ KL 
Sbjct: 1254 SLQEKVQPMEEQIKSLTATLTEKEQKLALLKEESDRWKQRSQDILHKYERIDPEEYRKLA 1313

Query: 1289 AEIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQ 1348
            +EI  LK  L  K  E+ +  +RF +++KQA+ERL+  KA +  +  +++      + ++
Sbjct: 1314 SEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLE 1373

Query: 1349 SLLETERGNIQNTEEKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVKSSDEISS 1408
            + L   R  I + E +  +    SED   +  +LEE     ++ EN  N  +KS   IS 
Sbjct: 1374 AKLSEAREKITSLETQLTE-RPASEDDNPVSHELEETKTKLQDAENTINM-LKSEWSISE 1431

Query: 1409 H-LNDVIDSLNNELTHLKESKNNEATVTGQPDLSN-------VVEEMKKSFEEEKIKFVQ 1460
                  +D LN +L  +++   N A  +G  D S+       V+E+ KK  EEE+   ++
Sbjct: 1432 ESFKKQLDELNKQLETIQK---NSAPSSGHSDPSSYHEQPTAVLEDFKKQVEEERRTLIE 1488

Query: 1461 DQTTEF--------KEKLAEEVKRIEAQATDTQNKNV-TPLQDISAQREQWEKEYEEIVL 1511
                E         K  LAE+ K +E       N +V    Q++ A +++WE+EYE+  L
Sbjct: 1489 SHQQELTARLEASRKNFLAEKEKALEELRDSLTNVSVEAASQNLEALKKKWEEEYEQQTL 1548

Query: 1512 KRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLS------SEEN 1565
            +RI +AEE LK+RIRLP+EE+IN VI++K+  LE+E+  KVN  A  LL       + + 
Sbjct: 1549 QRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASDK 1608

Query: 1566 KTFIEDLKNDI---KKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQ 1622
               I+D + +I   KK+L    + +L   K KAFEEG+QQ +MK   LE KISKLESQ +
Sbjct: 1609 ADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQAK 1668

Query: 1623 GSNAANENKNDVEVLLKTPSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGTTLALNQS 1682
                 N       V  K P  EN  P  Q+  + KP  S  Q+A    + G      N++
Sbjct: 1669 APLGTN-------VPTKIPL-ENTQPLAQQVPV-KP--SPFQLAYAQATFGNVPFLFNKN 1717

Query: 1683 RAPSSLQNGSDS 1694
                 +++  DS
Sbjct: 1718 SEQKKVEHQDDS 1729

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  492 bits (1266), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 455/1442 (31%), Positives = 791/1442 (54%), Gaps = 102/1442 (7%)

Query: 371  LDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTDATLLLENL 430
            ++ +KK++ QE+ +K+ LQ Q+E FI+ELE K+P I+SF+++   LE ELT+ TLLL   
Sbjct: 365  INLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQALENELTNLTLLLNKT 424

Query: 431  RREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSNGPLSAEE 490
              EKN + N+L+       + +   K L +QR DLA+Q++++L+  +V+NDS GPL+ EE
Sbjct: 425  SNEKNTIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREE 484

Query: 491  VRFIQDILXXXX--XXXXXXXQQVISERLVTFQNIVELQQKNIDLLKSVRELARKLELQE 548
            + FI  I              Q VISERLVTF NI ELQ KN++LL S+R L+  LE  E
Sbjct: 485  IEFINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLENIE 544

Query: 549  EHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSL----PKPDTKV 604
                ++ +  + + I +AKEAI++LQ +N  LE K+K L  E D +K L       D+ +
Sbjct: 545  --NANSHKEFQNKTIADAKEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSI 602

Query: 605  ETEHLRLN---EENTDLIKELETRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQNE 661
            + + L  +   E N   I++L+T +   + E  K   +L ++I     + S      + E
Sbjct: 603  KNDDLSSSTSPETNEKSIEKLQTLIEELKAELKKNKDALESQIASFTADKSNLTISLEKE 662

Query: 662  RASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEYVSCKVAL 721
            ++S  L  +++ L +++  + K EN++L KR E LQ+I +KQ+ +  + + +Y++ +  +
Sbjct: 663  KSSNTLMAEKISLTESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGETEI 722

Query: 722  SNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQTEREQIFNSTK 781
            SN + +L+  +S+ +    ++ SL  ++   S+E+N+L+ ++SQLQSLQ ER  + + T+
Sbjct: 723  SNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQ 782

Query: 782  LDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAIKEKRDAYQDEL 841
                +++  +E    D+ + L +K  EI++L  +  S+  WYQN ID +K+   A + EL
Sbjct: 783  KKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKTEL 842

Query: 842  LEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNS--DNVGTKMETLQNELEKSKINL 899
              K + I +LN +I+ L+           +Y +  N+   + G     +  +L+ +K++L
Sbjct: 843  TSKNSLISDLNTKIELLESQ---------SYTIDTNTRCSSSGNDFSQISKDLDITKLHL 893

Query: 900  SEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLDTKSILSEQI 959
            SEAY ++++YKQ  +  EE L+  ++  E  K     KI  L  + + L  +     ++I
Sbjct: 894  SEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLMDDKISKLLSENETLKASTGEYDKRI 953

Query: 960  TDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYA 1019
            ++L+ +L ++   + EE ++++ ++  L     +  + +++YE K+S LQ+ LE +A +A
Sbjct: 954  SELSTDLKNEKNKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFA 1013

Query: 1020 NIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQR 1079
            + AQ  YE  L K     ++I + +E      +++  ++++      LL +NE LW++++
Sbjct: 1014 DNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQ 1073

Query: 1080 KSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNEDLVLSLRSDRDI 1139
             ++   +   KK+I++L++QNKL  DQ++LL+K  +S +    ++  + +   LR+DRD+
Sbjct: 1074 DAFISDLEESKKKIDNLTNQNKLYVDQLELLNKDFSSMDSSQLSSETKHMFNRLRADRDV 1133

Query: 1140 LQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEEHDNIMXXXXXX 1199
            L+T+LS+ E + K    KL S+  EL N + KL     +       +E H+ I+      
Sbjct: 1134 LETKLSIAERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSELNQI 1193

Query: 1200 XXXRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYK 1259
               +ESN TLRN+ ++  EK K LQ  L     K+  L  E   +KE + + E  +   K
Sbjct: 1194 TLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIK 1253

Query: 1260 EECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQA 1319
            EE N+W+ R++++  +  K+D     KL  E+  LK +   K+K+N EL +RFN +KKQA
Sbjct: 1254 EESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQA 1313

Query: 1320 HERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERG---NIQNT----EEKFRQ--MNK 1370
            HERLN+SK  Q +L  QI +L+  N +I+  L +E+    ++QNT    E K+ Q   N 
Sbjct: 1314 HERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLSDNEVKYTQKLSNI 1373

Query: 1371 QSEDVTALRSQLEEALLSSK----EFENKFNASVKSSDEISSHLNDVI-DSLNNELTHLK 1425
            +SE + AL+++     LSS+    E  ++ ++  KS  E  S L+ +  DS ++ +  + 
Sbjct: 1374 ESE-LKALKTENNSFKLSSEKEKMELTDEVDSLKKSLVEAQSKLSAIGSDSTDSTMNAMI 1432

Query: 1426 ESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQ 1485
            ES   E        L +   E++  ++ EK K ++    E++EK    ++ +++  TD  
Sbjct: 1433 ESMKKEFEEEKLKLLEDKTNELEAQWKLEKDKLLK----EYEEK----IEDLQSARTDQS 1484

Query: 1486 NKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELE 1545
             K    +++  + +++WE+EYE+  L+RIE+A+E LK+RIRLP+E KIN VI+K+K+ELE
Sbjct: 1485 IK----IEEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELE 1540

Query: 1546 KEYDEKVNQRAKELLSSEENKTFIED-----LKNDIKKELERNI----DQELKNAKAKAF 1596
             EY+ K+ ++  E+   E N+  IE      L+ +IK+E++R++    + +L  AK K+F
Sbjct: 1541 NEYEVKLQEKLNEI---EANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSF 1597

Query: 1597 EEGKQQAMMKTTFLEKKISKLESQLQGSNAANENKNDVEVLLKTPSDENNVPSKQEETLS 1656
            EEGKQQ+ MKTT LE+KISKLESQL  S A   +K          SD+N + S   +T +
Sbjct: 1598 EEGKQQSSMKTTLLERKISKLESQL--SEAIENDK---------QSDKNPIISDLAQTST 1646

Query: 1657 KPQLSKIQIANPLLSTGG--TTLALNQSRA--------------------PSSLQNGSDS 1694
               +       P  S GG  TT +LN ++                     P SL     S
Sbjct: 1647 LASIQPPSAKKPAFSFGGFNTTNSLNANKGFSSSSNNTSQSSKDTEIVQNPFSLGVSQTS 1706

Query: 1695 SNPF-TSPFQQTKNDANI---PAVTQPAF---LLREPSEPNMSVSTISRQSTSETNTESE 1747
            S+P   +PF  +   +N+      ++  F   +  +P+ P +  +    +S + T T  E
Sbjct: 1707 SSPMHFNPFSSSATTSNVFNQNGTSKNIFGNVMAMKPTTPTVEQAIKPLESVTPTET-PE 1765

Query: 1748 LP 1749
            +P
Sbjct: 1766 VP 1767

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  406 bits (1044), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 417/1399 (29%), Positives = 718/1399 (51%), Gaps = 138/1399 (9%)

Query: 374  IKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTDATLLLENLRRE 433
            +K++LI+E+ QK+ LQ QVE+F++ELE ++PT+NS K R   LE+EL   T LLE   RE
Sbjct: 362  LKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERE 421

Query: 434  KNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRF 493
             +    EL    +  K        L  QR DLAHQ+Q++L++  ++      L+ +E+ F
Sbjct: 422  SDIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITF 481

Query: 494  IQDILXXXXXXXXXXXQQVISERLVTFQNIVELQQKNIDLLKSVRELARKLELQEEHQQS 553
            ++ I+           Q++ISERLV F +I  LQ++N++LL + R LA +LE       S
Sbjct: 482  LRKIIKSRNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLE------SS 535

Query: 554  TSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYK--SLPKPDTKVETEHLR- 610
             ++ V++   +E+KE I  LQ     L  K++ L  E D YK  SL     +  TE LR 
Sbjct: 536  DTKSVQKITRNESKEKIAKLQESINGLTSKLEKLQKEKDAYKLLSLQNTGEQTPTEELRS 595

Query: 611  -LNEENTDLIK-----ELETRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQNERAS 664
             L ++   L K      L++ LA   EE  K    LN  I  +++           E + 
Sbjct: 596  QLQKKEEQLTKLERMSSLDSHLA---EEKAKV---LNQSIIKLKKEKYDLNNAIIKETSQ 649

Query: 665  RELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEYVSCKVALSNS 724
            R +AE++ K++++SL L   + +   K+ E  + +    +    +  +E  + +  +S  
Sbjct: 650  RAIAEKKSKMLEDSLELLHKKYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISIL 709

Query: 725  QNEL-NYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQTEREQIFNSTKLD 783
            Q E+ +Y Q+ L  SK NE +L    + ++    E + L S+L +++ E EQ  N  +  
Sbjct: 710  QKEIESYKQNLLQYSKDNENTL----SKLAAATQEKETLGSRLSTVKNELEQKINLMQ-- 763

Query: 784  SQTRLDTVERELY-----DISEKL--------KNKDREIKELESNRLSEIEWYQNKIDAI 830
                    ERE Y      ISE+L        ++K +E+K+ E+ + S+I WYQ ++D++
Sbjct: 764  --------ERETYYKEHDSISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSL 815

Query: 831  KEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMETLQN 890
                D  Q EL     E+ ++N +  K+  DL+         K L+ + N  + +  +  
Sbjct: 816  TTTNDKLQVEL---NKELTKINIQRLKIS-DLE---------KTLSQNTNGSSSLPRVDQ 862

Query: 891  ELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLD 950
            + EK K  L E   E++QY+           +  N  EETK    + +   ++  D+ ++
Sbjct: 863  DFEKLKNELKEKQLEINQYR-----------DLLNLAEETKNRLQKDLNKQRQIVDDAME 911

Query: 951  TKSILSEQITDLNNELDHQN------KAHLEEKSEISKKLNELLAQNHNIEEVSNQYELK 1004
             K  L +Q+ +L  E    N      KA  E+  +I   + +   +  N++   +  E K
Sbjct: 912  GKEQLDQQLAELTQECSSMNSLLQKQKAKCEDDQKI---IQDKATETENLKNSLSSLENK 968

Query: 1005 LSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTN 1064
            ++TL+N++ ++       +N Y+++L K +E +  I ++  +   Y+  +D ++AN    
Sbjct: 969  ITTLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAY 1028

Query: 1065 EELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSAT 1124
            E+ +    +   +++ ++E Q+   K+ I++L+ Q  +   +   ++   ++ +  +  T
Sbjct: 1029 EDAISAYRQKLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDET 1088

Query: 1125 PNED------LVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQ 1178
               D      L+L+LR +RD L  +L +++ E  +LR ++ ++   L  TR     +  +
Sbjct: 1089 VVNDTSDKNELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESE 1148

Query: 1179 YENTKISVEEHDNIMXXXXXXXXXRESNITLRNEANDSREKAKQLQEDLETLREKVLPLE 1238
                  + E+H   +         +E+N  L+ +  ++ ++   +   LE L+ ++ PL+
Sbjct: 1149 VSGEMTTTEQHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLK 1208

Query: 1239 AEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNL 1298
             +  RLK  I E +QQL    EE  RWK RS++IL K +++D  EH KL  E++TLK  L
Sbjct: 1209 DKVERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSTLKTQL 1268

Query: 1299 ADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNI 1358
              K K+NE+LNDRFNR+KKQAHE+L+++KA   +L  +I  L D  + ++  L+ ER  I
Sbjct: 1269 DTKTKDNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRI 1328

Query: 1359 QNTEEKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLN 1418
            Q  E + +Q     + +TAL  +L +++ +SK+ E     +V SS E++  L + ++SL 
Sbjct: 1329 QEVESQLKQKPDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLK 1388

Query: 1419 NELTHLKESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKFV----QDQTTEFKEKLAEEV 1474
            ++L  LK      +   G    S  +  +K+SFE EK + +    ++   + +E+  + +
Sbjct: 1389 SQLETLKNQNGVISVADGSAINSETIAHLKESFEVEKTELITTLKEEFKKQLEEEKKKLL 1448

Query: 1475 KRIEAQATDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKIN 1534
            +  E +  D++    +   DI   + +WE++ EEI+++RI  AEENLK+RIRLP+EEKIN
Sbjct: 1449 EEKEKEYYDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKIN 1508

Query: 1535 SVIQKKKNELEKEYDEKVNQRAKELLSSEENKTFI-EDLKNDIKKELERNIDQELKNAKA 1593
             VI+K++ ELE+EY++K+ ++    L++E   T I E+L+ ++++EL    D EL   K 
Sbjct: 1509 RVIEKRRKELEEEYEKKLKRQG---LTTE---TAIEEELRKEVERELRVKFDNELAEVKK 1562

Query: 1594 KAFEEGKQQAMMKTTFLEKKISKLESQLQGSNAAN---ENKNDVEVLLKT---PSDENNV 1647
            KAF EGKQQ+ MKTT LE+K+SKLESQ   S   +     K + E   KT   PS  N +
Sbjct: 1563 KAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQKENTEGATKTTLGPSKINLL 1622

Query: 1648 P---SKQEETLSK--PQLSKIQIANPLLSTGGTTLALNQSRAPSSLQNGSDSSNPFTSPF 1702
            P   S  ++++ K  PQ             G   L +N+     SL+    SSNPFT P 
Sbjct: 1623 PFSMSNTDDSIEKQVPQ-------------GEKVLQINR----RSLEPSFGSSNPFTLPT 1665

Query: 1703 QQTKNDANIPAVTQPAFLL 1721
            Q            +PAFL 
Sbjct: 1666 Q-----------NKPAFLF 1673

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  404 bits (1039), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 482/1805 (26%), Positives = 878/1805 (48%), Gaps = 200/1805 (11%)

Query: 16   IGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQGRINDLRT 75
            I  FL VP E L  I+ S L  L  K+ +F   + +  K  V ++E++     RI+ L  
Sbjct: 5    ISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKLTK 64

Query: 76   QLEDLIEQNAXXXXXXXXXXXXXXXXXXXXFQLSSTRDNLRAELKEIQEKFDNLQKQ--- 132
             L +  E+                        ++  +D L+ E      K D L KQ   
Sbjct: 65   LLNESSEEKVINSKV-----------------MNRLQDQLKEERSRHTRKIDALNKQLNA 107

Query: 133  NQDTIKLLDRKISQNEVEKELTLKLTNQYR--ESTAKCHDLEDEI---QSLKYNDSLTET 187
            + +TIK    K+   E  KE      +  R  +ST    D E+++   + L+  + L   
Sbjct: 108  SHETIK----KLEDEEGAKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVC 163

Query: 188  TMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQ-----------AEIQTLRKKIS 236
              N +S   K  +  +E+ E  L+NK K   E  S+C            + +Q L +K++
Sbjct: 164  KSNAVSLQFKYDTASQEK-ELWLQNK-KWTEERLSSCNQKALVDEVTKTSYLQNLEEKLN 221

Query: 237  TLENNCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMID 296
              +     + + N  L  +N+ +S  + EK  +++ L +  NT              M D
Sbjct: 222  QTQTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMND 281

Query: 297  VLQTQVQKLQDDYTRILNTKQPIVQNDEE--RNLEVEELKQKLIETETQLNKELEER--- 351
            +L++Q+   +  ++      +P  + D++  +N E  ++ ++LI+ + +L K  EE    
Sbjct: 282  LLRSQLTSFERGHSL-----RPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLL 336

Query: 352  RNITMQT--ESSTLSNQQQ---------EDLDTIKKELIQERYQKEKLQNQVEIFIVELE 400
            +NI      E+ T  N             ++ T+K++L++ER QK ++QNQ++ F++ELE
Sbjct: 337  KNIVSDCIEENGTTVNTNTAAPTVGKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELE 396

Query: 401  KKVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTK 460
             K P + SFK+RT++LE EL  +T LLE +   K +   +L +L Q   S +    SL +
Sbjct: 397  HKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVR 456

Query: 461  QRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILXXXXXXXXXXXQQVISERLVTF 520
            QR DLA Q++ +L + S    +  PLS +E+  ++ +L           Q +I+E+LV F
Sbjct: 457  QRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEF 516

Query: 521  QNIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKL 580
            +NI ELQ+KN++LL  +R LA KLE  E     T   +E Q I EAKEAII ++S N+KL
Sbjct: 517  KNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTIKEAKEAIIEMESINSKL 576

Query: 581  EDKIKTLNDELDCYKSLPKP-DTKVETEHLRLNEENTD-LIKELETRLATSREESNKTFA 638
              ++  L  E D YK L    D K   +   + E   +  I+EL+++L+++R ES+    
Sbjct: 577  ALRVNILTRERDSYKLLASANDNKTHADTEGITEATYEKKIRELQSKLSSTRVESSAIIQ 636

Query: 639  SLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQD 698
            +LN ++         T K+ Q +       +  L+  +N   L   +   LQ+R+  L+ 
Sbjct: 637  NLNGQL--------LTYKKSQTD------GKIALQEFENFKVLVAEKEAMLQERINHLKT 682

Query: 699  ITLKQDQRTQETLKEY-VSCKVALSNSQNELNYIQSQL-NISKTN------EKSLKDDIT 750
               KQ       +++Y  S    LS+S+N++  ++ ++ N+ K N      ++SL  D+ 
Sbjct: 683  QLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLE 742

Query: 751  IVSKERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIK 810
               KE+ +L   +S+ ++   E+  IF S +L   TR+  +E+ L +++ +L++K++EIK
Sbjct: 743  RCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIK 802

Query: 811  ELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVT 870
             L+S++ S+++W QN ID  ++   +   EL  K   IG L+ EI+ L  +L+ ++ +  
Sbjct: 803  TLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQ-- 860

Query: 871  AYKVLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEET 930
             YK L+N+ +  T   TL+ EL++++I L +A++++  Y++  S  E  L+     +++ 
Sbjct: 861  -YKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKKA 919

Query: 931  KKEFIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNE---- 986
            K++   KI+   K+       K    E+++ L  ELD        E   +  KL E    
Sbjct: 920  KEDCETKIQLENKE-------KGAKEEELSHLRKELD--------EIRCLQPKLREGASY 964

Query: 987  LLAQNHNIEEVSNQYELKLSTLQNDLEQQASYANIAQ----NNYEQELQKHAELAKTISQ 1042
            L+ Q+   E+V +Q + ++  ++N +++ A+     Q    + Y+ EL+ + +L++ + +
Sbjct: 965  LVLQS---EKVGDQAQ-RIQEMKNKIDKMAAIIEAYQKEESSQYQSELKTNKDLSEWVMR 1020

Query: 1043 LREDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKL 1102
            L ++A  Y+ ++   + +  + +ELL ++EK W E++  YE ++ +  ++ E L  +N +
Sbjct: 1021 LEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSV 1080

Query: 1103 LFDQVDLLSKSENSYNQQSSATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVN 1162
            L +++D  ++  NS  +         L  +LR +R  L+T+L+  + +   LR K +S+ 
Sbjct: 1081 LIEKIDGATEGSNSNEKYLELV---SLFSNLRHERSSLETKLTTCKRDLALLRQKNASLE 1137

Query: 1163 TELTNTRAKLTEIRQQYENTKISVEEHDNIMXXXXXXXXXRESNITLRNEANDSREKAKQ 1222
              + + +   T  R + +   + ++E++ I+         RE+N  L     +  EK + 
Sbjct: 1138 KSIGDLQRANTVPRNKVQCPAVIIDEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEA 1197

Query: 1223 LQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPV 1282
            + ++L  ++E++  L+    + KE +  N  ++ AY+ E  + KQR QD+  + K     
Sbjct: 1198 IYKELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKN 1257

Query: 1283 EHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLED 1342
            E EKL   I  L+  L + +  N +L ++FNR+KKQAHE+L++SK  Q  L +++ +L++
Sbjct: 1258 ETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKE 1317

Query: 1343 ENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVKS 1402
                ++  L  E   + + E K ++   Q  +V+                        K 
Sbjct: 1318 TKDKLEENLHNEESKVVDLELKLKEHGLQVGEVS------------------------KD 1353

Query: 1403 SDEIS-SHLNDVIDSLNNELTHLKESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKFVQD 1461
             D I+     + I+SL  EL   + +           D S+  E++K + EEEK K + +
Sbjct: 1354 HDSIAFKPFVEEIESLKKELQVFRNAN----------DASDAFEKIKNNMEEEKNKIIDE 1403

Query: 1462 QTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENL 1521
            +T +F++KL + V + ++  ++ +N      + I A +++W KEYEE  +KRI++AEENL
Sbjct: 1404 KTKDFEKKLQDAVNKSKSNESEVENS-----EHIEALKKEWLKEYEEETVKRIKEAEENL 1458

Query: 1522 KRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSEENKTFIEDLKNDIKKELE 1581
            K+RIRLP+EE+I  +I K+K ELE+E++ K+ +  K L+ S  N+   ED          
Sbjct: 1459 KKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVFSGSNEEEAED---------- 1508

Query: 1582 RNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSNAANENKNDVEVLLKTP 1641
                 EL N+ +K   E   +  + T  +++K  KL+ QL+        KN V    K P
Sbjct: 1509 -----ELWNSPSKGSSE---KPSVVTDLIKQKNIKLQEQLKNV------KNAVTFNDKRP 1554

Query: 1642 SD---ENNVPSKQEETLSKPQLSKIQIANPLLSTGGTTL-ALNQSRAPSSLQNGSDSSNP 1697
                 ENN+P         P  S      PL S+  ++  + +    PS+    +D S P
Sbjct: 1555 KSENKENNIPDSAAADNRVP--SAFSFGKPLFSSNTSSFQSFHNPFTPSAANFSTDGSLP 1612

Query: 1698 FTSPFQQTKNDANIPAVTQPAFLLREPSEPNMSVSTISRQSTSETNTESELPVSSEGLAT 1757
                   T N  +  A       L+     N+    I+     E    S+ P+ S+  + 
Sbjct: 1613 -------TFNIKSAFAAGTAGNTLKTSDPANVG---INEAKVMEIGNTSKRPIQSDTSSD 1662

Query: 1758 PSSKR 1762
            P SK+
Sbjct: 1663 PDSKK 1667

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  399 bits (1026), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 424/1565 (27%), Positives = 794/1565 (50%), Gaps = 196/1565 (12%)

Query: 235  ISTLENNCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXM 294
            I  L +  SI+K  ND L  +N+ +S N+ EK  ++++ ++ Y+T              +
Sbjct: 169  IDNLRHEVSILKKNNDLLLGKNQELSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRI 228

Query: 295  IDVLQTQVQKLQDDYTRILNTKQPIVQN-DEERNLEVEELKQKLIETETQLNKELEERRN 353
               L+TQ++++Q + +         +QN D     E +++ ++LI+T     K+L++ RN
Sbjct: 229  NSSLETQLKEIQQEKS---------IQNEDNTSRAESQKIMEQLIDT----RKQLKDSRN 275

Query: 354  ITMQTESSTLSNQQQEDLDTIKKELIQERY-----------QKEKLQNQVEIFIVELEKK 402
                 E + L +   E ++ +  E                 QK+ L+ QVE FI ELE K
Sbjct: 276  -----ECTRLKSYVNEFINDVNGEYSSSSSLLKKELLKVKEQKDYLETQVENFITELEIK 330

Query: 403  VPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQR 462
            VP I+S +++   LEKEL+D T L++ +  E+  +  E  + ++  +      ++LT QR
Sbjct: 331  VPVIDSLEKKNKDLEKELSDVTSLVDRISIERESLEKEFQSFKRKSEHNDGMIQTLTTQR 390

Query: 463  NDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILXXXXXXXXXXXQQVISERLVTFQN 522
            +DLAHQ+Q++L+    Q  +N  LS +E  FI+ +            Q +ISERL+ F +
Sbjct: 391  SDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTENDTYARNNDSQSIISERLLKFAD 450

Query: 523  IVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLED 582
            I ELQ++N+D+L +VR LA +LE QE+ +Q+    +E++ ++EAK+A++ LQ Y   LE 
Sbjct: 451  ITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERKTLEEAKKALLDLQEYTNSLER 510

Query: 583  KIKTLNDELDCYKSLPKPDTKVETEHLRLNEENTDLIKELETRLATSREESNKTFASLNN 642
            K++T   E D YK L K  +    +    N+ +     +L+  L  +RE   K    L  
Sbjct: 511  KLETFRKERDVYKLLSKGKSPSSNKPSECNDIDKHTTGKLQNELQQTREYLTKEIEKLTR 570

Query: 643  EIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSL------SKVE-NEQLQKRL-- 693
               DI     +     +   +++E AE + +LI+N+L +      S +E N+ LQ+ L  
Sbjct: 571  TNKDILNKKKELEYSMKKMESAKEYAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQ 630

Query: 694  ------EILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKD 747
                  E+ QD+         E   +Y   ++  +++Q++ N +++Q    +T +K L +
Sbjct: 631  KEAKLAELTQDL--------HELTSQYNLLQIRFTDTQSQSNSLRTQ---HQTTQKELFE 679

Query: 748  DITIVSKERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDR 807
                V +E+N LK  + +L+  + E + I  + +L    RL   +    D+ + ++ ++ 
Sbjct: 680  ----VVEEKNALKVKIHELEISRNECKGIQATVELKLNERLTEYQLHEQDLLKIIEKQED 735

Query: 808  EIKELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKD-LQASE 866
            +I+++E  R  E+ WYQ       E       + ++K  E G      ++  +D L++ +
Sbjct: 736  QIRDMEVKRAEELNWYQKNFPTQTETEIGLPVD-MKKEGETG------RQSNRDTLESQK 788

Query: 867  SRVTAYKVLNNSDNV--GTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQ 924
            S    +  L    +V   T +  +Q       +  +E  ++  +   + ++  + +   +
Sbjct: 789  SGSPGFTDLGTDSSVRKSTSLPVMQ-------VGRTEEESKEAKKCDALTDSSQVVGLPE 841

Query: 925  NTVEETKKEFIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKL 984
            N V + +K+ I +IE L  D+ EL  +   +  +   L+++L  +  +   EK+ ++ +L
Sbjct: 842  N-VTKKEKDLIAQIEQLASDKKELKTSLQAIRAEYQHLHDQLQLEKNSFDTEKASLNNEL 900

Query: 985  NELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQ-- 1042
            ++++ +N+++ EV+ +      +L++DL          +   E+E QKH E   T+S+  
Sbjct: 901  DKIM-ENNSLTEVAKK------SLEDDLHD-------VEMKLEEERQKHEETNATLSEKE 946

Query: 1043 -----LREDAHTYRKKMDS---MQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIE 1094
                 + E+   YR+++     MQ +     EL               ED +    KRI+
Sbjct: 947  LLCEKMIEEISGYREELSKSAEMQVDIQHTREL---------------EDLLDLANKRID 991

Query: 1095 DLSSQNKLLFDQVDLLSKSENSYNQQSSATPNEDLVLSLRSDRDILQTRLSVTEEEGKAL 1154
            DL +QN LL +Q++     E++ N+       +D+++ ++ +RD LQ +L++ E EG+ L
Sbjct: 992  DLCTQNNLLHEQLNATLDLEDTQNKDDI----KDIIVCMKRERDTLQKKLAIVEREGEVL 1047

Query: 1155 RLKLSSVNTELTNTRAKLTEIRQQYENTKIS--VEEHDNIMXXXXXXXXXRESNITLRNE 1212
            R + + + +EL           QQ+ N  +S  +  H+ I+         RE+N++L  E
Sbjct: 1048 RERCAGLKSELDAVSKG-----QQWHNLPLSNLLTGHEKILDELKEVHLLRENNVSLLTE 1102

Query: 1213 ANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDI 1272
             N  +     L ++L  +R+   PL+ ++N  +   KE +Q+++ YK+E  RWK+R Q +
Sbjct: 1103 VNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISLYKDEIERWKKRWQQM 1162

Query: 1273 LTKHKKIDPVEHEK-LEAEIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQ 1331
            +  H++ D +  E   + EI +LK  + ++ KE E+L+++F  +KKQAHE+L+++K   Q
Sbjct: 1163 V--HRQDDTLGLEANFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQ 1220

Query: 1332 TLIDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQ-MNKQSEDVTALRSQLEEALLSSK 1390
            TL + + +++  N  ++ +++ +   I+  E   ++ + K  +D         E L+S K
Sbjct: 1221 TLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLKENLEKFDKD---------EKLVSEK 1271

Query: 1391 EF---ENKFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNNEATVTGQPDLSNVVEEM 1447
             F   E K N ++    +++  LN  + SL  E+  L++ K++E         + ++  M
Sbjct: 1272 TFKENEAKLNKTITMLQKLNETLNQEVVSLREEINVLRK-KDDET--------NQLISTM 1322

Query: 1448 KKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQN-KNVTPLQDISAQREQWEKEY 1506
            K  FE EK + ++++  E  EK   E  R E  +  ++N  N     ++   +++  K++
Sbjct: 1323 KLDFEREKDRLIEEKVRELNEKF--ESGRNEVLSKQSENVTNDNTGSNVDKLKQELRKDW 1380

Query: 1507 EEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSEENK 1566
            EE  L+RIE+A+ENLKR IRLP+EEKI  +I+K++ ELE ++D++V ++A  +  +++  
Sbjct: 1381 EEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIALADKAD 1440

Query: 1567 TFIEDLKNDIKKELERNIDQELK----NAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQ 1622
               ++LK  +++ELE  I+Q+L+      + KAFEEGK+QA MKTT LE+K+SKLESQ+ 
Sbjct: 1441 MSPDELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQVA 1500

Query: 1623 GSNAANENKNDVEVLLKTPSDENNVPSKQEETLSKPQLSKIQIANPLL---STGGTTLAL 1679
              N +                     SK  +++S   L+KI + +P L   +TG  T A+
Sbjct: 1501 KDNESG--------------------SKVRKSISG--LTKIDVNSPQLYKDNTGTRTEAV 1538

Query: 1680 NQSRAPSSLQNGSD---SSNPFTSPFQQ---TKNDANIPAV-TQPAFLLREPSEPNMSVS 1732
             + R  + + +G D    SNPFTSP Q+   + + A +P V   P F       P  S  
Sbjct: 1539 LKLRPTAKVDSGKDVSNDSNPFTSPTQELSKSNSPAALPIVHMAPTFSFT----PGKSTG 1594

Query: 1733 TISRQ 1737
            T++++
Sbjct: 1595 TVNKE 1599

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  392 bits (1006), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 425/1666 (25%), Positives = 805/1666 (48%), Gaps = 183/1666 (10%)

Query: 157  LTNQYRESTAKCHDLEDEIQSLKYNDSLTETTMNKLSQDLKSISEIKERLETELENKDKK 216
            +T Q     A+  +L+++++ LK  D   ++  +     L  +      L  E+E   + 
Sbjct: 88   VTGQTSALRAELENLQNDLELLKDKDLALQSERDSTVALLDGLKLENSALRAEIEQAKEL 147

Query: 217  MSEYYSNCQAEIQTLRKKISTLENNCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNL 276
             S    + +A++ +    + + E    + KSE  +L  +   +S  L ++ + +++L + 
Sbjct: 148  ASIRQHDYEADLDSKTGALVSKEEELRLAKSERASLISQTERLSQELLQRDADIRQLVDA 207

Query: 277  YNTXXXXXXXXXXXXXXMIDVLQTQVQKLQDDYTRILNTKQP---IVQNDEERNLEVEEL 333
                                +LQ QV  L+ +   + +  +P   I    EE  L+    
Sbjct: 208  DKLRQDEYTDEINLQKHRARLLQEQVASLEKEAKLVGHETEPEYEIPPPGEEVALQ---- 263

Query: 334  KQKLIETETQLNKELEERRNITMQTESSTLSNQQQEDLDTIKKELIQERYQKEKLQNQVE 393
                     Q +  +     +T   E+S   ++   ++  +   L +E   K+KL+ QV 
Sbjct: 264  ---------QRSHSISMDSLLTGNDETSHSMSELNNNISILSNRLKRETLSKQKLEKQVH 314

Query: 394  IFIVELEKKVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKW 453
             F+ ELE+  P I SFKQ+++  + ++    L LE++ ++K  +  E++  ++  + +  
Sbjct: 315  KFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQYKKQLEQISG 374

Query: 454  ETKSLTKQRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILXX---XXXXXXXXXQ 510
            + K L ++R DLA QLQY+L++  V+ DS+ PL++ E  +I++IL              Q
Sbjct: 375  QDKILRRERFDLARQLQYLLLNGFVK-DSDDPLTSSEFSYIKEILNTDPEEGNTSSTDSQ 433

Query: 511  QVISERLVTFQNIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAI 570
             +IS+R++ F++IVELQQ+NI+LL +VR L+ + E  E   +S   +   +AI+EAK+ +
Sbjct: 434  LIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLESGDSI---EAINEAKQTL 490

Query: 571  ISLQSYNTKLEDKIKTLNDELDC---YKSLPKPDTKVETEHLRLNEENTDL-----IKEL 622
            + LQ YN+ LE K+++L ++L     + S+   +             N+DL     I+ L
Sbjct: 491  LDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFG-----------NSDLSDGNNIQAL 539

Query: 623  ETRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLS 682
            + +  +   ES++T   L ++I++++++ S   KEC++   S+ L E RLK+ Q+ L LS
Sbjct: 540  KNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLS 599

Query: 683  KVENEQLQKRLEILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNE 742
            K EN  L+ R++       +++  T +T+K+Y+ C   L   Q +L     + +I +  +
Sbjct: 600  KNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQ 659

Query: 743  KSLKDDITIVSKERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKL 802
             S+++ +    KERN  + L+ QL++LQ  +++     ++  Q ++D +E E  ++  K+
Sbjct: 660  SSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKI 719

Query: 803  KNKDREIKELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDL 862
              K+       +N  +E+EWYQ K D++    DA  ++++E  + I  L  + + L   L
Sbjct: 720  DTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDILL 779

Query: 863  QASESRVTAYKVLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLEN 922
            Q + S+    +     D+V      L+ EL  S+  L++   E              LE 
Sbjct: 780  QEANSKNKLLEARETVDDVNKLTGALETELATSRTRLTDTSRE--------------LEI 825

Query: 923  YQNTVEETKKEFIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISK 982
              NT+    +++  +I+ L + + EL +    L ++I  L +EL H       EK  + K
Sbjct: 826  SSNTI----RQYQSEIKVLNERQSELENENKHLRDEIAILRDELTHNGGEFEREKEALMK 881

Query: 983  KLNELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYA---NIAQNNYEQELQKHAELAKT 1039
            KL+ L  +   + ++   Y  ++  L+ DL++QA       +A +   +E+Q        
Sbjct: 882  KLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEEVREVQNR------ 935

Query: 1040 ISQLREDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQ 1099
                  +  TYR +++ ++   T   ++  + EK  E + K   +QI   K+R++  S +
Sbjct: 936  ------NTETYRNELELVEIRQT---KVFVEKEKELESRIKILNEQIELDKERMKQFSDE 986

Query: 1100 NKLLFDQVDLLSKSENSYNQQSSATPN-EDLVLSLRSDRDILQTRLSVTEEEGKALRLKL 1158
              LL +QV LL+  + S    +  +P   DLV  L  ++  L+++L  ++ E   LR +L
Sbjct: 987  ESLLREQVKLLADEKASDLVDAGVSPEYTDLVRKLSDEKKNLESKLFASQSEKNRLREQL 1046

Query: 1159 SSVNTELT----NTRAKLTEIRQQYENTKISVEEHDNIMXXXXXXXXXRESNITLRNEAN 1214
            +   +E+     N      E+  +  N     EEH             +ESN++L NE  
Sbjct: 1047 TKTESEIAVLNMNYEQAKKEVAAEVNNESGRAEEH------IAQLESLKESNMSLTNEVK 1100

Query: 1215 DSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILT 1274
             ++ +  ++  +L  L+ K   +E++ +  + V+   + +L   + EC+R K  S D+  
Sbjct: 1101 LAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDMPQ 1160

Query: 1275 KHKKIDPVE-HEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTL 1333
               K    E    L++ +ATL + + + K  N EL DRF R+K+QA ERL++SK T  +L
Sbjct: 1161 NGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSL 1220

Query: 1334 IDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTALRSQLEEALLSSKEFE 1393
             D ++ L  +   +Q ++E  +  +     K ++  + S  +  L+++L   +  +K+ E
Sbjct: 1221 RDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIETSAVMKELKTELAAVMSKNKDIE 1280

Query: 1394 NKFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNNEATVTGQPDLSNVVEEMKKSFEE 1453
             + N + KSS+++++ LN+ I+SL +E+ +LKE+ + E    G  ++S VVE M+K+FE+
Sbjct: 1281 AELNETSKSSNQLTTALNEEIESLKHEVQYLKEASSAEP--QGNEEMSGVVESMRKAFED 1338

Query: 1454 EKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISAQREQWEKEYEEIVLKR 1513
            EKI F++  + + + +LAEE  +++ +                   E  EKE + +V+++
Sbjct: 1339 EKIAFMKATSEDSEARLAEERGKLKREM------------------EALEKEKDSLVMEK 1380

Query: 1514 IEQAEENL-----------------------KRRIRLPTEEKINSVIQKKKNELEKEYDE 1550
                EEN                        K R+ L  +EK + +++ K +ELE+++  
Sbjct: 1381 TRLGEENTALMKARSDVPDIETLQKQWEASNKERLVLLYKEKSDQMMRAKMDELEEQFQN 1440

Query: 1551 KVNQRAKELLSSEENKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFL 1610
            +V  + KEL +          LK++I+++ +   +  L   K +AFEEGKQQA MK + L
Sbjct: 1441 RVRNKEKELNA----------LKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSIL 1490

Query: 1611 EKKISKLESQLQGSNAANENKNDVEVLLKTPSDENNVPSKQEETLSKPQLSKIQIAN-PL 1669
            E+KI+KLE++    + A ++ +D+ V    P                P  +K+Q AN P 
Sbjct: 1491 ERKIAKLEAE----SKATKSGSDMSVSEDAPR------------FVTPNNNKVQQANQPF 1534

Query: 1670 LSTGGTTLALNQSRAPSSLQNGSDSSNPFTSPFQQTKNDANIPAVTQ--PAFLLREPSEP 1727
            L+T G+  ++  S            SNPFT+P  +     N  + ++  P FLL   S+P
Sbjct: 1535 LATAGSGFSVQSSE-----------SNPFTTPVSRGAAHTNASSQSKFAPTFLLN--SQP 1581

Query: 1728 NMSVSTISRQSTSETNTESELPVSSE-GLATPS----SKRPAQEDT 1768
             + VS     S  + +T     V  + G A PS    +KRP + ++
Sbjct: 1582 PVLVSG---SSDEDNDTMRGTSVDEDAGTAVPSLNENNKRPGEGES 1624

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  373 bits (957), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 475/1810 (26%), Positives = 881/1810 (48%), Gaps = 220/1810 (12%)

Query: 16   IGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQGRINDLRT 75
            I  +L VP + L  +  SIL  L  ++++F   + +  +  V ++E++     RI    +
Sbjct: 5    ISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRI----S 60

Query: 76   QLEDLIEQNAXXXXXXXXXXXXXXXXXXXXFQLSSTRDNLRAELKEIQEKFDNLQKQ--- 132
            +L +L+ +++                     +LS   + L+ E  +   K D L KQ   
Sbjct: 61   KLNELLGESSEEKNVSKK-------------ELSRLHNLLKNERSKCARKIDALNKQLNA 107

Query: 133  NQDTI-KLLDRKISQNEVEKELTLKLTNQYR--ESTAKCHD----------LEDEIQSLK 179
            +++TI KL D +  + E E    LK  +Q    E +A  H+          +E+ +Q+ K
Sbjct: 108  SKNTITKLNDERGVKEEAE---VLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCK 164

Query: 180  YNDSLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLE 239
             N    +   + + Q+ + I E K+ +E +L  +D+K         + +Q L ++++  +
Sbjct: 165  SNTLSLKLKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQ 224

Query: 240  NNCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMIDVLQ 299
            N+   + + N  L  +N+ +S ++ +K  +++ L +  N               M D+L+
Sbjct: 225  NDYESVSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLR 284

Query: 300  TQVQKLQDDYTRILNTKQPIVQNDEERNLEVEELKQKLIETETQLNK---ELEERRNI-- 354
            +Q+   + +Y+     K     +D  +N +   +  KLI+T+ QL K   E +  +NI  
Sbjct: 285  SQLTSFEKNYSLSAREKD---NDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVA 341

Query: 355  -TMQTESSTLSNQQQ---------EDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVP 404
              ++ + +   N             D+  +K++LI+ER QK +LQNQ+E FI ELE+K P
Sbjct: 342  DCIEEDEAAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTP 401

Query: 405  TINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRND 464
             + SFK+RT+ LE+EL ++T LLE +   K +   EL +LRQ   + +    SL KQR D
Sbjct: 402  ELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLD 461

Query: 465  LAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILXXXXXXXXXXXQQVISERLVTFQNIV 524
            LA Q++ +L++ S       PLS +E+  ++ +L           Q +I+ERLV F N  
Sbjct: 462  LARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNTN 521

Query: 525  ELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKI 584
            ELQ+KN++LL  VR LA KLE  E  Q  +   +E Q I EAK+AII L+  N+ LE +I
Sbjct: 522  ELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRI 581

Query: 585  KTLNDELDCYKSLPKPDT-KVETEHLRLNE-ENTDLIKELETRLATSREESNKTFASLNN 642
              L+ E D YK L   +  K+  +     E  N   IKELE+ L+ ++ E++     LN 
Sbjct: 582  DILSRERDSYKLLASANGNKIYADAANKTEAANLKKIKELESELSLTKVENSAVVQRLNK 641

Query: 643  EIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQ-LQKRLEILQDITL 701
            E+             C+  +++ ++A Q      ++  +  +E E  LQ R++ L+    
Sbjct: 642  EL-----------LTCKKSQSNGQIALQEF----SNFKVLAIEKENLLQTRIDDLKTKLE 686

Query: 702  KQDQRTQETLKEYVSC-KVALSNSQNELNYIQSQL-NISKTN------EKSLKDDITIVS 753
            KQ      ++   +   +  LS  +N+   +  ++ N+SK N      ++SL  D+    
Sbjct: 687  KQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCEISNLSKKNTDLRCMKESLTRDLERCC 746

Query: 754  KERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELE 813
            KE+ +L+  +++ ++   E++   +S ++   T++  +E+   +++ +L +K +EI+ L+
Sbjct: 747  KEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTKIKNLEKNCEELNNRLHSKVQEIETLQ 806

Query: 814  SNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYK 873
            +++ S+++W QN ID  ++   +   +L EK   I +L+ E+K L+ +LQ ++ +   YK
Sbjct: 807  TSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQKTKLQ---YK 863

Query: 874  VLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKE 933
            +LNNS +  T    L+ ELE+S+I+L +A+++++ Y++  S  E  L+   + + +TK+E
Sbjct: 864  LLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEE 923

Query: 934  FIRKIETLQKDRDELLDTKSILSEQITDLNNELDH---------QNKAHLEEKSE-ISKK 983
               K ++L    DE  + K    E+I+ L  ELD          +    L ++SE +  +
Sbjct: 924  LKVKSQSL----DEENNAK---EEEISFLRRELDEIRGLQPKLKEGALRLVQQSEKLGNQ 976

Query: 984  LNELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQL 1043
               + A N  I++++   EL              +  +  + Y+ +L+ + +L+  + +L
Sbjct: 977  TQRIQAMNEKIDKMTTIVEL--------------HQEVETSQYQAKLKANKDLSALVLRL 1022

Query: 1044 REDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLL 1103
              +   Y+ ++   +++  + +ELL K+E+ W E++  YE ++ +  ++ E L  +N  L
Sbjct: 1023 ENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENSAL 1082

Query: 1104 FDQVDLLSKSENSYNQQSSATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNT 1163
             +++D     EN+ +++     +  L  SLR +R+ L+T+L+  + +    + K +++  
Sbjct: 1083 VEKID-DGTGENNGDKEYLKLVS--LFSSLRHERNTLETKLTTCKRDLALAKQKNANLEK 1139

Query: 1164 ELTNTRAKLTEIRQQYENTKISVEEHDNIMXXXXXXXXXRESNITLRNEANDSREKAKQL 1223
             + + +      R+  + +   ++E ++IM         +E+N  L+       EK + +
Sbjct: 1140 SVNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAI 1199

Query: 1224 QEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVE 1283
             ++  +L+ ++  L+ +  + KE +  N  ++  Y+ E  +WKQR  ++  + K+    E
Sbjct: 1200 YKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDE 1259

Query: 1284 HEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDE 1343
             EKL  EI+ LK  L + +  N +LND+FNR+KKQAHE+L++SK  Q  L +++ +L+D 
Sbjct: 1260 TEKLFNEISDLKAKLLNAQNANADLNDKFNRLKKQAHEKLDASKKQQTALTNEVDELKDM 1319

Query: 1344 NAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVKSS 1403
               ++  L +E   +   E K ++   Q+E V             SK+ E          
Sbjct: 1320 KNELEESLHSEESKVLELEAKLKKHLVQAEGV-------------SKDQE---------- 1356

Query: 1404 DEISSHLNDVIDSLNNELTHLKESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKFVQDQT 1463
            ++ S  L + I+ L  EL   KE+           D S+ +E+MK+  E EK K ++++T
Sbjct: 1357 EDTSKPLMEEIELLKRELQVFKET----------SDSSDTIEKMKEIMEAEKNKIIEEKT 1406

Query: 1464 TEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKR 1523
            TEF+ KL EE       AT    +N+  L      ++QW K+YEE  ++RI++AEENLK+
Sbjct: 1407 TEFERKL-EEATGKNTGATIENGENMEEL------KKQWLKQYEEETMRRIKEAEENLKK 1459

Query: 1524 RIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKEL-LSSEENKTFIEDLKNDIKKELER 1582
            RIRLP+EE+I  +I K+K ELE+E+  K+   +    LSS+             KKE E 
Sbjct: 1460 RIRLPSEERIQKIISKRKEELEQEFQRKLKANSGSFTLSSD-------------KKENEV 1506

Query: 1583 NIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSNAA---NENKNDVEVLLK 1639
            N + +L N+ +K   E   +  + T  + +K   L+ QL+        N+++        
Sbjct: 1507 NAEDDLWNSPSKGNSE---KPSVVTNLIRQKNLILQEQLKNPKKGIISNDSRP------T 1557

Query: 1640 TPSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGTTLALNQSRAPSSLQNGSDSSNPFT 1699
            + + EN++P                         G+T A N  +AP +   G       T
Sbjct: 1558 SSNKENDIP-------------------------GSTTAEN--KAPLAFNFGKPLFPSNT 1590

Query: 1700 SPFQQTKNDANIPAVT------QPAFLLREPSEPNMSVSTISRQSTSETNTESELPVSSE 1753
            S FQ  +N    PA T       P F ++     + +V T      ++  T     +   
Sbjct: 1591 SSFQSFQNPF-TPAATSFNTGVSPVFNIKPALAVDATVDTFKTPGLNDAGTNEAKIIE-- 1647

Query: 1754 GLATPSSKRP 1763
             +   S KRP
Sbjct: 1648 -IGNNSLKRP 1656

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  363 bits (933), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 471/1812 (25%), Positives = 883/1812 (48%), Gaps = 207/1812 (11%)

Query: 16   IGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQGRINDLRT 75
            I  FL+VP E L  +   +L  L  K+ +F   + +  K  V ++E++     RI+ L+ 
Sbjct: 5    ISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLKQ 64

Query: 76   QLEDLIEQ--------NAXXXXXXXXXXXXXXXXXXXXFQLSSTRDNLRA--ELKEIQEK 125
             L++  EQ        N                      QL  + + +R   + K ++E+
Sbjct: 65   LLDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKRVKEE 124

Query: 126  FDNLQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYNDSLT 185
            +D  Q ++Q    L D    +N++ +   +++ N  +   +    L+     LKY+ S+ 
Sbjct: 125  YDIWQSRDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKSNAISLQ-----LKYDTSVQ 179

Query: 186  ETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSII 245
            E  +   S+ L     I+E+L +      K ++E  +   + ++ L +K+  +++N   +
Sbjct: 180  EKELMLQSKKL-----IEEKLSS---FSKKTLTEEVTKS-SHVENLEEKLYQMQSNYESV 230

Query: 246  KSENDALKKENRIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMIDVLQTQVQKL 305
             + N  L  +N+ +S ++ EK  +++ L +  +               M D+L++Q+  L
Sbjct: 231  FTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSL 290

Query: 306  QDDYTRILNTKQPIVQNDEE--RNLEVEELKQKLIETETQLNK---ELEERRNITMQT-- 358
            + D +      + I +ND+   RN E  ++  +LI+T+ +L K   E +  +NI M    
Sbjct: 291  EKDCSL-----RAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTK 345

Query: 359  -ESSTLS--------NQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSF 409
             E +T++         +   D+  +K++LI+ER QK +LQNQ+E FI+ELE K P + SF
Sbjct: 346  EEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISF 405

Query: 410  KQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQL 469
            K+RT  LE EL  +T LLE +   K +   E+ +LRQ     +    SL KQR DLA Q+
Sbjct: 406  KERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQV 465

Query: 470  QYILIHTSVQNDSNGPLSAEEVRFIQDILXXXXXXXXXXXQQVISERLVTFQNIVELQQK 529
            + +L++TS   ++  PLS +E+  ++ IL           Q +I+ERLV F N+ ELQ+K
Sbjct: 466  KLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNELQEK 525

Query: 530  NIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLND 589
            N++LL  +R LA KLE  E  Q  T Q VE Q I EAK+AII L++ N K+E +I  L  
Sbjct: 526  NVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLR 585

Query: 590  ELDCYKSLP-----KPDTKVETEHLRLNEENTDLIKELETRLATSREESNKTFASLNNEI 644
            E D YK L      K +T   T      E+    I+ELE  L++++ E++    +L  E+
Sbjct: 586  ERDSYKLLASTEENKANTNSVTSMEAAREKK---IRELEAELSSTKVENSAIIQNLRKEL 642

Query: 645  DDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQD 704
               +++  +     ++    + LA+++ ++++ ++   K E   L+K+   +      + 
Sbjct: 643  LIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAE---LEKQKSWVPSYIHVEK 699

Query: 705  QRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVS 764
            +R    L +    ++ + + + E++ ++ +       ++SL  D     KE+ EL+  + 
Sbjct: 700  ERASTELSQ---SRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLK 756

Query: 765  QLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQ 824
            + +    E +  F+S +   + ++  +E  L  +   L++K +EI+ + S + S+++W Q
Sbjct: 757  ESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQ 816

Query: 825  NKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTK 884
            N ID  + K  +   EL  K   I +L+ EI+ L K+L+ ++ +   YK L+ + +  T 
Sbjct: 817  NTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQ---YKFLDQNSDASTL 873

Query: 885  METLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKD 944
              TL+ ELE+ ++ L +A +++  Y++  S  E  L   +N + +TK+ +  KIE  +K+
Sbjct: 874  EPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAKIELEKKE 933

Query: 945  R----DELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQ 1000
            +    ++L   +  L E I  L  +L  +   H  ++SE  K  NE+      IE++   
Sbjct: 934  KWAREEDLSRLRGELGE-IRALQPKL-KEGALHFVQQSE--KLRNEVERIQKMIEKIE-- 987

Query: 1001 YELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQAN 1060
               K+ST+     Q      ++Q  Y+  ++++ +L++ + +L +DA   + ++   +++
Sbjct: 988  ---KMSTIV----QLCKKKEMSQ--YQSTMKENKDLSELVIRLEKDAADCQAELTKTKSS 1038

Query: 1061 ATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQ 1120
              + ++LL K+E+ W E++  YE ++ +  ++ E L  +N +L ++VD            
Sbjct: 1039 LYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVD------------ 1086

Query: 1121 SSATPNED--------LVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKL 1172
             +A  N D        L  +LR +R+ L+T+L+  + E   ++ K  S+   + + +   
Sbjct: 1087 DTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQ 1146

Query: 1173 TEIRQQYENTKISVEEHDNIMXXXXXXXXXRESNITLRNEANDSREKAKQLQEDLETLRE 1232
            T   ++Y+ + + ++E  +I          +E+N  L+    +  EK +++ + L   +E
Sbjct: 1147 TLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQE 1206

Query: 1233 KVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIA 1292
            ++  L+ +  + KE +  N  ++  Y+ E  + KQR QD+  + K     + EKL  EI+
Sbjct: 1207 EISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEIS 1266

Query: 1293 TLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLE 1352
             LK  L+  +  N +L ++FNR+KKQAHE+L++SK  Q  L +++ +L+     ++  L 
Sbjct: 1267 DLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLH 1326

Query: 1353 TERGNIQNTEEKFRQMNKQSEDVT------ALRSQLEEALLSSKEFENKFNASVKSSDEI 1406
             E   + + + K +    QSEDV+        R+ +EE                      
Sbjct: 1327 FENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEE---------------------- 1364

Query: 1407 SSHLNDVIDSLNNELTHLKESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKFVQDQTTEF 1466
                   I+SL  EL   K + ++          S+  E++K + E+EK + + ++T EF
Sbjct: 1365 -------IESLKKELQIFKTANSS----------SDAFEKLKVNMEKEKDRIIDERTKEF 1407

Query: 1467 KEKLAEEVKRIEAQATDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIR 1526
            ++KL E + +  +   +         +DI   +++W KEYE+  L+RI++AEENLK+RIR
Sbjct: 1408 EKKLQETLNKSTSSEAEYS-------KDIETLKKEWLKEYEDETLRRIKEAEENLKKRIR 1460

Query: 1527 LPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSEENKTFIEDLKNDIKKELERNIDQ 1586
            LP+EE+I  +I K+K ELE+E+ +K+ + A  L       TF+++      K    + ++
Sbjct: 1461 LPSEERIQKIISKRKEELEEEFRKKLKENAGSL-------TFLDN------KGSGEDAEE 1507

Query: 1587 ELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSNAANE-NKNDVEVLLKTPSDEN 1645
            EL N+ +K   E          F+ +K   L+ Q Q  N  N+ + ND + ++ T  + N
Sbjct: 1508 ELWNSPSKGNSERPSAV---AGFINQK--NLKPQEQLKNVKNDVSFNDSQSMV-TNKENN 1561

Query: 1646 NVPSKQEETLSKPQLSKIQIANPLLSTGGTTLALNQSRAPSSLQNGSDSSNPFTSPFQQT 1705
             V S      + P  S      P  S+  ++L         S Q      NPFT+   Q+
Sbjct: 1562 IVDSSAAGNKAIPTFS---FGKPFFSSNTSSL--------QSFQ------NPFTAS--QS 1602

Query: 1706 KNDANIPAVT---QPAFLLREPSEPNMS-VSTISRQST-----SETNTESELPVSSEGLA 1756
              + N P  T   QP   ++  +  N S V+ ++  ST     +E  + S+ P+ S   +
Sbjct: 1603 NINTNAPLRTLNIQPEVAVK--AAINFSNVTDLTNNSTDGAKITEIGSTSKRPIESGTSS 1660

Query: 1757 TPSSKR----PA 1764
             P +K+    PA
Sbjct: 1661 DPDTKKVKESPA 1672

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  358 bits (918), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 464/1810 (25%), Positives = 888/1810 (49%), Gaps = 210/1810 (11%)

Query: 16   IGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQGRINDLRT 75
            I  FL VP E L  I  S+L  L  K++ F   + +  +  V ++E++     RI+ L  
Sbjct: 5    ISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRISKLSK 64

Query: 76   QLEDLIEQNAXXXXXXXXXXXXXXXXXXXXFQLSSTRDNLRAELKEIQEKFDNLQKQ--- 132
             L +  EQ                       +LS  +D L  + +  + K D L KQ   
Sbjct: 65   LLNESSEQKNIASK-----------------ELSHLQDQLMQDRERCRRKIDALNKQLDS 107

Query: 133  NQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEI---QSLKYNDSLTETTM 189
            ++D IK L+ +  ++  E+ +  +  +Q   S     D E+++   + ++  + L     
Sbjct: 108  SRDAIKRLNDE--KDAKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKS 165

Query: 190  NKLSQDLKSISEIKERLETELENK---DKKMSEYYSNCQAEIQTLRKKISTLENNCSIIK 246
            N +S  LK  + ++E+ E  L+NK   ++K+S Y +   A+  T   +I  LE      +
Sbjct: 166  NSVSLQLKYDTIVQEK-ELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQ 224

Query: 247  SENDA-------LKKENRIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMIDVLQ 299
            ++ ++       L  +N+ +S ++ EK  +++ L +                  M D+L 
Sbjct: 225  ADRESALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLS 284

Query: 300  TQVQKLQDDYTR--ILNTKQPIVQNDEERNLEVEELKQKLIETETQLNK---ELEERRNI 354
            +Q+   + D++   I      + ++ +  N+  E     L+ T+ Q  K   E +  +NI
Sbjct: 285  SQLASFERDHSSGEIGKDDDNLCKDPDHNNVTDE-----LMNTKVQFQKSQDECQRLQNI 339

Query: 355  T---MQTESSTLSNQQQE--------DLDTIKKELIQERYQKEKLQNQVEIFIVELEKKV 403
                +Q + +T+              D+  ++K+LI+ER QK +LQNQ+E FI+ELE K 
Sbjct: 340  ISDFVQEDKATVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKT 399

Query: 404  PTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRN 463
            P + SFK+RT  LE EL  +T LLE +   K +   EL +LRQ   S +     L KQR 
Sbjct: 400  PELVSFKERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRL 459

Query: 464  DLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILXXXXXXXXXXXQQVISERLVTFQNI 523
            DLA Q++ +L++TS    +  PLS +++  ++ IL           Q +ISERLV F NI
Sbjct: 460  DLARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNI 519

Query: 524  VELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDK 583
             ELQ+KN++LL  +R LA KLE  E  + +T   VE+Q I EAK+AII L++ N K+E +
Sbjct: 520  NELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESR 579

Query: 584  IKTLNDELDCYKSLPKPDTKVETEHLRLNEEN-TDL-----IKELETRLATSREESNKTF 637
            I  L  E D YK L       +  ++ +N +N T++     IKELE  L++++ ES+   
Sbjct: 580  INILLRERDSYKLLASS----KENNVNVNAKNFTEISHEKKIKELEAELSSTKVESSAVI 635

Query: 638  ASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLI---QNSLSLSKVENEQLQKRLE 694
             +L  E+   ++        C  + AS++   +  K++   + S+  ++V N +     +
Sbjct: 636  QNLRKELTTYKKLL------CDKKIASQDF--ENFKMLAKEKESILETRVNNLKTDLEKQ 687

Query: 695  ILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSK 754
             L   +  QD + +++  E +  +       +E++ ++ +   S   ++SL  D+    K
Sbjct: 688  KLSVPSFVQDNKVRDS-TELLQSRTKTEILMHEISSLKKETANSMVLKESLTRDLERCCK 746

Query: 755  ERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELES 814
            E+ +L+  + + +    E++  F+S  +    R+  +E  L  +  +LK+K +EIK L+S
Sbjct: 747  EKIQLQMKLKESEISLNEQKVNFDSKGIKYDARIKQLEESLERLRIELKSKAQEIKSLQS 806

Query: 815  NRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKV 874
            ++ S+++W QN ID  +EK  +   EL  K   +  L+ +I+ L  +L+ ++ +   Y+ 
Sbjct: 807  SKDSQLKWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLK---YEF 863

Query: 875  LNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEF 934
            LNN+ +  T    L+ ELE++++ L +A++++  Y++  S  E+ L+   + +   K+++
Sbjct: 864  LNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLASMKEDY 923

Query: 935  IRKIETLQKDRDELLDTKSILS--EQITDLNNELDHQNKAHLEEKSEISKKLNE----LL 988
              +IE         L+ K  L+  E+++ L  ELD        E   +  KL E    L+
Sbjct: 924  DARIE---------LECKEKLANEEELSLLRRELD--------EIRSLQPKLKEGTVCLV 966

Query: 989  AQNHNIEEVSNQYELKLSTLQNDLEQQ----ASYANIAQNNYEQELQKHAELAKTISQLR 1044
             Q+   E++ NQ E K+  ++  +++       Y     + ++  ++ + EL++ +++L 
Sbjct: 967  KQS---EKLRNQAE-KIQEMKAKIDKMNWNVQVYKKEKTSQFQSIMKANKELSELVTRLE 1022

Query: 1045 EDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLF 1104
            ++A   + ++  ++++    ++LL  +EK W E++  YE ++ +  ++ E L  +N +L 
Sbjct: 1023 KEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVLI 1082

Query: 1105 DQVDLLSKSENSYNQQSSATPNED------LVLSLRSDRDILQTRLSVTEEEGKALRLKL 1158
            +++  +++  +          NED         +LR +R+ L+T+L+  + +   ++ K 
Sbjct: 1083 EKIGSVTEGSDG---------NEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKN 1133

Query: 1159 SSVNTELTNTRAKLTEIRQQYENTKISVEEHDNIMXXXXXXXXXRESNITLRNEANDSRE 1218
            +S+   + + +      + + + + + ++E ++I          +E+N  L+    +  E
Sbjct: 1134 ASLEKNINDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTE 1193

Query: 1219 KAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKK 1278
            K +++ E+L   +E+V  L+++  + KE +  N  ++  Y+ E ++ KQR  D+ T+ ++
Sbjct: 1194 KNREIYEELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQRE 1253

Query: 1279 IDPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIK 1338
            +     EKL +EI+  K  L D +    EL ++FNR+KKQAHE+L++SK  Q  L +++K
Sbjct: 1254 VQKKTIEKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELK 1313

Query: 1339 QLEDENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNA 1398
            +L+     ++  L ++     + + + ++   QS D+  LR Q + A L           
Sbjct: 1314 ELKAVRDKLEQDLNSKNFKTVDLDTEPKEHTVQSGDL--LRDQEKVASLP---------- 1361

Query: 1399 SVKSSDEISSHLNDVIDSLNNELTHLKESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKF 1458
                       L + I+SL  EL   K + N+          S+  E+++ + EEEK K 
Sbjct: 1362 -----------LIEEIESLKRELQVFKNANNS----------SDAFEKLRDNMEEEKNKI 1400

Query: 1459 VQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAE 1518
            + ++T EF++KL E V + ++      N      ++I   +++W KEYEE  ++RI +AE
Sbjct: 1401 INERTKEFEKKLEEIVSKSKSTGKVADNS-----ENIETLKKEWLKEYEEETIRRIREAE 1455

Query: 1519 ENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSEENKTFIEDLKNDIKK 1578
            ENLK+RIRLP+EE+I  +I K+K ELE+E+  K+ + A  L       TF  D     +K
Sbjct: 1456 ENLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSL-------TFSCD-----RK 1503

Query: 1579 ELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSNAANENKNDVEVLL 1638
            E   + D++L N+ +K      ++  + T F+++K  K++ QL+ +      KN V    
Sbjct: 1504 ETNDDPDEDLWNSPSKG---NSERPSVITDFMKQKNIKVQEQLKKA------KNGV---- 1550

Query: 1639 KTPSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGTTLALNQSRAPSSLQNGSDSSNPF 1698
                        +  +++K   + +++ +       +T +  +   PS+    + S   F
Sbjct: 1551 -------FFGDSRSSSMNKENSALVKVND---DKAASTFSFGKPLFPST----TTSFQSF 1596

Query: 1699 TSPFQQTKNDANIPAVTQPAFLLREPSEPNMSVSTISRQSTSETNTESELPVSSEGLATP 1758
             +PF Q+  D+N   V+ P F +R      ++  T S+      N+  E  ++  G    
Sbjct: 1597 QNPFTQSTIDSN-TGVSLPTFNIRTDLLAGVATDT-SKTDGLANNSPDEEEITEIG---S 1651

Query: 1759 SSKRPAQEDT 1768
            + KRP +ED 
Sbjct: 1652 TLKRPNEEDA 1661

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  311 bits (797), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 410/1471 (27%), Positives = 695/1471 (47%), Gaps = 260/1471 (17%)

Query: 365  NQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTDAT 424
             Q    +  ++K L++ER +   L+ Q+E F++ELE ++P +   +++   ++++L  AT
Sbjct: 278  GQGAPSIAHLRKLLLKERKENVSLKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAAT 337

Query: 425  LLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSNG 484
              +    + K +   EL + RQ    +      L  QR+DLAHQ+Q++L      N S+ 
Sbjct: 338  NKMIEESKAKIRTQRELSSSRQKVDHLNQIFHKLRVQRSDLAHQIQFLL----TVNSSDT 393

Query: 485  PLSAEEVRFIQDILXXXXXXXXXXXQQVISERLVTFQNIVELQQKNIDLLKSVRELARKL 544
             L   E+ FI+ I+           Q+++S+RL+ F NI ELQ++N+ L+ +VR L  K+
Sbjct: 394  VLPPSELSFIKTIIENENWDAYKDSQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKV 453

Query: 545  ELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSLPKPDTKV 604
            E  E    S         ++ AK  I  L+  N +LE ++K     ++  K     D+K+
Sbjct: 454  ESWEADNDSG------LTLEAAKLQISKLEQSNAQLESEVKNWEALMETLKDGDSLDSKI 507

Query: 605  ETEHLRLNEENTDLIKELETRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQNERAS 664
                +    E    I+ELE++L    E   +    LN  ID   RN S T+         
Sbjct: 508  NVTMV----EQQKKIEELESKLTDVGESHVQKINVLNKTID---RNQS-TI--------- 550

Query: 665  RELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETL----KEYVSCKVA 720
                        N L      NEQ++         T+K D   +  L    +E +S    
Sbjct: 551  ------------NML------NEQIKN--------TVKSDMNAKSELIACKRENLSLTQQ 584

Query: 721  LSNSQNELNYIQS--------------QLNISKTNEKSLKDDITIVSKERNEL------- 759
            +S  QNEL+ + S              +L+++    KS ++   ++++E+ ++       
Sbjct: 585  ISTKQNELDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSL 644

Query: 760  --------KELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEK-------LKN 804
                    K+L+ QL++   E E   +  +L  +   +T+  ++  +SE+       L  
Sbjct: 645  FDKIQQESKKLL-QLETRNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAF 703

Query: 805  KDREIKELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQA 864
            K+ E+K+       +I+WYQ  ID + E+          K+N+I ELN ++         
Sbjct: 704  KEEEVKQFIEKSEKQIKWYQQNIDELSEQNK-------NKSNKIIELNDKL--------- 747

Query: 865  SESRVTAYKVLNNSD-NVGTKMETLQNELE--KSKINLSEAYAELDQYKQSASEKEEFLE 921
               R+ + K L+N    VGT+++ LQNEL   K+ + +SE+ A L  YK +    + F  
Sbjct: 748  ---RLLSEKSLSNKPYPVGTELKELQNELNGMKAALEVSESQATL--YKDTLERNQNFYN 802

Query: 922  N----YQNTVEETKKEFIRKIETLQKDRDELLDTKSILSEQITDLNNE-----LDHQNKA 972
            N    +QNT+ E           LQ   + L      L  QIT+  N+     L+HQ   
Sbjct: 803  NSTLSFQNTISE-----------LQSKNEALSKQHETLQNQITETENQSKGIQLEHQTII 851

Query: 973  H--LEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQEL 1030
                 EK+ + +KLN L      I E+  +Y+ ++  ++++L+ Q+      + N+E  L
Sbjct: 852  DRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQSD----TRLNFESAL 907

Query: 1031 -QKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHAL 1089
              K  EL     Q+ E  +T   K++S  A  T   E      K   ++R S   ++   
Sbjct: 908  TSKEKELTSYAVQI-EQLNTEIAKLNSDIAALTEPAEA----RKTLIKERDSLGQELKLA 962

Query: 1090 KKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNEDL---VLSLRSDRDILQTRLSV 1146
             +RIE L++QN +L+D    +   +      + A PNEDL   V++LR +RD+ Q++ + 
Sbjct: 963  NQRIESLAAQNSILYDTFSGMRHVD------ADAEPNEDLRNLVINLRIERDMHQSQETT 1016

Query: 1147 TEEEGKALRLKLSSVNTELTNTRAKLTE-IRQQYENTKISVEEHDNIMXXXXXXXXXRES 1205
             + + K L+  L  +  +L  T  ++ E    + ++  ++V  H+ IM         +E 
Sbjct: 1017 AQRDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVT-HEKIMRELEGLTNTKEE 1075

Query: 1206 NITLRNEANDSREKAKQLQEDLETLREKVLPLE-----AEQNRLKEVIKENEQQLNAYKE 1260
            N+ L        E  K L ED  TL+E+V  L      A++N      +E +Q++  Y++
Sbjct: 1076 NLYLD-------ESIKSLNEDKRTLQEEVSRLRESEELAKKNSSAISEQEWQQKIETYQQ 1128

Query: 1261 ECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAH 1320
            E  +WK   Q +     +    E + L+ ++ T K ++  K +EN++LNDRF R+KKQAH
Sbjct: 1129 ESEKWKLMCQQM----SENTATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAH 1184

Query: 1321 ERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTALRS 1380
            E+LN+SKAT  +L  ++ +L+  N  +Q  L  +  N           +  SE   AL  
Sbjct: 1185 EKLNASKATSDSLAIELSELKTVNDALQEKLNNQETN-----------SVDSESNAALIL 1233

Query: 1381 QLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNNEATVTGQPDL 1440
            QL+E    +K  E +   SV SS+++       I  +  ELT LKE  N         D 
Sbjct: 1234 QLKEENKQAKSLELELRHSVDSSEKL-------IADMTKELTTLKE--NPIQGSVNVEDY 1284

Query: 1441 SNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISAQRE 1500
            ++ +E++K  FE+EK   ++  T+E  E+   E K +        N N+  L      R+
Sbjct: 1285 THRLEQLKSEFEDEKRVLIEKTTSELTERFEREKKELM-----NNNANLEEL------RK 1333

Query: 1501 QWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKEL- 1559
              E+E+E   L+RIE+A+ENLK+ IRLPTEEKI  VI K+K +LE+++  KV ++A  L 
Sbjct: 1334 PLEEEWERKTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLLK 1393

Query: 1560 LSSEENKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLES 1619
            LS   NKT  ++L+ ++++E++  ++++ +  K KAFEEG+QQA MKTT LE+KI+KLE+
Sbjct: 1394 LSELSNKT-ADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLERKIAKLEA 1452

Query: 1620 QLQGSNAANENKNDVEVLLKTPSDENNVPSKQEETLSKPQL-SKIQIANPLLS------- 1671
            +LQG                        P K    L+K  + S + +A PL +       
Sbjct: 1453 RLQGGTG---------------------PLKSANGLNKINIDSPLMVAGPLTNEPVLDEK 1491

Query: 1672 ----TGGTTLALNQSRAPSSLQNGSDSSNPFTSPFQQTKNDANIPAVTQPAFLLREPSEP 1727
                 G TT  ++Q   P+S     DS+N F+       N   +PA  QPAF  R  ++P
Sbjct: 1492 PNAFAGATTTTISQ---PTS-TTAKDSANAFSF------NAQKVPA--QPAFSSR--AQP 1537

Query: 1728 NMSVSTISRQSTSETNTESELPVSSEGLATP 1758
              S  + ++ S S+ + ++ +  +S    TP
Sbjct: 1538 AFSFGSFNKTSFSDLSHKNSVGAAS---GTP 1565

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  235 bits (599), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 277/1077 (25%), Positives = 546/1077 (50%), Gaps = 53/1077 (4%)

Query: 137  IKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYNDSLTETTMNKLSQDL 196
            +KLL+ +I+Q +  K    K+  + +      H L  EI++ K    L  T ++K++  L
Sbjct: 78   LKLLEERINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRTQLDKVTFTL 137

Query: 197  KSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSIIKSENDALKKEN 256
                + K+  E+E  +K+K    Y    + E Q + + ++ ++N   +   +N  L K N
Sbjct: 138  SLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKNAELFKRN 197

Query: 257  RIVSSNLHEKSSKVQELTNLYNTXXXXXXXXXXXXXXMIDVLQTQVQKLQDDYTRILNTK 316
              +S +L  K S+++ L N   T              +I+ LQ Q++ LQ+    + + K
Sbjct: 198  EELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESLSDEK 257

Query: 317  --QPIVQNDEERNL--EVEELKQKLIETETQ---LNKELEERRNI------TMQTESSTL 363
               P  Q  ++  L  +++ L +KL  +E +   L   +EE +NI      ++ + +S  
Sbjct: 258  FDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNIPEEESSSVSSHASGR 317

Query: 364  SNQQ---QEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKEL 420
            +N       D++ ++K  ++ER QK +L+ Q+   + ELE+ +P+++S+K+R+  LEKEL
Sbjct: 318  NNSALSLSGDVNILRKHFLKERQQKRQLEEQMRQILQELERNMPSLSSYKERSTFLEKEL 377

Query: 421  TDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQN 480
              + +LLE++++E    + EL+       +++    SL  QR  LA Q++Y+L+   +QN
Sbjct: 378  NSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQVKYLLL--IIQN 435

Query: 481  DS--NGPLSAEEVRFIQDILXXXXXXXXXXXQQVISERLVTFQNIVELQQKNIDLLKSVR 538
            +      L  +++  +   L           ++++ ERL  F+N+ ELQ +N+ LL+  R
Sbjct: 436  NETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSR 495

Query: 539  ELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSLP 598
            ELA K E  E+         E + I++AKEAI+ LQ Y+ KLE +IK L+DEL   K   
Sbjct: 496  ELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELSDELAVQKK-- 553

Query: 599  KPDTKVETEHL----RLNEENTDLIKELETRLATSREESNKTFASLNNEIDDIRRNHSQT 654
                K E E +    ++ ++ +    +L  +L+ + + S     +LN+EI+++ + ++  
Sbjct: 554  ---EKTEKESISAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDALNSEIENLHQANTDV 610

Query: 655  VKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEY 714
                  E+++R+LAE R  L++ ++SL K E E+LQ+ +  LQ   L ++++   + ++Y
Sbjct: 611  NISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEEVNKLQQNILDKEKQFSYSSRDY 670

Query: 715  VSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQTERE 774
            +SCK  LS ++ E+  ++++  +S   + +L+     +  ERN L+  V+Q+ SL  E +
Sbjct: 671  ISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNLRMTVTQMNSLNNELQ 730

Query: 775  QIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAIKEKR 834
             +   TK     +L     +    + +L+   + + EL+S   SEI+WY+  ID +K   
Sbjct: 731  TLLKETKSGYDDKLKISALKCTQTNNQLQLVQQRMSELKSQNDSEIKWYKATIDDLKANV 790

Query: 835  DAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMETLQNELEK 894
                +EL +K  +I E +  ++ +Q +L            L NS +V  +   L+ EL +
Sbjct: 791  FELNEELKQKEEKIEEFSKTLENVQNEL-----------TLANSKDVSEEKRALEKELSE 839

Query: 895  SKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLDTKSI 954
             K  L ++  E+ +Y+   S  +   EN     E+  K    K+++  ++R  L +  S 
Sbjct: 840  VKSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKALASKLDSELRERTTLQENLST 899

Query: 955  LSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQ 1014
            L  ++    +EL   N       SE+    + LL +    ++   +    ++       +
Sbjct: 900  LQARMVVQQDELTSNNNTL----SELRVSYDSLLLEQKTFKDKEAELRSVIAV------K 949

Query: 1015 QASYANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKNEKL 1074
              +Y ++++ +YE+ +Q+++EL+K +  LRE+    R      + +    E +++K + +
Sbjct: 950  TGNYDSLSK-SYERIMQENSELSKVVELLREEVKN-RTSNGEKEGDLEDTESIIKKGQDV 1007

Query: 1075 WEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNEDLVLSLR 1134
            W+E++K +E QI  L +R+ +L  +N+ L  +++   K  NS + +++A  NE+ + +LR
Sbjct: 1008 WDEEKKVFEVQITNLNERLSELLEENESLLARLESQDKGNNSPSAETNAAGNEETLAALR 1067

Query: 1135 SDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQ-YENTKISVEEHD 1190
            S+R  L  +L+  ++E +++R KL      L+    +L +I+ Q +E + +   EHD
Sbjct: 1068 SERTSLIEKLTAAQKEERSVRHKLRETEHALSENAFELKKIKSQIFELSSLPQNEHD 1124

 Score =  109 bits (272), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 96/267 (35%), Positives = 146/267 (54%), Gaps = 46/267 (17%)

Query: 1442 NVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISAQREQ 1501
            ++V+EMK +FE+EK   +  Q  E  EKL           TD + K    L++       
Sbjct: 1186 SLVQEMKDNFEKEKSSLLSQQEQEI-EKL-----------TDNERK----LREF------ 1223

Query: 1502 WEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLS 1561
                YEE + K++ QAEENLK+RIRLPTEEKIN +I+K+K+ELE  +++K+ + AK LL 
Sbjct: 1224 ----YEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLL 1279

Query: 1562 SEEN---KTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLE 1618
              ++   K   ++++   ++ L++  D++L   + KAFEEGKQ  +MK+ FLE+KIS LE
Sbjct: 1280 HSDDDKIKKIYKEIEESGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLE 1339

Query: 1619 SQLQGSNAANENKNDVEVLLKTPSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGTTLA 1678
             QL+  N  N           + + + NV S  E        S IQ  NP  + G   + 
Sbjct: 1340 GQLKEKNKLNN---------NSKNLKENVSSTDEHN------SSIQ-GNPFFNLGKEQMN 1383

Query: 1679 LNQSRAPSSLQNGSDSSNPFTSPFQQT 1705
            + +  + SS  + + S NPFTS F+Q 
Sbjct: 1384 VPRFTSESSTMSTTSSLNPFTS-FEQA 1409

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1554

 Score =  216 bits (550), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 194/556 (34%), Positives = 297/556 (53%), Gaps = 51/556 (9%)

Query: 1150 EGKALRLKLSSVNTELTNTRAKLTEIRQQYEN-TKISV-----EEHDNIMXXXXXXXXXR 1203
            E K L L L+S N  L   R +    R+++ +  KI       E+ + +M          
Sbjct: 1014 EKKMLALNLNSANYSLRRARYRNKNPREKFPSFVKIDQQSKKEEDKEEVMENTTKLLALE 1073

Query: 1204 ESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECN 1263
            ESN  L  E  +  +  + L   L  ++ K+ PLE E N LK  + E EQ LN  +EE  
Sbjct: 1074 ESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELE 1133

Query: 1264 RWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAHERL 1323
            RWK RSQ IL + K ++   H K   +I TL++ L   + EN +L DRF+R+KKQAHE+L
Sbjct: 1134 RWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKL 1193

Query: 1324 NSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTALRSQLE 1383
            +++K  Q  L  QI +L +   +++  L+ E   I+   +       +SE++  LR++LE
Sbjct: 1194 DAAKTMQINLTTQINELNETKVNLEKSLQQE---IEKNNQSGNGAADESEEIIRLRAELE 1250

Query: 1384 EALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNNEATVTGQPDLSNV 1443
            ++   S E E K   + K  +E        I+SL +EL  +K  +N  +TV      S +
Sbjct: 1251 KSNNFSNELEKKVEDAKKFKNE--------IESLKSELQSVKAYEN--STVN-----SKI 1295

Query: 1444 VEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISAQREQWE 1503
            ++++K+SF+ EK + ++    EFK KL +E + I AQ  +    N     +I   +++WE
Sbjct: 1296 IKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQRKNNILANGQESANIEELKKKWE 1355

Query: 1504 KEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSE 1563
            +E E ++LKRI +AEENLK+R+RLP+EEKIN+VI+K++  LE+E++ K+    +EL  + 
Sbjct: 1356 EEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKL----RELGLNA 1411

Query: 1564 ENKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQG 1623
            +    + D +  I+KEL    + EL   K KAFEEGKQQ+MMK+T LE+K+SKLESQ   
Sbjct: 1412 DGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLS 1471

Query: 1624 SNAANENKNDVEVLLKTPSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGTTLALNQSR 1683
                N+            S+E  VP       SK  LS I  ++P L  G   L LN   
Sbjct: 1472 PTKNND------------SNETQVP-------SKINLSNINSSSPPL--GEKVLQLN--Y 1508

Query: 1684 APSSLQNGSDSSNPFT 1699
              + +    +  NPFT
Sbjct: 1509 GANVVAETDNDDNPFT 1524

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
            (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  186 bits (471), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 197/636 (30%), Positives = 320/636 (50%), Gaps = 96/636 (15%)

Query: 1090 KKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNEDLVLSLRSDRDILQTRLSVTEE 1149
            K R+++L++QN+LL +++           ++S+    +D+ +SLR +RD L  ++   E+
Sbjct: 732  KVRVQNLATQNRLLLEKL-----------ERSANLEVDDIFVSLRYERDTLSDQVVNYEK 780

Query: 1150 EGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEEH-------DNIMXXXXXXXXX 1202
            + + +   L SV +EL    +++      +EN +  V++H       + ++         
Sbjct: 781  DMQVILADLESVQSELNAANSQIL----NFENQRAMVQDHKKGNVNEETLIEKLTELDEL 836

Query: 1203 RESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEEC 1262
            +E N+ L  E +   E    L+  LE   E++ PLE + + L  +I++ +  +N   E+ 
Sbjct: 837  KERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKA 896

Query: 1263 NRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAHER 1322
              WK R  ++    K  D         ++  L++ + +K KENEEL+DRFNR+KKQA+ER
Sbjct: 897  ENWKTRFNELTLSAKNND-------NEDLINLQKQVEEKSKENEELSDRFNRLKKQANER 949

Query: 1323 LNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTALRSQL 1382
            L++SK  Q  L +Q  +L+  N  ++  L  +    +  E      +++   +  L+ QL
Sbjct: 950  LHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLKEQL 1009

Query: 1383 EEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNNEATVTGQPDLSN 1442
              AL  SK+FE +   +V  S+ + S L + I+SLN +L      K+ E++V  Q    +
Sbjct: 1010 ANALDKSKKFEEELIKTVSESESLVSDLKNEIESLNEKL------KSKESSVGLQ---ES 1060

Query: 1443 VVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISAQREQW 1502
             +E  KK    E  + +    +E   K  EE+K ++                        
Sbjct: 1061 EIENAKKILIAELEEKLNKTKSELDLKHKEELKVLKT----------------------- 1097

Query: 1503 EKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSS 1562
              EYE  + KR+ +AEE LKR+IRLP+EEKIN++I+ K  +LE++Y +K+     E +S+
Sbjct: 1098 --EYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKL-----ETVSA 1150

Query: 1563 EENKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQ 1622
            E   T IE     IK+E E N    L NAK KAFEEGKQQA MKT FLE KI+KLESQLQ
Sbjct: 1151 E--STDIEK----IKQEFEDN----LVNAKKKAFEEGKQQASMKTKFLENKIAKLESQLQ 1200

Query: 1623 GSNAANENKNDVEVLLKTPSDENNVP--SKQEETLSKPQ--LSKIQIANPLLSTGGTTLA 1678
             + +   +  D E  +KT  +E + P   KQE   +KP    S    +NP  +T  T   
Sbjct: 1201 NNES---DVTDKEAEVKTTDNEKSNPELDKQE---AKPSFTFSPPPNSNPFTTTQDTDSP 1254

Query: 1679 LNQSRAPSSLQNGSDSSNPF-TSP----FQQTKNDA 1709
            ++      +   G   +NPF  SP    FQ  + D+
Sbjct: 1255 VSVFGIKPTFSLG---ANPFKISPVAPSFQTARADS 1287

 Score =  182 bits (461), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 178/611 (29%), Positives = 316/611 (51%), Gaps = 58/611 (9%)

Query: 228 IQTLRKKISTLENNCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTXXXXXXXX 287
           I+ L+ K+  LEN    + S N  L  +N  +++NL+ K  +++ L +            
Sbjct: 89  IENLKLKLFKLENENKTLNSTNLNLTDKNDTLNNNLNLKLIELKNLNDNITELELKRNND 148

Query: 288 XXXXXXMIDVLQTQVQKLQDDYTRILNTKQPIVQNDEERNLEVEELKQKLIETETQLNKE 347
                 +I  L ++++ L      +   K P  +N      EVE     +I     +N +
Sbjct: 149 IQLKDKLIQQLNSKIENL------LKLGKSPKFKN------EVE-----IINDSKTINDD 191

Query: 348 LEERRNITMQTESSTLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTIN 407
           +E  +     + +  LS Q                     L++ ++ ++ ELE+++P I 
Sbjct: 192 IENSKATIPPSPAKALSKQNN------------------GLKSDIQNYLNELEQQLPLIE 233

Query: 408 SFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAH 467
           +FK   + L+  L    L++E+L+ +K +    +D++++         ++L  QR DLAH
Sbjct: 234 NFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKTINEKSSSIEALDIQRTDLAH 293

Query: 468 QLQYILIHTSVQNDSNGPLSAEEVRFIQDILXXXXXXXXXXXQQVISERLVTFQNIVELQ 527
           QLQY+LIH+S+QND+NGPLS  E+ F+Q+++           Q VIS+RL+ F++IV LQ
Sbjct: 294 QLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLSSDVQSVISDRLIKFKDIVSLQ 353

Query: 528 QKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTL 587
           +KN++L KS+R LA  LE +E   +++ +  +   I+EAKE I+SLQ YN  L+ +I TL
Sbjct: 354 EKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEAKETILSLQEYNNVLKLEIGTL 413

Query: 588 NDELDCYKSLPKPDTKVETEHLRLNEENTDLIKELETRLATSREESNKTFASLNNEIDDI 647
             ++   +S   P++K E+E    N  +++L+K+LE++L+     S  T  +LN +I ++
Sbjct: 414 QSKISELQS-SIPNSK-ESEKQHFN-YHSNLVKDLESKLSKLSAYSQSTIENLNKDIQNL 470

Query: 648 RRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRT 707
               +  +   + E++S  LA ++L L+QNS  L  +ENE+L  +  +L+    ++++  
Sbjct: 471 YNERTDILINLEKEKSSTILANEKLTLLQNSYDLLTLENEELSSKNSMLEQQLNEEEKNL 530

Query: 708 QETLKEYVSCKVALSNSQNELNYI-QSQLNISKTNEKSLKDDITIVSKERNELKELVSQL 766
              L +Y+ CK  L +  N L  +  ++L + + N  SLK +I    ++  +L      L
Sbjct: 531 NSVLNDYIKCKTNLLDFTNRLTLLNNNKLGLEEEN-NSLKQEIKSNYEQIKDLDSKSKHL 589

Query: 767 -QSLQTE--------REQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRL 817
            QSL+ E        +E   N +KL+ Q  +  +ER       KL+NK+ EI +L S+  
Sbjct: 590 EQSLENEISKYTDKVKELELNISKLNEQKLI--LER-------KLQNKNIEIDDLNSSNY 640

Query: 818 SEIEWYQNKID 828
            +I WYQ K+D
Sbjct: 641 DQISWYQKKLD 651

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score =  134 bits (337), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 162/719 (22%), Positives = 347/719 (48%), Gaps = 71/719 (9%)

Query: 156 KLTNQYRESTAKCHDLEDEIQSLKYNDSLTETTMNKLSQDLKSISEIKERLETELENKDK 215
           ++TN+  +   K  +LE +++  K N+  T+  + K+S    S+      LE++L   + 
Sbjct: 72  RVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEKMSITYNSLESKNRELESDLSAMND 131

Query: 216 KMSEYYSNCQAEIQTLRKKISTLENNCSIIKSENDALKKENRIVSSNLHEKSSKVQELTN 275
             +  +   Q + Q L +++  L+N+  I++++ D L K       NL EK S++  L  
Sbjct: 132 NENTLHDEEQYKNQCLNREVINLKNDILILETKYDKLLKGYNDTKDNLKEKISELLALDT 191

Query: 276 LYNTXXXXXXXXXXXXXXMIDVLQTQVQKLQD-------------------------DYT 310
            + +              +I  L  +++ L++                         +Y 
Sbjct: 192 SFKSETKLKDEIIEEKDYLIANLTNEIESLKNREINEHSSDINIEYGKNSSIIVDKQEYQ 251

Query: 311 RILNTKQPIVQND--EERNLEVEELKQKLIETETQLNKELEERRNITMQTESSTLSNQQQ 368
           R+LN  + ++ N+  +E +L+V  L        T    E + +  I        +S    
Sbjct: 252 RLLN--EALINNEKIDEYDLKVARL--------TATVNEFQSKTGINF------VSTDDF 295

Query: 369 EDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTDATLLLE 428
            D   +KKE+ +   Q++ LQ ++E  I ELE   P +N+   + + LE  L+      E
Sbjct: 296 CDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKINELELLLSKEKNTSE 355

Query: 429 NLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSNGPLSA 488
           + +    ++ NE   +    K    + ++L ++ NDL +Q+Q++LI  S+QND  G L+ 
Sbjct: 356 HFKTTIKEIENEKKNIISRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTE 415

Query: 489 EEVRFIQDILXXXXXXXX---XXXQQVISERLVTFQNIVELQQKNIDLLKSVRELARKLE 545
            E++FI+ +               Q +IS+RL+ F++++ LQQKN++L+K++R + +KL+
Sbjct: 416 NEIKFIKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMELIKTLRLITKKLD 475

Query: 546 LQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSLPK------ 599
            QE   ++  +      ++EAKE I+ + S + KL++KI  L  +L+  + +        
Sbjct: 476 NQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANRPVSHEKNGHE 535

Query: 600 ---PDTKVETEHLRLNEENTDLIKELETRLATSREESNKTFASLNNEIDDIRRNHSQTVK 656
               + K+ TE  RL      ++ EL+  +    ++++   +   +++  +   + +   
Sbjct: 536 SVLAENKLYTEGDRL------ILDELKNNIPEFTKQASNIISMNFDQLTSLYNKNLELTA 589

Query: 657 ECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEYVS 716
           +      SR++ +++L L+Q+      + NE+L++ +E+++D   ++D+    T+  +V 
Sbjct: 590 DRLKAYQSRDITQKKLDLLQDKYDYLSISNEKLKEHMEVIKDTIRRKDETLNSTIANHVD 649

Query: 717 CKVALSNSQNELNYIQSQLNISKTNE-KSLKDDITIVSK----ERNELKELVSQLQSLQT 771
           CK +L +  N++N +     ++K +E K LKD  + ++     ER +LK  +  ++++Q 
Sbjct: 650 CKASLLSVTNDMNSL-----MTKYDELKYLKDQQSRITNELKMEREQLKMELLNIKTVQI 704

Query: 772 EREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAI 830
           + +      K    ++++ +E    ++S+ L+ K++E+++  S +  E++WYQ K D  
Sbjct: 705 QSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKFDIF 763

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 43/66 (65%)

Query: 1301 KKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQN 1360
            K KEN+E  DRFNR+KKQA+ RL+SSK  Q  L +QI  L+ + A +QS LE +   +Q 
Sbjct: 980  KSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKLEVQSKTVQE 1039

Query: 1361 TEEKFR 1366
             E + +
Sbjct: 1040 LETQIK 1045

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score =  101 bits (251), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 77/243 (31%), Positives = 134/243 (55%), Gaps = 35/243 (14%)

Query: 370 DLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTDATLLLEN 429
           ++D IK ELI+E+Y+K  L+ +   F+ ++E K+P +     + + +E E  +       
Sbjct: 282 NIDDIKTELIKEKYEKSLLEKKFNDFLFDIESKLPYL-----QNNSVENETNNGN----- 331

Query: 430 LRREKNQVTNELDALRQNFKSVKWE-------TKSLTKQRNDLAHQLQYILIHTSVQN-D 481
            + E+ ++ +E D+L+   +S+K +        K+L +QR+DL HQ+ Y+LI  S  N D
Sbjct: 332 -KIEEQKIIHEHDSLKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNED 390

Query: 482 SNGPLSAEEVRFIQDILXXXXXXXXXXXQQVISERLVTFQNIVELQQKNIDLLKSVRELA 541
           +N  L+  E+ FI++++           Q +ISERL+ F N+ +L  KNI L+  VREL 
Sbjct: 391 NNKILTENELNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELT 450

Query: 542 RKLE-LQEEHQQSTSQV-VEQQAIDEAKEAIISLQSYNTK--------------LEDKIK 585
            K+E +++++ Q    + ++ ++IDEAK+ +I L+  N K              LEDKI 
Sbjct: 451 NKMESIEKQNSQKFGDLEMDFKSIDEAKQRMIVLKEENVKNKDIINQIISEKKLLEDKIH 510

Query: 586 TLN 588
            LN
Sbjct: 511 GLN 513

 Score = 66.2 bits (160), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 138/500 (27%), Positives = 218/500 (43%), Gaps = 93/500 (18%)

Query: 1290 EIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQS 1349
            EI  LK+ +  K KE  E  DRF R+KKQA ++LN  K T+  L +    LE     ++ 
Sbjct: 752  EIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCDLEKSKNELEQ 811

Query: 1350 LLETERGNIQNTEEKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVK----SSDE 1405
             L     + ++ +E+  +M    +++    ++L+    S +E  N++    K      +E
Sbjct: 812  RLLLLESSEKSLQEEIVKM---KDELMTSNNELDNNQRSQEELRNEYEKQNKLYKIKEEE 868

Query: 1406 ISSHLNDVIDSLNNELTHLKESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKFVQDQTTE 1465
            + S LN ++         LKE++N+   +   PD  +V+ ++K     E +K  +D   E
Sbjct: 869  LESALNQLM---------LKENQNSALDLESLPD--DVMLKLK-----EMVK--KDIEIE 910

Query: 1466 FKEKLAEEVKRIEAQATDTQNKNVTPLQD--ISAQREQWEKEYEEIVLKRIEQAEENLKR 1523
                L  ++K IE  +    N +   L D  IS  +E WEKEY+ I+  RIE AE     
Sbjct: 911  NDIILKAKLKEIEKNSAKDVNTDSIELSDDNISTMKEAWEKEYQHILKIRIEDAE----- 965

Query: 1524 RIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSEENKTFIEDLKNDIKK----- 1578
                      N  + + + ELEKEY+E++++ + E LS + N    +DL  ++ K     
Sbjct: 966  ----------NQAMARTRKELEKEYEERLSKES-EKLSDQYNNKLKDDLSEELLKIDKKY 1014

Query: 1579 --ELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSNAANENKNDVEV 1636
              ELE  +  E   +K K F++       K   L KKI  LE+Q                
Sbjct: 1015 AMELETKLKNETDESK-KEFQDALGTEQTKNKILSKKIEFLETQ---------------- 1057

Query: 1637 LLKTPSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGTTLALNQSRAPSSLQNGSDSSN 1696
             +K   DE      Q +  S P  S  +I  P  +   T  A  Q+   S+    +  SN
Sbjct: 1058 -IKELKDE------QTKHHSNPMKSDEKI--PSTTNLSTNFAFGQNPFVSNASQNAYMSN 1108

Query: 1697 PF--TSPFQQTKNDANIPAVTQPAFLLREPSEPNMSVSTISRQSTSETNTESELPVSSEG 1754
             F   SPF +     N P   + AF   + S P+ + S+I+ Q T   NT+     S+E 
Sbjct: 1109 VFLSGSPFSR-----NAP---EKAF---KHSTPDNTNSSITVQPTLTFNTD----FSNES 1153

Query: 1755 LATPSSKRPAQEDTEEEKLD 1774
                 S   A ED E E+ D
Sbjct: 1154 KDLKRSAESAAEDDEVEEGD 1173

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
            (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 85.5 bits (210), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 119/452 (26%), Positives = 199/452 (44%), Gaps = 110/452 (24%)

Query: 1184 ISVEEHDNIMXXXXXXXXXRESNIT-LRNEANDSREKAKQLQEDLETLREKVLPLEAEQN 1242
            +S++E ++++           SN++ L N+ N  +        DL +  +++L LE E+ 
Sbjct: 542  VSIQESNDLLADENQKIKMENSNLSSLLNKINTDKNSISNELSDLHS--KEILELETEKT 599

Query: 1243 RLKEVIKENEQQLNAYKEECN---RWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLA 1299
            +L E ++E E++L    E+ N   +W Q   D   +    +   +  L+ +   LK++  
Sbjct: 600  KLLEQLEEGERKLKETNEKHNEQIKWFQNKIDNFNEETTKNQFNN-ALKNDYENLKKSFE 658

Query: 1300 DKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQ---SLLETERG 1356
            +K KE EE ND+F+R+K+QA+ERLN+SK TQ+ L D +K LEDE  + +   S LE +  
Sbjct: 659  EKSKEVEEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDIN 718

Query: 1357 NIQN----TEEKFRQMNKQSE----DVTALRSQLEEALLSSKEFENKFNASVKSSDEISS 1408
            N+ N     E+K  + N + E      + LR ++++  L+    E+     VK+ +E  S
Sbjct: 719  NLNNALVEAEKKLSEENLKYETERQTGSTLRLKIDDLQLN----EDNLKEKVKNLEENES 774

Query: 1409 HLNDVIDSLNNELTHLKESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKFVQDQTTEFKE 1468
             L D I          K  + NE  + G                  KI  +Q      K+
Sbjct: 775  TLKDKI----------KMIEGNEDDLMG------------------KISVLQSNEILLKD 806

Query: 1469 KLAEEVKRIEAQATDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLP 1528
            KL +          ++++ N + L D+   ++ WEKEY  I+ KRIE AE  L++R+   
Sbjct: 807  KLND---------LNSKSSNNSELVDVEGLKKDWEKEYSHIIEKRIEYAEMQLEKRL--- 854

Query: 1529 TEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSEENKTFIEDLKNDIKKELERNIDQEL 1588
                        K+E+E+E D+K                                    +
Sbjct: 855  ------------KSEMEREMDDK------------------------------------M 866

Query: 1589 KNAKAKAFEEGKQQAMMKTTFLEKKISKLESQ 1620
            K  + K FE GK  +      LE K+S LE Q
Sbjct: 867  KVVEMKGFESGKASSEKTLNLLEHKLSLLEKQ 898

>KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1869

 Score = 42.0 bits (97), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 104/196 (53%), Gaps = 28/196 (14%)

Query: 621  ELETRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLS 680
            +LET+L  ++E   K F+S  +EI+D++ N    VK+ Q     +E  E +L L Q+ +S
Sbjct: 1145 DLETKLNEAKERFEKEFSSTQSEIEDLKGNLQTKVKDIQRANERKEELENKLTLAQSKIS 1204

Query: 681  LSKVENEQLQKRLEILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQL----- 735
                   +L+K LE +++  +++   T+E       C+ AL++SQ+E+  ++  L     
Sbjct: 1205 -------ELKKDLE-MKETHIQKMYETKE------KCQNALNSSQSEVEELKKNLETKET 1250

Query: 736  NISKTNE--KSLKDDITIVSKE----RNELKELVSQLQSLQTEREQIFNSTKL---DSQT 786
             I K  E  +SL+ ++    +E     +ELKE +S L++L+ E E+   + K    D + 
Sbjct: 1251 KIQKATEACESLRSELETSVQESKRGMDELKEKISALETLKREAEKDSETMKKELEDKEK 1310

Query: 787  RLDTVERELYDISEKL 802
             L T++    DIS++L
Sbjct: 1311 NLATLQSAFDDISKQL 1326

>KNAG0C01570 Chr3 (310309..312681) [2373 bp, 790 aa] {ON} Anc_1.285
            YJL082W
          Length = 790

 Score = 38.9 bits (89), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 28/45 (62%), Gaps = 6/45 (13%)

Query: 1698 FTSPFQQTKNDANIPAVTQPAFLLREPSEPNMSVSTISRQSTSET 1742
            +  PFQ T +D +IPA T P     +PS P MS S +SR+ST ET
Sbjct: 366  YDGPFQFTDDDFDIPATTSPT----QPSRP-MSPS-LSRKSTEET 404

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
           YFL008W
          Length = 1222

 Score = 38.1 bits (87), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 87/164 (53%), Gaps = 19/164 (11%)

Query: 845 TNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKM-ETLQNELEKS-----KIN 898
           T  IG     I  L++D++  +S V  ++   N   V TK  ET ++E++KS     K +
Sbjct: 320 TKRIGNFEKRIDALKRDVERQKSYVERFE---NQLKVVTKARETFEDEIKKSAQDSNKYH 376

Query: 899 LSE----AYAELDQ-YKQSASEK-EEFLENYQNTVEETKKE--FIRKIETLQKDR--DEL 948
           L++     YA L++ Y  S     E  + N QN  ++   +   ++K + +   R  DEL
Sbjct: 377 LTDEDLKLYAALNEKYLNSGGFAIEGKIANSQNDSKDVADDIGLVKKRKEISSSRISDEL 436

Query: 949 LDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNH 992
           L TK  L  Q++DL++ L+ +N+AH E+ SE+ K  +E+ + N+
Sbjct: 437 LVTKQSLELQMSDLSSSLNEKNQAHSEQASELKKLQSEIESSNN 480

>Kpol_274.8 s274 complement(13824..15257) [1434 bp, 477 aa] {ON}
           complement(13824..15257) [1434 nt, 478 aa]
          Length = 477

 Score = 37.4 bits (85), Expect = 0.35,   Method: Composition-based stats.
 Identities = 46/157 (29%), Positives = 68/157 (43%), Gaps = 21/157 (13%)

Query: 137 IKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYNDSLTETTMNKLSQDL 196
           I+ LD+ I Q +V+    LK   +  E  +    +  +I  L  N S+T+ T   LSQDL
Sbjct: 286 IEQLDQFI-QKQVQISQHLKADEE--EHMSLVQSIPRDITYLSKNQSITKQT---LSQDL 339

Query: 197 KSISEIKERLETELENK-------------DKKMS--EYYSNCQAEIQTLRKKISTLENN 241
           + I+ IKE  +  + N              D K+S  E     Q +IQ  +KK+      
Sbjct: 340 RKIAFIKETTDQSISNTQQFTILFQQLLTPDSKVSSIELDKFFQQKIQLYQKKLDDYFRV 399

Query: 242 CSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYN 278
            S I+S  + +  +     SN HE SS    L  L N
Sbjct: 400 LSDIESTVNGINDDLFGTGSNTHEASSDGPNLYALKN 436

>TDEL0H00530 Chr8 complement(88314..89990) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score = 36.6 bits (83), Expect = 0.61,   Method: Composition-based stats.
 Identities = 37/130 (28%), Positives = 57/130 (43%), Gaps = 12/130 (9%)

Query: 1641 PSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGTTLALNQSRAPSSLQNGS--DSSNPF 1698
            PS EN+ P     + S P  SK   + P  S   T      S+ PSS  + S   SS P 
Sbjct: 191  PSTENSKPPTSGPSTSLPPTSKPSTSQPPTSKPST------SQPPSSGPSTSLPPSSKPS 244

Query: 1699 TSPFQQTKNDANIPAVTQPAFLLREPSEPNMSVSTISRQSTSETNTE----SELPVSSEG 1754
            TS    +K   + P  ++P+      S+P+ S    S+ STS+  +     S+ P S   
Sbjct: 245  TSQPPSSKPSTSQPPSSKPSTSQPPSSKPSTSQPPSSKPSTSQPPSSKPSTSQPPSSGPS 304

Query: 1755 LATPSSKRPA 1764
             + P + +P+
Sbjct: 305  TSLPPTSKPS 314

>Ecym_5020 Chr5 complement(43098..45470) [2373 bp, 790 aa] {ON}
            similar to Ashbya gossypii ADR400W
          Length = 790

 Score = 36.6 bits (83), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 108/237 (45%), Gaps = 32/237 (13%)

Query: 938  IETLQKDRDELL--DTKS-----ILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQ 990
            +ET    +D +L  DT++     I S +  D +N +   ++ H E  S++  +L      
Sbjct: 325  VETYVSTKDSILKQDTQAANQPEITSTETDDSSNNVSRNSQVHPEVSSDMDSQLEVA--- 381

Query: 991  NHNIEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTY 1050
               IE +  +Y   L ++Q  +    +  N+  +    +L K   L KT++Q  E   T 
Sbjct: 382  ---IENMHQEYHSFLKSIQEKMVNNDNLGNVIGS----KLSKQMSLLKTLAQSVERISTP 434

Query: 1051 RKKMDSMQANATTN--EELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVD 1108
            R    +   +A  +  ++L  K  +   +  KSY+D I ALK  I+   S+   L D+ +
Sbjct: 435  RVPASAPAGDAYISNLDDLAYKASR---DLSKSYQDHIEALKSIIDRYKSE---LNDKDE 488

Query: 1109 LLSKSENSYNQQSSATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTEL 1165
             L + ++   Q+SS + NEDL   LR        +L  T+E+   L  ++S +  EL
Sbjct: 489  KLEELKSCMKQESSGSLNEDLEFQLRG-------QLVKTKEQCSQLEHQISELKAEL 538

>ZYRO0B16610g Chr2 (1348784..1349335) [552 bp, 183 aa] {ON} similar
           to uniprot|P40452 Saccharomyces cerevisiae YIL157C FMP35
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 183

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 2/78 (2%)

Query: 701 LKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKT--NEKSLKDDITIVSKERNE 758
           L++  RT+E L E +     +     ELN +  ++NI       K  K  + +V+ + NE
Sbjct: 94  LRRSPRTRELLGENIEFDGLMPWVHGELNQVAGKVNIRFNIRGSKGTKAVVRLVANKDNE 153

Query: 759 LKELVSQLQSLQTEREQI 776
            KE + +  SL  + EQI
Sbjct: 154 FKEFLIREWSLTADDEQI 171

>TDEL0A02030 Chr1 (367215..367853) [639 bp, 212 aa] {ON} Anc_2.427
            YMR117C
          Length = 212

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 46/75 (61%), Gaps = 5/75 (6%)

Query: 1228 ETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPV-EHEK 1286
            E LR+K L    E +RL+  +K +E ++N+  ++ N+ K  SQD+++ +  +D V E ++
Sbjct: 46   EKLRDKKL----EISRLEIQLKNSESRVNSLSKDLNQIKDESQDLVSNNDVVDFVKELDE 101

Query: 1287 LEAEIATLKQNLADK 1301
            LE  I  L+ NL +K
Sbjct: 102  LEQSIVDLRSNLGEK 116

>ZYRO0D16016g Chr4 complement(1338068..1338754) [687 bp, 228 aa] {ON}
            similar to uniprot|P40543 Saccharomyces cerevisiae
            YIL024C Hypothetical ORF
          Length = 228

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 53/102 (51%), Gaps = 5/102 (4%)

Query: 962  LNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYANI 1021
            L N+ D    ++ E  ++     N +L   H+ E   N  ++ +S++Q+DL QQ    N 
Sbjct: 63   LVNDCDWVTLSYFETITDNCGHTNNVLNY-HDYELNDNLDDITISSVQDDLRQQEQLLNY 121

Query: 1022 AQNNYEQELQKHAELAKTISQLRE----DAHTYRKKMDSMQA 1059
             +N+YE++  +  E+A ++S   E    D  T  +++DS QA
Sbjct: 122  TRNDYEEKEGEPKEVAISVSGSHEQSIPDERTPSEEIDSTQA 163

>Skud_7.368 Chr7 complement(618751..621360) [2610 bp, 869 aa] {ON}
           YGR071C (REAL)
          Length = 869

 Score = 34.7 bits (78), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 11  EELTLIGSFLSVPVEQLNAIETSILSNLKTK--VEQFTELQSQSLKNEVSLEELQKTSQG 68
           +++ LIG+FL  PV Q  ++ T I +   T   V + T++ S+ L+N + +   Q    G
Sbjct: 614 DDVNLIGAFLYPPVFQSKSLLTEIFNTTSTNEIVNKVTKIASRYLRNFIDIINFQSFDNG 673

Query: 69  RINDLRT 75
           + N+L +
Sbjct: 674 KDNELSS 680

>NDAI0J00960 Chr10 complement(214481..221710) [7230 bp, 2409 aa] {ON}
            Anc_8.331 YDR150W
          Length = 2409

 Score = 34.3 bits (77), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 58/114 (50%), Gaps = 20/114 (17%)

Query: 1283 EHEKLEAEIATLKQNLADKKKENEELNDRFNRIK--KQAHER-LNSSKATQQTLIDQIKQ 1339
            E ++L+ ++ TLK+N+ D   EN++LND+F  +K  KQ  ER LN +  T Q L    K 
Sbjct: 191  EKKQLKLQLMTLKKNINDLNDENDQLNDKFQTLKTEKQIMERKLNEANHTIQELTS--KS 248

Query: 1340 LEDENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTALRSQLEEALLSSKEFE 1393
            + D N  I +  +T+   ++N E   ++ N                LL SKEFE
Sbjct: 249  IIDTN-EIPTQTDTQPLTLENVETFTKENNY--------------ILLPSKEFE 287

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score = 34.3 bits (77), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 1158 LSSVNTELTNTRAKLTEIRQQYENTKISVEEHDNIMXXXXXXXXXRESNITLRNEANDSR 1217
            +S +NTE++  R +L +I++  +  K+ ++ H++++              +LRN+A    
Sbjct: 721  ISVLNTEISGLRTQLNQIQRSLKENKVEIQYHEDMVKKEYIPKID-----SLRNKAAQCE 775

Query: 1218 EKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQ 1254
             +  Q + + ETL+E++     E  +L   IKE EQ 
Sbjct: 776  ARVSQFEHEKETLQERIYKGITE--KLGFSIKEYEQH 810

 Score = 33.5 bits (75), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 33/154 (21%), Positives = 77/154 (50%), Gaps = 30/154 (19%)

Query: 903  YAELDQYKQSASEKEEFLENYQNTVEETKKEF-IRKIETLQKDRDELLDTKSILSEQITD 961
            +AEL QYK+   + E++ + Y    ++ +K F + ++  L++ R+ L+D   +   +++D
Sbjct: 211  HAELKQYKEGVVKDEQY-KGYAQDKKKLQKNFALWELYHLERKRNSLIDELQVSKSKLSD 269

Query: 962  LNNELD-------HQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQ-------------- 1000
            L  +L            +  +E+  I+K  ++L+ + +N+E++++               
Sbjct: 270  LKGKLSTEESLLQRSKGSFAKEELAITKYRSKLIGKRNNVEKLTSSLLPVRSSKQATTKR 329

Query: 1001 ---YELKLSTLQNDLEQQASYANIAQNNYEQELQ 1031
                E ++ +LQ D+++Q SY      N+E +L+
Sbjct: 330  IANIERRIESLQRDIDRQTSYV----ENFEHQLK 359

>Kwal_47.16674 s47 complement(57126..59048) [1923 bp, 640 aa] {ON}
           YJR134C (SGM1) - Product of gene unknown [contig 376]
           FULL
          Length = 640

 Score = 33.9 bits (76), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 3/61 (4%)

Query: 712 KEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQT 771
           KE  S K  LS   +E   +Q ++N   T  K L+ D+ I SKER+   E+V++ +SLQ+
Sbjct: 162 KELCSVKELLSAKDSEQGSLQLKVNECLTRCKDLEHDLGIASKERD---EIVAKYRSLQS 218

Query: 772 E 772
           E
Sbjct: 219 E 219

>NDAI0B03720 Chr2 (930486..934910) [4425 bp, 1474 aa] {ON} Anc_2.253
            YIL115C
          Length = 1474

 Score = 33.9 bits (76), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 46/128 (35%), Gaps = 21/128 (16%)

Query: 1654 TLSKPQLS-----KIQIANPLLSTGGTTLALNQSRAPSSLQNGSDSSNPFT------SPF 1702
            T+ KP  S     K     P   T   T A      P+SL   +   NPFT      SPF
Sbjct: 489  TIGKPTFSFGSETKPISTPPAFGTPSFTSASKSENKPASLFGNTTIENPFTSADKTQSPF 548

Query: 1703 QQTKNDANIPAVTQP-AFLLREPSEPNMSVSTIS------RQSTSETNTESELPVSSEGL 1755
             QT  D       QP AF     + P+   S  +      +Q  S   T +    ++   
Sbjct: 549  GQTNKDTE---TKQPFAFGTNTATTPSFGTSAFAASTEQNKQPFSTVQTTNSTSTAAPAF 605

Query: 1756 ATPSSKRP 1763
             TPS  +P
Sbjct: 606  GTPSFGQP 613

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 33.9 bits (76), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 101/211 (47%), Gaps = 32/211 (15%)

Query: 1292 ATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLI---DQIKQLEDENAHIQ 1348
            +T+ + L + + E   LN R N  KK   + L++ +     LI   + IK +E +  + +
Sbjct: 441  STISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNNSELISTQEMIKNIEKKKDNAE 500

Query: 1349 SLLETERGNIQNTEEKFRQMNKQSEDVTAL-----------RSQLEEALLSSKEFENKF- 1396
             L+ T   +I  T  K   +N Q ED T             +S+LEE  +S K    +F 
Sbjct: 501  KLVNTTEKSITQTNNKLETLNNQQEDYTKQIEELNEKLKIEKSKLEEIKISLKGKTEQFS 560

Query: 1397 NASVKSSDEISSHLNDV------IDSLNNELTHLKESKNNEATVTGQPDLSNVVEEMKKS 1450
            N  +K+  E+  +   +      I  L +E++ L E+K+N         LSN +  +KK 
Sbjct: 561  NEILKNEKELEPYQIQLQEKMSQIQLLQSEISLLNENKDN---------LSNEIISIKKL 611

Query: 1451 FEEEKIKFVQ--DQTTEFKEKLAEEVKRIEA 1479
             EE+K+  V+  ++ T +K++L E+ K +E+
Sbjct: 612  IEEKKLSVVRMSEKITGWKQQLLEQRKEVES 642

>Skud_2.55 Chr2 complement(111625..115797) [4173 bp, 1390 aa] {ON}
           YBL047C (REAL)
          Length = 1390

 Score = 33.5 bits (75), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 57/115 (49%), Gaps = 11/115 (9%)

Query: 160 QYRESTAKCHDLEDEIQSLKYNDSLTETTMNKLSQDLKSISEIKERLETELENKDKKMSE 219
           Q   +T +  +L +++ SL    S+T    ++ +Q+LK ++EIK  ++++L N     S 
Sbjct: 597 QLSSATTEMANLSNQVNSLSKQASITNEKKSRATQELKRVTEIKNSIQSKLNN---LRSS 653

Query: 220 YYSNCQAEIQTLRKKISTLENNCSIIKSENDALKKENRIVSSNLHEKSSKVQELT 274
           +  N         K+   LE   + +  EN+ L ++  +  +N H   SK+ ELT
Sbjct: 654 HDQNV--------KQTEQLEAQVTEVNKENETLSQQLAVSEANYHATESKLNELT 700

>NCAS0B05060 Chr2 complement(940241..940938,941045..941060) [714 bp,
            237 aa] {ON} Anc_7.67 YAL030W
          Length = 237

 Score = 32.7 bits (73), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 92/218 (42%), Gaps = 55/218 (25%)

Query: 879  DNVGTKMETLQ-NELEKSKINLSEAYAELDQYKQSASEK--EEFLENYQNTVEETKKEFI 935
            D V  K+  LQ N++ K  +NL + Y   D Y  ++ E   EE L  + + V   K   I
Sbjct: 54   DIVVPKVVPLQGNKVTKVSMNLIDGY---DCYYTTSEEAGEEELLVCFTD-VTIPKILPI 109

Query: 936  RKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLA-QNHNI 994
            R +  L+KD     DT   LS  +  + +E                   NEL A QN N 
Sbjct: 110  RLLSELKKDGGNGTDTA--LSGHVGQILDEFH-----------------NELTALQNENS 150

Query: 995  EEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTI---SQLREDAHTYR 1051
            E  S +         NDL+      NI  NN ++ L++   ++  +   SQL +++H ++
Sbjct: 151  EGASTE---------NDLQD---VVNIMNNNIDKFLERQERISLLVDKTSQLNDNSHNFK 198

Query: 1052 KKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHAL 1089
            KK              +R  E++W ++ K+    I A+
Sbjct: 199  KKA-------------VRIKERMWWQRMKNTTLMIFAV 223

>NCAS0B04430 Chr2 (801789..802331) [543 bp, 180 aa] {ON} 
          Length = 180

 Score = 32.3 bits (72), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 1059 ANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLL 1103
            A ATT+    +  E+++EE  +S +D +HA K +I    S+NK++
Sbjct: 58   AKATTDTSKFKTKEEIFEEDFRSIKDDLHAFKTKISGF-SENKMI 101

>Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)
            [2388 nt, 796 aa]
          Length = 795

 Score = 33.1 bits (74), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 75/156 (48%), Gaps = 21/156 (13%)

Query: 1211 NEANDSREKAKQLQEDLETLREKVLPLEAEQNRLK-------EVIKENEQQLNAYKEECN 1263
            NEAN+S  K + L+++LE L+ K+   EA + +LK       E+ ++ E++L +   E N
Sbjct: 404  NEANNSASKLQLLEDELEILKNKLDEYEASETKLKLDYKELDELFQKREEELFSKANEVN 463

Query: 1264 RWKQRSQDILTKH--------KKIDPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRI 1315
              +Q   +I+           K+I+ +   K + E+  L Q   D  KE   L D+ N +
Sbjct: 464  TLQQSLNEIMNSQKSASEDLVKQIEELSTSKSQLEV-KLSQISVDHSKEKHYLEDKINGM 522

Query: 1316 KKQAHERLNSSKATQQTLID-QIKQLEDENAHIQSL 1350
            +K   E +   +   Q + D QIK     N  IQ+L
Sbjct: 523  EKDLSENVGKLEIANQKISDLQIKL----NGEIQNL 554

>KLTH0B08316g Chr2 (673602..676454) [2853 bp, 950 aa] {ON} some
            similarities with uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 950

 Score = 33.1 bits (74), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 22/28 (78%)

Query: 1291 IATLKQNLADKKKENEELNDRFNRIKKQ 1318
            + TL+Q LAD +KENE++  RFN ++KQ
Sbjct: 462  VVTLRQQLADAEKENEKILVRFNMLEKQ 489

>AGR229W Chr7 (1177911..1180028) [2118 bp, 705 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOR195W (SLK19)
          Length = 705

 Score = 33.1 bits (74), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 82/174 (47%), Gaps = 24/174 (13%)

Query: 922  NYQNTVEETKKEFIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAH-------- 973
            N +  +E+   E    +  L +D++ L+ +   L+E++  + +EL  Q +A         
Sbjct: 141  NLRAELEQQGSEGWDGVAALLEDKNRLIGS---LTEEVRRVQDELWRQTQAREQLQVAAC 197

Query: 974  --------LE----EKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYANI 1021
                    LE    E+  ++   +ELL +   +E  + + + +++ L+N+L      A I
Sbjct: 198  RAAERVRGLEATEREQRALAAAYDELLGKKEKLEARAEKLKARMAELRNELTVAVQNAQI 257

Query: 1022 AQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQAN-ATTNEELLRKNEKL 1074
             Q  Y +++  + EL + +    EDA     ++++++A  A+  EEL   ++KL
Sbjct: 258  LQEKYHEQIGANEELEQQLRDRAEDAQATASRLEAVEAELASLREELAAGSQKL 311

>Kpol_1031.15 s1031 (38596..41385) [2790 bp, 929 aa] {ON}
           (38596..41385) [2790 nt, 930 aa]
          Length = 929

 Score = 33.1 bits (74), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 75/155 (48%), Gaps = 24/155 (15%)

Query: 787 RLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTN 846
           +LDT+ +EL    E + + + +IK+L S+           ID +K      ++ ++EK +
Sbjct: 236 KLDTITKELIAKDELIASNEEDIKQLNSH-----------IDTLKNTIRGLEETIIEKDD 284

Query: 847 EIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMETLQNELEKSKINLSEAYAEL 906
            + +   EIK L  +L             N+SD++G++   LQN+L++    +S     L
Sbjct: 285 NLKKQKDEIKTLNNNL-------------NDSDHLGSEFLLLQNKLKEKNSQISVLENNL 331

Query: 907 DQYKQSASEKEEFLENYQNTVEETKKEFIRKIETL 941
              K +A+E +  LEN Q   ++  +E I +I  L
Sbjct: 332 IDSKNTATELKTRLENLQKEYDDKLREKINQIHKL 366

>TBLA0B09930 Chr2 (2372624..2373292) [669 bp, 222 aa] {ON} 
          Length = 222

 Score = 32.3 bits (72), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 55/106 (51%), Gaps = 22/106 (20%)

Query: 658 CQNERASRELAEQRLKL---IQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEY 714
           C+  + + +L  QR+ L   I  S  LSK+EN++L KRL+                 KE+
Sbjct: 118 CKPLKTNPDLIGQRILLKSGITCSPPLSKLENKELVKRLK----------------SKEW 161

Query: 715 --VSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNE 758
             +S ++ +S S  ++ YIQS+  I + N  +++D + + S E NE
Sbjct: 162 DDISSRLKVS-SNGDVVYIQSEKEIQEANSNNIEDSLVVWSNELNE 206

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.122    0.307 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 182,714,548
Number of extensions: 8911004
Number of successful extensions: 101342
Number of sequences better than 10.0: 5641
Number of HSP's gapped: 81891
Number of HSP's successfully gapped: 13992
Length of query: 1788
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1664
Effective length of database: 39,262,815
Effective search space: 65333324160
Effective search space used: 65333324160
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 73 (32.7 bits)