Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0A031905.704ON39839820800.0
ZYRO0G06556g5.704ON3793848691e-114
TDEL0B021605.704ON3753668271e-107
SAKL0E14960g5.704ON3843987841e-101
KNAG0C066105.704ON3863667506e-96
KLTH0E01012g5.704ON3864007481e-95
KAFR0H002005.704ON3893887393e-94
Kwal_55.196885.704ON3933997377e-94
TPHA0D046205.704ON4063967162e-90
KLLA0A00550g5.704ON3803737105e-90
NDAI0E050505.704ON4513427062e-88
CAGL0G02519g5.704ON3783766672e-83
AFR288C5.704ON4653175914e-71
Kpol_YGOB_Anc_5.7045.704ON2072113901e-44
NCAS0F002306.48ON6051111259e-07
SAKL0E02068g6.48ON5581121259e-07
NDAI0K028706.48ON6621111241e-06
TPHA0J005306.48ON5891341232e-06
CAGL0L04554g6.48ON5601461222e-06
KLTH0C10406g6.48ON5531291178e-06
KAFR0G026206.48ON6011061097e-05
YOR171C (LCB4)6.48ON6241711081e-04
ZYRO0C07084g6.48ON6471681081e-04
Ecym_31386.48ON5881121071e-04
KLLA0F20504g6.48ON5671931052e-04
AGR256W6.48ON5791561053e-04
Kpol_1042.16.48ON6531161034e-04
Kpol_1037.376.48ON622971034e-04
Smik_15.3496.48ON6251711035e-04
TDEL0G042206.48ON6321561018e-04
Skud_15.3336.48ON6271601019e-04
Skud_12.3406.48ON6801011000.001
KNAG0E027306.48ON748102970.002
Suva_8.2246.48ON624156970.002
CAGL0K05995g6.48ON794156960.003
Kwal_56.225506.48ON553136950.004
YLR260W (LCB5)6.48ON687101950.004
KAFR0A052506.48ON717145950.004
Smik_12.3356.48ON678158950.005
TPHA0F024906.48ON677105940.005
TBLA0E031806.48ON694142910.012
KNAG0M011106.48ON598155900.016
NCAS0D025106.48ON646116890.019
Suva_10.3586.48ON680101890.024
NDAI0I023706.48ON76063870.044
TBLA0G004306.48ON954120810.21
TBLA0G028403.224ON98297750.99
KLTH0G02002g3.511ON496106751.0
Ecym_80787.328ON898117704.3
TPHA0D043908.207ON215394705.1
KAFR0H032202.300ON526137679.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0A03190
         (398 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704    805   0.0  
ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conser...   339   e-114
TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704    323   e-107
SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]...   306   e-101
KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa] ...   293   6e-96
KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserve...   292   1e-95
KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704      289   3e-94
Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig ...   288   7e-94
TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa] ...   280   2e-90
KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserve...   278   5e-90
NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa] ...   276   2e-88
CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {...   261   2e-83
AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON} N...   232   4e-71
Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 20...   154   1e-44
NCAS0F00230 Chr6 (35422..37239) [1818 bp, 605 aa] {ON} Anc_6.48 ...    53   9e-07
SAKL0E02068g Chr5 (158331..160007) [1677 bp, 558 aa] {ON} simila...    53   9e-07
NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {...    52   1e-06
TPHA0J00530 Chr10 (120581..122350) [1770 bp, 589 aa] {ON} Anc_6....    52   2e-06
CAGL0L04554g Chr12 complement(526735..528417) [1683 bp, 560 aa] ...    52   2e-06
KLTH0C10406g Chr3 complement(862020..863681) [1662 bp, 553 aa] {...    50   8e-06
KAFR0G02620 Chr7 complement(541557..543362) [1806 bp, 601 aa] {O...    47   7e-05
YOR171C Chr15 complement(652010..653884) [1875 bp, 624 aa] {ON} ...    46   1e-04
ZYRO0C07084g Chr3 complement(533008..534951) [1944 bp, 647 aa] {...    46   1e-04
Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}...    46   1e-04
KLLA0F20504g Chr6 complement(1902726..1904429) [1704 bp, 567 aa]...    45   2e-04
AGR256W Chr7 (1223989..1225728) [1740 bp, 579 aa] {ON} Syntenic ...    45   3e-04
Kpol_1042.1 s1042 (2298..4259) [1962 bp, 653 aa] {ON} (2298..425...    44   4e-04
Kpol_1037.37 s1037 (90148..92016) [1869 bp, 622 aa] {ON} (90148....    44   4e-04
Smik_15.349 Chr15 complement(608112..609989) [1878 bp, 625 aa] {...    44   5e-04
TDEL0G04220 Chr7 complement(765502..767400) [1899 bp, 632 aa] {O...    44   8e-04
Skud_15.333 Chr15 complement(600768..602651) [1884 bp, 627 aa] {...    44   9e-04
Skud_12.340 Chr12 (606790..608832) [2043 bp, 680 aa] {ON} YLR260...    43   0.001
KNAG0E02730 Chr5 complement(542414..544660) [2247 bp, 748 aa] {O...    42   0.002
Suva_8.224 Chr8 complement(402084..403958) [1875 bp, 624 aa] {ON...    42   0.002
CAGL0K05995g Chr11 (583945..586329) [2385 bp, 794 aa] {ON} simil...    42   0.003
Kwal_56.22550 s56 (176751..178412) [1662 bp, 553 aa] {ON} YLR260...    41   0.004
YLR260W Chr12 (665844..667907) [2064 bp, 687 aa] {ON}  LCB5Minor...    41   0.004
KAFR0A05250 Chr1 (1038486..1040639) [2154 bp, 717 aa] {ON} Anc_6...    41   0.004
Smik_12.335 Chr12 (603893..605929) [2037 bp, 678 aa] {ON} YLR260...    41   0.005
TPHA0F02490 Chr6 (549495..551528) [2034 bp, 677 aa] {ON} Anc_6.4...    41   0.005
TBLA0E03180 Chr5 (801485..803569) [2085 bp, 694 aa] {ON} Anc_6.4...    40   0.012
KNAG0M01110 Chr13 complement(197296..199092) [1797 bp, 598 aa] {...    39   0.016
NCAS0D02510 Chr4 complement(474974..476914) [1941 bp, 646 aa] {O...    39   0.019
Suva_10.358 Chr10 (627071..629113) [2043 bp, 680 aa] {ON} YLR260...    39   0.024
NDAI0I02370 Chr9 (540379..542661) [2283 bp, 760 aa] {ON} Anc_6.4...    38   0.044
TBLA0G00430 Chr7 (86333..89197) [2865 bp, 954 aa] {ON} Anc_6.48 ...    36   0.21 
TBLA0G02840 Chr7 complement(759469..762417) [2949 bp, 982 aa] {O...    33   0.99 
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    33   1.0  
Ecym_8078 Chr8 complement(169093..171789) [2697 bp, 898 aa] {ON}...    32   4.3  
TPHA0D04390 Chr4 complement(941586..948047) [6462 bp, 2153 aa] {...    32   5.1  
KAFR0H03220 Chr8 complement(615857..617437) [1581 bp, 526 aa] {O...    30   9.6  

>NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704
          Length = 398

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/398 (100%), Positives = 398/398 (100%)

Query: 1   MSKSIKQYLLTIDHDHYYVETVLEGSAYKSFNLLIEDSTPLSVDRKLQFVPLKDTAQLIV 60
           MSKSIKQYLLTIDHDHYYVETVLEGSAYKSFNLLIEDSTPLSVDRKLQFVPLKDTAQLIV
Sbjct: 1   MSKSIKQYLLTIDHDHYYVETVLEGSAYKSFNLLIEDSTPLSVDRKLQFVPLKDTAQLIV 60

Query: 61  IDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFF 120
           IDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFF
Sbjct: 61  IDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFF 120

Query: 121 LSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTS 180
           LSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTS
Sbjct: 121 LSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTS 180

Query: 181 NYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDILA 240
           NYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDILA
Sbjct: 181 NYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDILA 240

Query: 241 NYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYSS 300
           NYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYSS
Sbjct: 241 NYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYSS 300

Query: 301 SLPKDELMARILKGYENNIGDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCCDGL 360
           SLPKDELMARILKGYENNIGDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCCDGL
Sbjct: 301 SLPKDELMARILKGYENNIGDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCCDGL 360

Query: 361 LFNLNDFIHKNDNGPCKNNEILIEFLSTYSPFQLSLMS 398
           LFNLNDFIHKNDNGPCKNNEILIEFLSTYSPFQLSLMS
Sbjct: 361 LFNLNDFIHKNDNGPCKNNEILIEFLSTYSPFQLSLMS 398

>ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conserved
           hypothetical protein
          Length = 379

 Score =  339 bits (869), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 186/384 (48%), Positives = 239/384 (62%), Gaps = 20/384 (5%)

Query: 16  HYYVETVLEGSAYKSFNLLIEDSTPLSVDRKLQFVPLKDTAQLIVIDSIHSGGGRTSDND 75
            YYV    +GS Y SF L  E S      R        D + LIV+DS+ SG GRT +ND
Sbjct: 14  EYYVTFAKDGSKYTSFQL--EKSHAKQSSRA---STRSDDSTLIVLDSLKSGIGRTENND 68

Query: 76  FYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTISEFINGLP 135
           FY  V+ PI  +LN  H  +KTTS DSV  FA  LD  + YEI+ +SGDTTISEF N LP
Sbjct: 69  FYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTTISEFCNNLP 128

Query: 136 KQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTSNYSINNFPLYKAIFP 195
            + +     +N L ILP P GTGNA ANSLG   P T F NYL  N    + PLY+A  P
Sbjct: 129 NKKI----TRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLYRAALP 184

Query: 196 NGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDILANYDLDLNISIESPRG 255
           NG  I+FF+I SLGFHANLLH CE P Y K+G ERF+IA++ IL +Y LDL+IS++  R 
Sbjct: 185 NGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISLDGLR- 243

Query: 256 LSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYSSSLPKDELMARILKGY 315
                  R Y+YF ++NTP LEA Y PSP+SNPL  +L ++ YSSSL + EL+ +I++GY
Sbjct: 244 -------RSYAYFALINTPNLEATYKPSPRSNPLERELRLLGYSSSLGRQELVEKIMQGY 296

Query: 316 ENNI-GDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCCDGLLFNLNDFIHKNDNG 374
           +N   GD+  N  + Y  I  +F + LN S E S   KF++CCDG+L NL D+   + + 
Sbjct: 297 QNKPNGDLPTNEDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHK 356

Query: 375 PCKNNEILIEFLSTYSPFQLSLMS 398
           P  +NEI  +FL+ YS FQL + S
Sbjct: 357 P--SNEIRFQFLNDYSGFQLQVYS 378

>TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704
          Length = 375

 Score =  323 bits (827), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 164/366 (44%), Positives = 237/366 (64%), Gaps = 23/366 (6%)

Query: 34  LIEDSTPLSVDRKLQFVPLKDTAQLIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHL 93
           L++ +T    DR +Q  P      LIVIDS+HSG GRT+ ND Y  VM+PIF  +N+ H 
Sbjct: 30  LVKTATTTEDDRTVQNQP-----NLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHR 84

Query: 94  LVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPF 153
           L+KTTS+D++ ++AS LD+++ + + FLSGDT+ISEFIN LP+ +   N     LSIL F
Sbjct: 85  LIKTTSRDTIASYASTLDISQSHTVLFLSGDTSISEFINNLPQGAPSAN-----LSILSF 139

Query: 154 PFGTGNALANSLGLTCPTTIFSNYLTSNYSINNFPLYKAIFPNGNEIVFFVILSLGFHAN 213
           P G+GNA A+SLG+ CP   F  ++    S + FPLYKA+FPNG  IVFF+ILS+GFHAN
Sbjct: 140 PMGSGNAWASSLGIMCPVKTFGQFIRGEMSHSPFPLYKAVFPNGYSIVFFIILSMGFHAN 199

Query: 214 LLHCCEAPHYKKLGVERFRIASEDILANYDLDLNISIESPRGLSPIVPSREYSYFVVVNT 273
           L+H CE P Y+++G+E+F++A   IL  Y+LDL I++ S         +  YSYF ++NT
Sbjct: 200 LVHACERPEYQRMGIEKFQLAGSVILKEYELDLKITVNS--------LAASYSYFALINT 251

Query: 274 PKLEAKYIPSPQSNPLRSQLHIIAYSSSLPKDELMARILKGYENNIGDVVN-NTGVTYLP 332
           P LE  Y PSP+S+PL+ +L+++ YSS L KD+ + +++KGYE    D +  ++   Y+P
Sbjct: 252 PNLEPAYRPSPESDPLKEELYLLGYSSGLSKDQFLTKVMKGYELGPSDKLPLDSDTIYVP 311

Query: 333 IEDNFIIKLNYSQEYSPSSKFQLCCDGLLFNLNDFIHKNDNGPCKNNEILIEFLSTYSPF 392
               F + L++    SP  K ++CCDG+L NL D     +     +N+  IEFL+ YS F
Sbjct: 312 FTKGFDVTLDFPLLESPRYKSEICCDGVLLNLQDLQADLE----VSNKFSIEFLNHYSKF 367

Query: 393 QLSLMS 398
            +  MS
Sbjct: 368 NIKAMS 373

>SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]
           {ON} conserved hypothetical protein
          Length = 384

 Score =  306 bits (784), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 171/398 (42%), Positives = 240/398 (60%), Gaps = 16/398 (4%)

Query: 1   MSKSIKQYLLTIDHDHYYVETVLEGSAYKSFNLLIEDSTPLSVDRKLQFVPLKDTAQLIV 60
           M+K++ + LL I    Y V+   +GS Y SF L  E  +  +V   L  +P  ++ +LI+
Sbjct: 1   MAKAVNKPLLQIGSTLYSVDIEKDGSVYSSFVLKAEKLS--TVSSSLISLPSANS-ELII 57

Query: 61  IDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFF 120
           +DS+ SG GR +  DF   V++PI  KL   H ++KT S  S+  FA +++ +K Y I F
Sbjct: 58  LDSVMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIF 117

Query: 121 LSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTS 180
           LSGDT+ISEF+N +P Q+   +++K++L+I P P GTGNA A+SL L CP   F  +L +
Sbjct: 118 LSGDTSISEFLNHIPTQN---SNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKN 174

Query: 181 NYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDILA 240
           +   + FPLY+A FPNG   +FF+ILS+GFHANLLH C    YK +GVERF+ AS  I  
Sbjct: 175 DLIASKFPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFK 234

Query: 241 NYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYSS 300
           NYDL   +SI       P   S  Y+YF ++NTP LE  Y PSP S+PL S LH++ + S
Sbjct: 235 NYDLKYKVSI-------PNRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFES 287

Query: 301 SLPKDELMARILKGYENNIGDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCCDGL 360
           SL   EL+ RI +G     GD + +TGV Y  +E +F I + +S   S   KF++CCDG 
Sbjct: 288 SLKSSELIKRITRGRTAQKGDDIMDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQ 347

Query: 361 LFNLNDFIHKNDNGPCKNNEILIEFLSTYSPFQLSLMS 398
           L NL D   +   G   +  I + FL  YSPF L ++S
Sbjct: 348 LLNLLDM--QGTEGSF-DGTIKVSFLQDYSPFNLKVLS 382

>KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa]
           {ON} Anc_5.704
          Length = 386

 Score =  293 bits (750), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 162/366 (44%), Positives = 225/366 (61%), Gaps = 16/366 (4%)

Query: 1   MSKSIKQYLLTIDHDHYYVETVLEGSAYKSFNLLIEDSTPLSVDRKLQFVPLKDTAQLIV 60
           M  +++++L+    +   VE   +GS Y  F LL E        ++     L     LIV
Sbjct: 1   MITTVRKHLVDFCGERISVEIDKDGSKYTKFALLSE-----PCPQECAPPQLFTRENLIV 55

Query: 61  IDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFF 120
           +DS+HSG GRTS ND   NV+EP+  +L+  + +VK+ +  SV  F ++LD T+ Y I F
Sbjct: 56  LDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYTILF 115

Query: 121 LSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTS 180
           +SGDT++SEF NG+      V   ++SL+ILP   GTGNALANSL L CP   F+++L  
Sbjct: 116 VSGDTSVSEFFNGV---GAGVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRG 172

Query: 181 NYSINNFPLYKAIFPNGN-EIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDIL 239
                 FPLY+AI P+G   +VFF++LSLGFHANLLH  E   YK +GVERF+ AS DIL
Sbjct: 173 ELVTAEFPLYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDIL 232

Query: 240 ANYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYS 299
            NY L   I+++  +G++       Y+YF +VN P LEA YIPSPQS+P + +LH++AYS
Sbjct: 233 QNYKLQEQITLDK-QGVAG-----SYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYS 286

Query: 300 SSLPKDELMARILKGYENNIGD-VVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCCD 358
           SSL + +L+ RI+ GY+N  GD +  +   TY  I + F IKL   QE      F+LC D
Sbjct: 287 SSLNRKQLLERIMAGYKNRRGDELTADPYTTYKRISEGFEIKLQNKQEGPNDPAFELCLD 346

Query: 359 GLLFNL 364
           G L+NL
Sbjct: 347 GQLYNL 352

>KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserved
           hypothetical protein
          Length = 386

 Score =  292 bits (748), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 156/400 (39%), Positives = 238/400 (59%), Gaps = 19/400 (4%)

Query: 1   MSKSIKQYLLTIDHDHYYVETVLEGSAYKSFNLLIE--DSTPLSVDRKLQFVPLKDTAQL 58
           M + ++  L++     ++     + + Y SF+L+    +    S+D +L     +    +
Sbjct: 1   MKQVVEVPLVSTAKTQFWACVETDDNKYTSFSLVSRPNEYGDASLDPQLT----RGQKDI 56

Query: 59  IVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLD-LTKHYE 117
           +++DSI SG GR S N+F +NV+EP+F  L + H +V+T   D+           T++  
Sbjct: 57  LIVDSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTI 116

Query: 118 IFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNY 177
           + FLSGDTTISEF+NGL ++  +    +++LS++P P GTGNA ANSLGL CP    S +
Sbjct: 117 LIFLSGDTTISEFLNGLNRRVFE--GLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCF 174

Query: 178 LTSNYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASED 237
           L    +   FPLYKA FPNG E++FF+ILS+GFHANLLH C+   ++ LGVERF+IAS +
Sbjct: 175 LQGQLTPRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLE 234

Query: 238 ILANYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIA 297
           IL  Y L+  + +         +P+R+YSYF ++NTP LEA Y PSPQSN L  QLH++ 
Sbjct: 235 ILQKYPLEYRLQVSG-------LPTRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLG 287

Query: 298 YSSSLPKDELMARILKGYENNIGDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCC 357
           YSS L +  L+++I+KGY N  GD ++  GV Y P      +  +   E   ++ F++CC
Sbjct: 288 YSSKLQQASLVSKIMKGYSNRAGDDISGDGVIYEPYNHALEVVFDQVPENVSNTYFEICC 347

Query: 358 DGLLFNLNDFIHKNDNGPCKNNEILIEFLSTYSPFQLSLM 397
           DG L N+     ++      +  I I+FL  +S F+L++M
Sbjct: 348 DGHLLNMLSLQPQDQK---FDGRIRIQFLKNFSSFELNVM 384

>KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704
          Length = 389

 Score =  289 bits (739), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 162/388 (41%), Positives = 235/388 (60%), Gaps = 26/388 (6%)

Query: 17  YYVETVLEGSAYKSFNLL---IEDSTPLSVDRKLQFVPLKDTAQLIVIDSIHSGGGRTSD 73
           + V+   +GS Y +F L+   ++D  P S               ++VIDS+ SG GR  +
Sbjct: 20  FEVKITKDGSKYHAFKLVAKEVKDDKPCSPPH---------YENVVVIDSVSSGTGRNKN 70

Query: 74  NDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTISEFING 133
           N FY  V++PIF    + H   KTT   S+  +A  LDL+K Y + F+SGDT+ISEFIN 
Sbjct: 71  NHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSISEFINN 130

Query: 134 LPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTSNYSINNFPLYKAI 193
           LP      N  K+++SILP P GTGNA ++S+G  CP    S++L +    ++FPLY+ I
Sbjct: 131 LPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQPSHFPLYEVI 190

Query: 194 FPNGNEIVFFVILSLGFHANLLHCCE-APHYKKLGVERFRIASEDILANYDLDLNISIES 252
           FPNG  ++FF+ILSLG HAN+LH CE  P YKK G ERF++A E ++  YDL++ + I  
Sbjct: 191 FPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTYDLNVRLQIPE 250

Query: 253 PRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYSSSLPKDELMARIL 312
                 +  S  +SYF+++NTP LE+ YIPSP S+P   QLH++ YSSSL  ++L+  + 
Sbjct: 251 ------LDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLLNYVT 304

Query: 313 KGYENNIGD-VVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCCDGLLFNLNDFIHKN 371
           +GY N +GD +V ++ + Y PI  N  I L   +E S   K+ +CCDGLLFNL D + +N
Sbjct: 305 QGYSNKLGDELVESSNMVYKPISRNVSIVLTEDEE-SEKYKYDICCDGLLFNLRDMLPEN 363

Query: 372 DNGPCKNNEIL-IEFLSTYS-PFQLSLM 397
              P K + +L   F S  S PF++ ++
Sbjct: 364 ---PTKEDYVLKTNFKSRDSLPFEVQVL 388

>Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig
           159] FULL
          Length = 393

 Score =  288 bits (737), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 161/399 (40%), Positives = 230/399 (57%), Gaps = 14/399 (3%)

Query: 1   MSKSIKQYLLTIDHDHYYVETVLEGSAYKSFNLLIEDSTPLSVDRKLQFVPLKDTAQLIV 60
           M++ ++  L+   +  + V    EGS   SF+LL   +   S     + V  K    ++V
Sbjct: 1   MAQIVEVPLVCSHNTQFSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKK-GDILV 59

Query: 61  IDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLD-LTKHYEIF 119
           +DSI SG GR   NDF  NV++P+F +L L + +VKT +++SV           ++  + 
Sbjct: 60  VDSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVI 119

Query: 120 FLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLT 179
           FLSGDT+ISEF+N L ++       + ++++L  P GTGNA ANSLG     T  + +L 
Sbjct: 120 FLSGDTSISEFVNNLTQEQQGT--IRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQ 177

Query: 180 SNYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDIL 239
                 NFPLYKAIFPNG EIVFF+ILS+GFHANLLH C+ P +KKLGVERFR+AS++I 
Sbjct: 178 GFLKPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIF 237

Query: 240 ANYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYS 299
            +Y LD  + +          P   YSYF ++NTP LE  Y PSP+SNPL S+LH++ YS
Sbjct: 238 EDYILDYPLQVTQ-------RPLEHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYS 290

Query: 300 SSLPKDELMARILKGYENNIGDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCCDG 359
           S LP+  L+ RI+KGY N     +N  GVTY    ++  +      E  P S F +CCDG
Sbjct: 291 SGLPQPMLINRIMKGYSNQPETDINEEGVTYQAFSNDLDVVFAQDPELVPRSAFDICCDG 350

Query: 360 LLFNLNDFIHKNDNGPCKNNEILIEFLSTYSPFQLSLMS 398
            L N+   + +       +  I ++FL  +S F L ++S
Sbjct: 351 HLLNM---LSQQPAHGSFDGRIHVKFLKEHSSFHLKVLS 386

>TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa]
           {ON} Anc_5.704
          Length = 406

 Score =  280 bits (716), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 158/396 (39%), Positives = 230/396 (58%), Gaps = 24/396 (6%)

Query: 17  YYVETVLEGSAYKSFNL----LIEDSTPLSVDRKLQFVPLKDTAQLIVIDSIHSGGGRTS 72
           Y V    +GS Y SF L      E+S  L V   L       +++L+VIDSI SG GRT 
Sbjct: 21  YDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLA------SSELVVIDSICSGVGRTG 74

Query: 73  DNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTISEFIN 132
            NDFY NVM+P+F + N  H  ++T  +DS+++ A+K + +K Y I FLSGDT++SEFIN
Sbjct: 75  QNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVSEFIN 134

Query: 133 GLPKQS----LDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTSNYSINNFP 188
            L K      +  ++ K  ++I   P GTGNALA+S+ L+ P  +F  +L +   I +FP
Sbjct: 135 NLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFLNNELIIKDFP 194

Query: 189 LYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDILANYDLDLNI 248
           LY    PN   I+FF+I S+GFHANLLH C++  Y+K+G ERF  ASE+I  NY  DLNI
Sbjct: 195 LYTVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKASENIFKNY--DLNI 252

Query: 249 SIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYSSSLPKDELM 308
            + +  G   I  SR Y+YF ++NTP LE  Y+PSP S+  +++LH++ Y +SL  ++L+
Sbjct: 253 GLTTKNGSESI--SRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGYDASLSTEKLV 310

Query: 309 ARILKGYENNIGDVVNNTG--VTYLPIEDNF----IIKLNYSQEYSPSSKFQLCCDGLLF 362
            +I+ GY     + +NN      Y P+  +     II    S +     K+ +CCDGLL 
Sbjct: 311 NKIMAGYSYKEREKINNKDNLTYYYPVNLSGTGLQIILETDSDKKLEKYKYDICCDGLLL 370

Query: 363 NLNDFIHKNDNGPCKNNEILIEFLSTYSPFQLSLMS 398
           NL+D  +++       N+I I        FQL+L +
Sbjct: 371 NLDDINNQHGVAESNKNKITISKFPNDLNFQLNLFA 406

>KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserved
           hypothetical protein
          Length = 380

 Score =  278 bits (710), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 156/373 (41%), Positives = 218/373 (58%), Gaps = 25/373 (6%)

Query: 2   SKSIKQYLLTIDHDHYYVETVLEGSAYKSFNL---LIEDSTPLSVDRKLQFVPLKDTAQL 58
           S   KQ L   +   + + T L     KS+ L   L++D   L+ ++K ++     + +L
Sbjct: 8   SNVTKQELGIYNGVSFTIVTKLLAEGAKSYQLGSKLLDDEKLLA-NKKFEY-----SGEL 61

Query: 59  IVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEI 118
           +++DS+ SG GR  D DF  NV+   F ++ + + L+KTTSK SV   AS +D T+ Y +
Sbjct: 62  LIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTRQYTV 121

Query: 119 FFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYL 178
            FLSGDT+ISEF+N LP          + +S+LPFP GTGNA A+SL L  P  IFS ++
Sbjct: 122 LFLSGDTSISEFVNNLPLN-------HDCISVLPFPMGTGNAWASSLKLMDPAVIFSQFV 174

Query: 179 TSNYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDI 238
               S N+FPLY+A F NG  + FF+ILSLGFHANLLH CE   Y+K+G+ERFR+AS+ I
Sbjct: 175 NGKLSCNDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRI 234

Query: 239 LANYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAY 298
           L  Y L+  +SI       P +    +SYF ++NT  LE  Y+PSP S+PL SQLH++AY
Sbjct: 235 LREYKLESRVSI-------PDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAY 287

Query: 299 SSSLPKDELMARILKGYENNIGDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCCD 358
            SSL + E   R+  GY N     +   G  Y P+   F   +    + S  S F++CCD
Sbjct: 288 QSSLDRVEFQKRVFMGYSNTKHSNILQNGTFYRPLP--FCFNVEVLDDPSQKSNFEVCCD 345

Query: 359 GLLFNLNDFIHKN 371
           G L NL +   KN
Sbjct: 346 GQLLNLLELEGKN 358

>NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa]
           {ON} Anc_5.704
          Length = 451

 Score =  276 bits (706), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 162/342 (47%), Positives = 215/342 (62%), Gaps = 32/342 (9%)

Query: 53  KDTAQLIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKL-- 110
           K+  +LI+IDS HSG GR  +NDFY  +MEPI  KLN+   L KTTSKDS+++FA+    
Sbjct: 79  KNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSI 138

Query: 111 ---DLTK-HYEIFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLG 166
              D TK  Y + FLSGDTTISEF N LP Q      +K +L+IL  P GT NA +NSL 
Sbjct: 139 KTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQT--SKINLNILTIPMGTANAWSNSLN 196

Query: 167 LTCPTTIFSNYLTSNYSINNFPLYKAIFPN-------------GNEIVFFVILSLGFHAN 213
           L CP  IF  +L +  +++ FPLY  I P+              N I FF++LS+GFHAN
Sbjct: 197 LNCPIDIFQKFLLNKLTVSPFPLYSLILPHSPSSSSSSGKTGGKNTIYFFIVLSMGFHAN 256

Query: 214 LLH-CCEAPHYKKLGVERFRIASEDILANYDLDLNISIESPRGLSPIVPSREYSYFVVVN 272
           LLH C     Y  LG+ERF++AS++IL+NY+L+LNI+IES    S I+ +  +SYF ++N
Sbjct: 257 LLHLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFNLMN 316

Query: 273 TPKLEAKYIPSPQSNPLRSQLHIIAYSSS-LPKDELMARILKGYENNIGDV----VNNTG 327
           TPKLE  YIPSP S+PL++ LH++AY S    K +L+  I+KGY N +G      ++  G
Sbjct: 317 TPKLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNIDEDG 376

Query: 328 VTYLPIED-NFIIKLN----YSQEYSPSSKFQLCCDGLLFNL 364
           + Y PI D  F I LN     S   S S  ++LCCDG+LFNL
Sbjct: 377 IIYFPINDKKFKITLNNPSPISSSLSLSHNYELCCDGMLFNL 418

>CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {ON}
           similar to KLLA0A00550g Kluyveromyces lactis
          Length = 378

 Score =  261 bits (667), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 148/376 (39%), Positives = 216/376 (57%), Gaps = 22/376 (5%)

Query: 17  YYVETVLEGSAYKSFNLLIEDSTPLSVDRKLQFVPLKDTAQLIVIDSIHSGGGRTSDNDF 76
           Y VE V      +S+ L+   +   S D  L+F   +DT Q+IVIDS+ SG  R   +D 
Sbjct: 15  YSVEIVEVKGKVESYKLI--KANDRSTDCFLKFD--RDT-QIIVIDSVKSGTSRNDRSDL 69

Query: 77  YRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTK--HYEIFFLSGDTTISEFINGL 134
           Y+ V+EP+F  L + +  +KT S++S+ +FA +        Y+I FLSGDT+ISEFIN L
Sbjct: 70  YKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSGDTSISEFINAL 129

Query: 135 PKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTSNYSINNFPLYKAIF 194
               L    AK  +SILP P G+GNALA SLG   P      YL SN   +  PLY A  
Sbjct: 130 DTTIL--RSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKKCSPLPLYDAQL 187

Query: 195 PNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDILANYDLDLNISIESPR 254
           PN   ++FF+ILSLGFHANLLHC E P YK +GVERF++AS+ +  +YDL++ I++    
Sbjct: 188 PNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVGIAVNG-- 245

Query: 255 GLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYSSSLPKDELMARILKG 314
                + S+ YSYF V+  P LE  Y PSP+S+ L+ +LHI+ Y + +  ++L  +I++G
Sbjct: 246 -----LQSQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIMRG 300

Query: 315 YENNIGDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCCDGLLFNLNDFIHKNDNG 374
           Y N  G+ +   G  Y   + N  + +      +P  ++ +C DG L NL D   K++  
Sbjct: 301 YHNKDGEDIQEIGTIYQCFQKNLELSIKTGHN-APKYRYDMCIDGYLLNLEDCNSKDN-- 357

Query: 375 PCKNNEILIEFLSTYS 390
                +ILI F+  ++
Sbjct: 358 ---EYKILIRFIDDHA 370

>AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON}
           NOHBY633; No homolog in Saccharomyces cerevisiae;
           Methionine is very probably wrong'
          Length = 465

 Score =  232 bits (591), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 121/317 (38%), Positives = 174/317 (54%), Gaps = 16/317 (5%)

Query: 58  LIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYE 117
           L+V+DS+ SG GR    DFY  VM P+   L++ H  V+T+S  SV   A     T    
Sbjct: 137 LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 196

Query: 118 IFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNY 177
           +  +SGDTTISEF+N L         +   +++   P GT NA A+S+GL  P      +
Sbjct: 197 VLVMSGDTTISEFVNAL--------GSGAGVTVYALPLGTANAWAHSVGLGTPAKALQAF 248

Query: 178 LTSNYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASED 237
           +        FPLY+A FP+G  I FF++LS GFHANLLH C    Y++LGVERFR AS +
Sbjct: 249 VQGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTE 308

Query: 238 ILANYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIA 297
           IL  Y L  ++ + +  G   +     Y+YF ++NTP LE  Y+PSP S+PL  QLH++A
Sbjct: 309 ILDRYALAEHVRVRAADGSEQLAGL--YAYFALLNTPHLEETYVPSPLSDPLLKQLHVLA 366

Query: 298 YSSSLPKDELMARILKGYENNIGDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKF--QL 355
           + + L +D+L   ++ GY    G  ++  G+ Y  + D+F + +    E   S +   +L
Sbjct: 367 FEAELSRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSI----ENGASDRVANEL 422

Query: 356 CCDGLLFNLNDFIHKND 372
           C DG L NL D     D
Sbjct: 423 CVDGHLLNLVDLQAPGD 439

>Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 207
           aa] {ON} ANNOTATED BY YGOB -
          Length = 207

 Score =  154 bits (390), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 84/211 (39%), Positives = 118/211 (55%), Gaps = 16/211 (7%)

Query: 192 AIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDILANYDLDLNISIE 251
           A FP+ + I FF+ILSLGFHA LLH C  P   K+G ERF++A+++IL  YDLDLNI + 
Sbjct: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKVN 61

Query: 252 SPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYSSSLPKDELMARI 311
                     +R Y+YF ++NT  LE  Y PSP+SN L + L ++ YSS L + EL+ +I
Sbjct: 62  K--------STRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKI 113

Query: 312 LKGYENNIGDVVNNTGVTYLPIED----NFIIKLNYSQEYSPSSKFQLCCDGLLFNLNDF 367
           +KGY    GDV+     TY    D       I ++     S + KF++CCDGLL +L   
Sbjct: 114 MKGYIIRKGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDL--- 170

Query: 368 IHKNDNGPCKNNEILIEFLSTYSPFQLSLMS 398
             +   G   N  I I  +  Y  F L +++
Sbjct: 171 -MEKSKGRTDNLTIHINSVKDYLSFDLQVLT 200

>NCAS0F00230 Chr6 (35422..37239) [1818 bp, 605 aa] {ON} Anc_6.48
           YLR260W
          Length = 605

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 54/111 (48%), Gaps = 3/111 (2%)

Query: 58  LIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYE 117
           ++VI + H G G+      +    +PI I  N +  ++ T       + A  LD+TK+  
Sbjct: 222 ILVIINPHGGKGKA--KLLFEKKAKPILIASNCSLEIIHTKYSRHALDIAKDLDITKYDV 279

Query: 118 IFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLT 168
           I   SGD    E INGL  Q  D  DA N L+I   P G+GNA++ S   T
Sbjct: 280 IACASGDGIPYEVINGL-YQRPDRADAFNKLTITQVPCGSGNAMSISCHWT 329

>SAKL0E02068g Chr5 (158331..160007) [1677 bp, 558 aa] {ON} similar
           to uniprot|Q12246 Saccharomyces cerevisiae YLR260W LCB5
           Minor sphingoid long-chain base kinase paralog of Lcb4p
           responsible for few percent of the total activity
           possibly involved in synthesis of long-chain base
           phosphates which function as signaling molecules and
           similar to YOR171c
          Length = 558

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 57/112 (50%), Gaps = 3/112 (2%)

Query: 53  KDTAQLIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDL 112
           K    ++VI + H G GR   N  Y +  +PI I    T  +++TT      + A  +D+
Sbjct: 177 KRNKSILVIINPHGGKGRA--NKLYVSKAKPILIASQCTVEILETTYHRHAIDIAQNIDI 234

Query: 113 TKHYEIFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANS 164
            K+  I   SGD    E +NGL +++ D   A N ++I   P G+GNA++ S
Sbjct: 235 DKYDVIACASGDGIPHEVLNGLYRRA-DRAKAFNKVAITQLPCGSGNAMSVS 285

>NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {ON}
           Anc_6.48 YLR260W
          Length = 662

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 54/111 (48%), Gaps = 3/111 (2%)

Query: 58  LIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYE 117
           +++I + H G G+ S    +    +PI    N    ++ TT      + A  LD++K+  
Sbjct: 263 ILIIINPHGGKGKASK--LFNKWSKPILSTSNCKFEIINTTYSSHATDIAKSLDISKYDI 320

Query: 118 IFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLT 168
           I   SGD    E INGL  Q  D  DA N L+I   P G+GNA++ S   T
Sbjct: 321 IACASGDGIPYEVINGL-YQRPDRVDAFNKLTITQIPCGSGNAMSISCHWT 370

>TPHA0J00530 Chr10 (120581..122350) [1770 bp, 589 aa] {ON} Anc_6.48
           YOR171C
          Length = 589

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 66/134 (49%), Gaps = 4/134 (2%)

Query: 36  EDSTPL-SVDRKLQFVPLKDTAQLIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLL 94
           +D TPL +   K  +   K   +++VI + H  GG+ +    Y +  EPI      T  +
Sbjct: 180 QDKTPLINAILKRSYQNAKMYRRILVIVNPH--GGKGNAKKIYLSKCEPILKASTATVDI 237

Query: 95  VKTTSKDSVENFASKLDLTKHYEIFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFP 154
             T       + A ++DL+K+  I   SGD    E INGL ++S D  DA N L++   P
Sbjct: 238 AYTKYAGHAIDIAREVDLSKYDTIACASGDGIPYEVINGLNQRS-DRVDAFNKLAVTQIP 296

Query: 155 FGTGNALANSLGLT 168
            G+GNA++ S   T
Sbjct: 297 CGSGNAMSVSCHWT 310

>CAGL0L04554g Chr12 complement(526735..528417) [1683 bp, 560 aa]
           {ON} similar to uniprot|Q12246 Saccharomyces cerevisiae
           YOR171c LCB4
          Length = 560

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 66/146 (45%), Gaps = 18/146 (12%)

Query: 40  PLSVDRKLQFVPLK----DTAQLIVIDS-------------IHSGGGRTSDNDFYRNVME 82
           P +V  ++ +VP+     D  +LI+  S             I+  GG+      ++  +E
Sbjct: 133 PCTVPLQIDYVPMAHENPDLVELIIEKSYQNVKRNRSILVIINPHGGKGKAMHIFKKRIE 192

Query: 83  PIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTISEFINGLPKQSLDVN 142
           PI I    +  L++T       + A ++DL +   I   SGD    E INGL  +  D  
Sbjct: 193 PILIASECSFELMETKYSRHATDIAREIDLEEFDTIACASGDGVPYEVINGLYMRE-DKV 251

Query: 143 DAKNSLSILPFPFGTGNALANSLGLT 168
           DA N +++   P G+GNA++ S   T
Sbjct: 252 DAFNKITVTQLPCGSGNAMSISCHWT 277

>KLTH0C10406g Chr3 complement(862020..863681) [1662 bp, 553 aa] {ON}
           similar to uniprot|Q12246 Saccharomyces cerevisiae
           YLR260W LCB5 Minor sphingoid long-chain base kinase
           paralog of Lcb4p responsible for few percent of the
           total activity possibly involved in synthesis of long-
           chain base phosphates which function as signaling
           molecules and similar to YOR171c
          Length = 553

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 58/129 (44%), Gaps = 4/129 (3%)

Query: 53  KDTAQLIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDL 112
           K    ++VI + H G G       Y + ++PI    N T   V+TT      + A  +D 
Sbjct: 175 KRNKTILVIMNPHGGKGHA--KKLYLSKVKPILAASNCTVETVETTYHGHATDLAKTVDA 232

Query: 113 TKHYEIFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSL-GLTCPT 171
            K   I   SGD    E +NGL  Q  D  DA N L I   P G+GNA++ S  G T P+
Sbjct: 233 DKFDIIACASGDGIPHEVLNGL-FQRPDRADAFNKLIITQLPCGSGNAMSVSCHGTTNPS 291

Query: 172 TIFSNYLTS 180
               N L +
Sbjct: 292 HAALNILKA 300

>KAFR0G02620 Chr7 complement(541557..543362) [1806 bp, 601 aa] {ON}
           Anc_6.48 YOR171C
          Length = 601

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 52/106 (49%), Gaps = 5/106 (4%)

Query: 58  LIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTS-KDSVENFASKLDLTKHY 116
           L++I + H G G+      ++  +EPI +KL      VK T         A KLDL K  
Sbjct: 229 LLIIINPHGGKGKALK--LFQEHVEPI-LKLTFFKFEVKLTEYHRHAMQIARKLDLDKFD 285

Query: 117 EIFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALA 162
            I   SGD    E INGL  Q  D ++A N L +   P G+GNA++
Sbjct: 286 TIVCASGDGIPYEVINGL-YQRTDRSNAFNKLCVTQLPCGSGNAMS 330

>YOR171C Chr15 complement(652010..653884) [1875 bp, 624 aa] {ON}
           LCB4Sphingoid long-chain base kinase, responsible for
           synthesis of long-chain base phosphates, which function
           as signaling molecules, regulates synthesis of ceramide
           from exogenous long-chain bases, localizes to the Golgi
           and late endosomes
          Length = 624

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 73/171 (42%), Gaps = 30/171 (17%)

Query: 53  KDTAQLIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDL 112
           K    ++VI + H  GG+ +  + +     PI ++      +  T       + A  LD+
Sbjct: 224 KRNRSILVIINPH--GGKGTAKNLFLTKARPILVESGCKIEIAYTKYARHAIDIAKDLDI 281

Query: 113 TKHYEIFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTT 172
           +K+  I   SGD    E INGL ++  D  DA N L++   P G+GNA++    ++C  T
Sbjct: 282 SKYDTIACASGDGIPYEVINGLYRRP-DRVDAFNKLAVTQLPCGSGNAMS----ISCHWT 336

Query: 173 IFSNYLTSNYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHY 223
                        N P Y A+          ++ S+    +L+ CC  P Y
Sbjct: 337 -------------NNPSYAAL---------CLVKSIETRIDLM-CCSQPSY 364

>ZYRO0C07084g Chr3 complement(533008..534951) [1944 bp, 647 aa] {ON}
           similar to uniprot|Q12246 Saccharomyces cerevisiae
           YLR260W LCB5 Minor sphingoid long-chain base kinase
           paralog of Lcb4p responsible for few percent of the
           total activity possibly involved in synthesis of
           long-chain base phosphates which function as signaling
           molecules and similar to YOR171c
          Length = 647

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 66/168 (39%), Gaps = 30/168 (17%)

Query: 58  LIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYE 117
           ++VI + H G G+      +     PI +       +  T       + A ++DL K+  
Sbjct: 262 VLVIINPHGGQGKA--KKLFMTKCRPILLASRCPIEIAYTKYGRHAVDIAREVDLNKYDT 319

Query: 118 IFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNY 177
           I   SGD    E INGL  Q  D   A N LSI   P G+GNA++    +TC       +
Sbjct: 320 IACASGDGIPYEVINGL-YQRKDRAAAFNKLSITQLPCGSGNAMS----VTC-------H 367

Query: 178 LTSNYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKK 225
            TSN S     L K++    +                L CC  P Y K
Sbjct: 368 WTSNPSYAALSLVKSVESRID----------------LMCCSQPSYCK 399

>Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR256W
          Length = 588

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 53/112 (47%), Gaps = 3/112 (2%)

Query: 53  KDTAQLIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDL 112
           K    ++VI  I+  GGR   N  Y    +PI I       + +T+  +     A  +D+
Sbjct: 198 KRNKSILVI--INPHGGRGRANKIYVTKAKPILIASGCYVEVFQTSYPEHAIEIARTMDI 255

Query: 113 TKHYEIFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANS 164
            K+  I   SGD    E +NGL ++  D   A N +++   P G+GNA++ S
Sbjct: 256 DKYDVIACASGDGIPYEVLNGLYRRE-DRAKAFNKVAVTQLPCGSGNAMSVS 306

>KLLA0F20504g Chr6 complement(1902726..1904429) [1704 bp, 567 aa]
           {ON} similar to uniprot|Q12246 Saccharomyces cerevisiae
           YLR260W LCB5 Minor sphingoid long-chain base kinase
           paralog of Lcb4p responsible for few percent of the
           total activity possibly involved in synthesis of
           long-chain base phosphates which function as signaling
           molecules and similar to YOR171c
          Length = 567

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 80/193 (41%), Gaps = 30/193 (15%)

Query: 53  KDTAQLIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDL 112
           K    ++VI + H G G+   N  + +  +PI +      ++ +TT      + A  LD+
Sbjct: 174 KRNKSILVIINPHGGKGKA--NKLFLSKAKPILLASGCKIVVKETTYHLHAVDIAKNLDI 231

Query: 113 TKHYEIFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTT 172
            ++  +   SGD    E +NGL  +S D   A   L+I   P G+GNA++    ++C   
Sbjct: 232 DEYDVVACASGDGIPHEIMNGLFLRS-DRAKAFQKLAITQLPCGSGNAMS----ISC--- 283

Query: 173 IFSNYLTSNYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFR 232
               + TSN S     L K++    +                + CC  P YK      F 
Sbjct: 284 ----HGTSNPSYAALALLKSVESRID----------------VMCCTQPSYKNQPRLSFL 323

Query: 233 IASEDILANYDLD 245
             +  I+A  D+D
Sbjct: 324 SQTYGIIAESDID 336

>AGR256W Chr7 (1223989..1225728) [1740 bp, 579 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR260W (LCB5) and
           YOR171C (LCB4)
          Length = 579

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 61/156 (39%), Gaps = 28/156 (17%)

Query: 68  GGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTI 127
           GG+   +  Y    +PI +  +    +V+T         A+ +D+ K+  I   SGD   
Sbjct: 204 GGKGKAHKLYVTKAKPILVASDCQIDVVETKYSSHAAEIAATMDINKYDVIACASGDGIP 263

Query: 128 SEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTSNYSINNF 187
            E +NGL  +  D   A N L+I   P G+GNA++            S + TSN S  + 
Sbjct: 264 HEVLNGLFTRP-DRVAAFNKLAITQLPCGSGNAMS-----------ISCHGTSNPSYASL 311

Query: 188 PLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHY 223
            L KA     +                L CC  P Y
Sbjct: 312 SLVKATEARVD----------------LMCCTQPSY 331

>Kpol_1042.1 s1042 (2298..4259) [1962 bp, 653 aa] {ON} (2298..4259)
           [1962 nt, 654 aa]
          Length = 653

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 53  KDTAQLIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDL 112
           K   +++VI  I+  GG+ +    +     P+ I    T  L  T         A  LD+
Sbjct: 267 KRKRKILVI--INPYGGKGNAKKLFMTKCYPLLIASRCTVDLAYTKFSGHAITLAEALDI 324

Query: 113 TKHYEIFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLT 168
            K+  I   SGD    E INGL ++  D  +A N L+I   P G+GNA++ S   T
Sbjct: 325 NKYDTIACASGDGIPYEVINGLYRRK-DRVEAFNKLTITQLPCGSGNAMSVSCHWT 379

>Kpol_1037.37 s1037 (90148..92016) [1869 bp, 622 aa] {ON}
           (90148..92016) [1869 nt, 623 aa]
          Length = 622

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 45/97 (46%), Gaps = 1/97 (1%)

Query: 68  GGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTI 127
           GG+      Y N    I I+      +V T       +   +LD++K+  I   SGD   
Sbjct: 253 GGKGKAKKLYLNKCHDILIQSKCKVDIVYTNYGGHAIDIGRELDISKYDTIACASGDGIP 312

Query: 128 SEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANS 164
            E +NGL  Q  D  +A N L+I   P G+GNA++ S
Sbjct: 313 YEILNGL-YQRPDRVEAFNKLAITQLPCGSGNAMSIS 348

>Smik_15.349 Chr15 complement(608112..609989) [1878 bp, 625 aa] {ON}
           YOR171C (REAL)
          Length = 625

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 72/171 (42%), Gaps = 30/171 (17%)

Query: 53  KDTAQLIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDL 112
           K    ++VI + H  GG+ +    +    +PI  +      +  T       + A  LD+
Sbjct: 226 KRNRSILVIINPH--GGKGTAKTLFLTKAQPILAESGCKIEIAYTKYARHAIDIAKDLDI 283

Query: 113 TKHYEIFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTT 172
            K+  I   SGD    E INGL ++S D  +A N L++   P G+GNA++    ++C  T
Sbjct: 284 RKYDTIACASGDGIPYEVINGLYRRS-DRVEAFNKLAVTQLPCGSGNAMS----ISCHWT 338

Query: 173 IFSNYLTSNYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHY 223
                        N P Y A+          ++ S+    +L+ CC  P Y
Sbjct: 339 -------------NNPSYAAL---------CLVKSIETRIDLM-CCSQPSY 366

>TDEL0G04220 Chr7 complement(765502..767400) [1899 bp, 632 aa] {ON}
           Anc_6.48 YOR171C
          Length = 632

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 66/156 (42%), Gaps = 28/156 (17%)

Query: 68  GGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTI 127
           GG+      + +  +PI +  N +     T       + A ++DL K+  I   SGD   
Sbjct: 253 GGKGKAKKMFMSKCKPILLASNCSIDTAYTKYAMHAVDIAREIDLDKYDTIACASGDGIP 312

Query: 128 SEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTSNYSINNF 187
            E INGL  Q  D  +A   L+I   P G+GNA++    ++C       + TSN      
Sbjct: 313 YEVINGL-YQRPDRAEAFTKLAITQLPCGSGNAMS----VSC-------HWTSN------ 354

Query: 188 PLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHY 223
           P Y A+          ++ S+    +L+ CC  P Y
Sbjct: 355 PSYAAL---------CLVKSVEARIDLM-CCSQPSY 380

>Skud_15.333 Chr15 complement(600768..602651) [1884 bp, 627 aa] {ON}
           YOR171C (REAL)
          Length = 627

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 67/160 (41%), Gaps = 28/160 (17%)

Query: 64  IHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSG 123
           I+  GG+ +    +     PI ++      +  T       + A  LD++K+  I   SG
Sbjct: 237 INPHGGKGTAKTLFLTKASPILVESGCKIEIAYTKYARHAIDIARDLDISKYDTIACASG 296

Query: 124 DTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTSNYS 183
           D    E INGL ++  D  DA N +++   P G+GNA++    ++C  T           
Sbjct: 297 DGIPYEVINGLFRRP-DRVDAFNKVAVTQLPCGSGNAMS----ISCHWT----------- 340

Query: 184 INNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHY 223
             N P Y A+          ++ S+    +L+ CC  P Y
Sbjct: 341 --NNPSYAAL---------CLVKSIETRIDLM-CCSQPSY 368

>Skud_12.340 Chr12 (606790..608832) [2043 bp, 680 aa] {ON} YLR260W
           (REAL)
          Length = 680

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 1/101 (0%)

Query: 68  GGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTI 127
           GG+      +    +P+ +    +  +V T         A ++D+ K+  I   SGD   
Sbjct: 270 GGKGKAKKLFMTKAKPLLLASRCSIEVVYTKYPGHAIEIAREMDIDKYDTIACASGDGIP 329

Query: 128 SEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLT 168
            E INGL ++  D   A N L+I   P G+GNA++ S   T
Sbjct: 330 HEVINGLYRRP-DRVKAFNQLAITEIPCGSGNAMSVSCHWT 369

>KNAG0E02730 Chr5 complement(542414..544660) [2247 bp, 748 aa] {ON}
           Anc_6.48 YOR171C
          Length = 748

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 47/102 (46%), Gaps = 2/102 (1%)

Query: 67  GGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTT 126
           GG R +   F R     +     +  L+    S  ++E  A  +D+ K+  I   SGD  
Sbjct: 364 GGKRNAKKIFMRKAKRLLMASDFMFDLVYTKYSGHAIE-IAKNMDIEKYDTIACASGDGI 422

Query: 127 ISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLT 168
             E INGL ++   V  A N L+I   P G+GNA++ S   T
Sbjct: 423 PHEVINGLYRRHDRVR-AFNKLAITEIPCGSGNAMSVSCNWT 463

>Suva_8.224 Chr8 complement(402084..403958) [1875 bp, 624 aa] {ON}
           YOR171C (REAL)
          Length = 624

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 64/156 (41%), Gaps = 28/156 (17%)

Query: 68  GGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTI 127
           GG+      +     PI ++      +  T       + A  LD++K+  I   SGD   
Sbjct: 242 GGKGKAKTLFLTKARPILLESGCKIEIAYTKYARHAIDIAKDLDISKYDTIACASGDGIP 301

Query: 128 SEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTSNYSINNF 187
            E INGL ++  D  +A N L++   P G+GNA++    ++C  T             N 
Sbjct: 302 YEVINGLYRRP-DRVEAFNKLAVTQLPCGSGNAMS----ISCHWT-------------NN 343

Query: 188 PLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHY 223
           P Y A+          ++ S+    +L+ CC  P Y
Sbjct: 344 PSYAAL---------CLVKSIETRIDLM-CCSQPSY 369

>CAGL0K05995g Chr11 (583945..586329) [2385 bp, 794 aa] {ON} similar
           to uniprot|Q06147 Saccharomyces cerevisiae YLR260w
           sphingolipid long chain base kinase
          Length = 794

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 63/156 (40%), Gaps = 28/156 (17%)

Query: 68  GGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTI 127
           GG+      +    +P+      T  +  T       + A ++D++K+  I   SGD   
Sbjct: 411 GGKGKAKKLFMTKAKPLLSASRSTVEIKYTKYPQEAIDIAREMDISKYDTIVCASGDGIP 470

Query: 128 SEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTSNYSINNF 187
            E INGL ++  D  +A N L+I   P G+GNA++ S   T                 N 
Sbjct: 471 YEVINGLYRRP-DRVEAFNKLAITQLPCGSGNAMSVSCHWT-----------------NN 512

Query: 188 PLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHY 223
           P Y A+          ++ S+    +L+ CC  P Y
Sbjct: 513 PSYAAL---------CLLKSVEARIDLM-CCSQPSY 538

>Kwal_56.22550 s56 (176751..178412) [1662 bp, 553 aa] {ON} YLR260W
           (LCB5) - sphingoid long chain base (LCB) kinase [contig
           185] FULL
          Length = 553

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 59/136 (43%), Gaps = 4/136 (2%)

Query: 46  KLQFVPLKDTAQLIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVEN 105
           K  +   K +  +++I + H G G       Y + ++PI          ++TT       
Sbjct: 166 KRSYAGTKRSKSILIIMNPHGGKGHA--KKLYLSKVKPILTASPSFVEAIETTYHGHAIE 223

Query: 106 FASKLDLTKHYEIFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSL 165
            A  +++ K+  I   SGD    E +NGL  Q  D   A N L I   P G+GNA++ S 
Sbjct: 224 LAKNINIDKYDVIACASGDGIPHEVLNGL-YQRPDRAAAFNKLVITQLPCGSGNAMSVSC 282

Query: 166 -GLTCPTTIFSNYLTS 180
            G T P+    N L +
Sbjct: 283 HGTTNPSHAALNVLKA 298

>YLR260W Chr12 (665844..667907) [2064 bp, 687 aa] {ON}  LCB5Minor
           sphingoid long-chain base kinase, paralog of Lcb4p
           responsible for few percent of the total activity,
           possibly involved in synthesis of long-chain base
           phosphates, which function as signaling molecules
          Length = 687

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 1/101 (0%)

Query: 68  GGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTI 127
           GG+      +    +P+ +    +  +V T         A ++D+ K+  I   SGD   
Sbjct: 279 GGKGKAKKLFMTKAKPLLLASRCSIEVVYTKYPGHAIEIAREMDIDKYDTIACASGDGIP 338

Query: 128 SEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLT 168
            E INGL  Q  D   A N+++I   P G+GNA++ S   T
Sbjct: 339 HEVINGL-YQRPDHVKAFNNIAITEIPCGSGNAMSVSCHWT 378

>KAFR0A05250 Chr1 (1038486..1040639) [2154 bp, 717 aa] {ON} Anc_6.48
           YOR171C
          Length = 717

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 63/145 (43%), Gaps = 8/145 (5%)

Query: 29  KSFNLLIE---DSTPLSVDRKLQ--FVPLKDTAQLIVIDSIHSGGGRTSDNDFYRNVMEP 83
           K  +LLIE   D+T   ++  LQ  F   K    L+VI  ++  GG+ +    +     P
Sbjct: 284 KRLSLLIENESDNTSALIEEILQRSFRNTKRRRSLLVI--VNPFGGKGNAKKIFMRKARP 341

Query: 84  IFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTISEFINGLPKQSLDVND 143
           +         +  T         A  +D+ K+  I   SGD    E INGL ++  D   
Sbjct: 342 LLQASGFKIDVKYTKYSGHAVQIAQGIDIHKYDTICCASGDGIPHEVINGLYRRK-DRVA 400

Query: 144 AKNSLSILPFPFGTGNALANSLGLT 168
           A N L+I   P G+GNA++ S   T
Sbjct: 401 AFNKLTITQIPCGSGNAMSVSCHWT 425

>Smik_12.335 Chr12 (603893..605929) [2037 bp, 678 aa] {ON} YLR260W
           (REAL)
          Length = 678

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 64/158 (40%), Gaps = 28/158 (17%)

Query: 68  GGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTI 127
           GG+      +    +P+ +    +  +V T         A ++D+ ++  I   SGD   
Sbjct: 270 GGKGKAKKLFMTKAKPLLLASQCSIEVVYTKYPGHAIEIAREMDIDQYDTIACASGDGIP 329

Query: 128 SEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTSNYSINNF 187
            E INGL ++   V  A N L+I   P G+GNA++    ++C       + T+N S +  
Sbjct: 330 HEVINGLYRRPDHVK-AFNKLAITEIPCGSGNAMS----VSC-------HWTNNPSYSTL 377

Query: 188 PLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKK 225
            L K+I    +                L CC  P Y K
Sbjct: 378 CLIKSIETKID----------------LMCCSQPSYAK 399

>TPHA0F02490 Chr6 (549495..551528) [2034 bp, 677 aa] {ON} Anc_6.48
           YOR171C
          Length = 677

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 47/105 (44%), Gaps = 1/105 (0%)

Query: 64  IHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSG 123
           I+  GG+ +    Y +  +PI         +V T       N A ++D+ K+  I   SG
Sbjct: 295 INEFGGKGNAKKLYFSKAKPILAASRCKVDIVFTEYTGHAINVAKEMDINKYDTIVCASG 354

Query: 124 DTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLT 168
           D    E INGL  Q  D   A + L+I   P G+ NA++ S   T
Sbjct: 355 DGIPYEIINGL-YQRKDRAAAFSKLAITQLPCGSANAMSVSCHWT 398

>TBLA0E03180 Chr5 (801485..803569) [2085 bp, 694 aa] {ON} Anc_6.48
           YOR171C
          Length = 694

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 62/142 (43%), Gaps = 10/142 (7%)

Query: 37  DSTPLSVDRKLQFVPLKDTAQLIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVK 96
           D   L +DR   +V  K    ++VI  I+  GG+ S    Y     P+        + + 
Sbjct: 301 DVVSLILDR--SYVNAKRNRSMLVI--INPHGGKGSAKKLYMQKCHPLLAASKQCTIDIA 356

Query: 97  TTSKDS-VENFASKLDLTKHYEIFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPF 155
            T   +   + A  L++ K+  I   SGD    E +NGL  Q  D   A + L I   P 
Sbjct: 357 YTKYAAHAIDIARDLNIDKYDTIVCASGDGIPHEVLNGL-YQRKDRAKAFDKLCITQLPC 415

Query: 156 GTGNALANSLGLTCPTTIFSNY 177
           G+GNA++    ++C  T+  +Y
Sbjct: 416 GSGNAMS----VSCHWTVNPSY 433

>KNAG0M01110 Chr13 complement(197296..199092) [1797 bp, 598 aa] {ON}
           Anc_6.48 YOR171C
          Length = 598

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 66/155 (42%), Gaps = 22/155 (14%)

Query: 40  PLSVDRKLQFVPLK----DTAQLIVIDS-------------IHSGGGRTSDNDFYRNVME 82
           P +V   + +VPL     D A++I+  S             I+  GG+    + +     
Sbjct: 155 PRTVRLNIDYVPLSPASSDLAEVILKRSYKNARRNKKMLVIINPFGGKGQAKNLFFQRAA 214

Query: 83  PIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTISEFINGLPKQSLDVN 142
           PI       + +  T         A  LD+ K+  I   SGD    E +NGL ++ +D  
Sbjct: 215 PILDASGSDYDIAYTERSRHAVEIAESLDIDKYDTIVCASGDGIPYEVLNGLYRR-IDRV 273

Query: 143 DAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNY 177
            A N + +   P G+GNA++    ++C  T+ ++Y
Sbjct: 274 AAFNKIVVTQLPCGSGNAMS----ISCHWTMNTSY 304

>NCAS0D02510 Chr4 complement(474974..476914) [1941 bp, 646 aa] {ON}
           Anc_6.48 YLR260W
          Length = 646

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 4/116 (3%)

Query: 53  KDTAQLIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDL 112
           ++ + L+VI+     GG+      + +  +P+ +    +  +  T         A +LD+
Sbjct: 251 RNRSILVVINPF---GGKRKAKKVFMSKAKPLLLASECSIDIAYTEYIGHGIKIAQELDI 307

Query: 113 TKHYEIFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLT 168
            K+  I   SGD    E +NGL ++  D   A N L+I   P G+GNA++ S   T
Sbjct: 308 DKYDTIACASGDGIPHEIMNGLYRRP-DRVKAFNKLAITQIPCGSGNAMSVSCHWT 362

>Suva_10.358 Chr10 (627071..629113) [2043 bp, 680 aa] {ON} YLR260W
           (REAL)
          Length = 680

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 45/101 (44%), Gaps = 1/101 (0%)

Query: 68  GGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTI 127
           GG+      +    +P+ +    +  +V T         A  +++ K+  +   SGD   
Sbjct: 270 GGKGKAKKLFMTKAKPLLLASRCSIEVVYTKYPGHAVEIAEDMNIDKYDTVVCASGDGIP 329

Query: 128 SEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLT 168
            E +NGL ++   V  A N L+I   P G+GNA++ S   T
Sbjct: 330 HEVMNGLYRRPDHVK-AFNKLAITQIPCGSGNAMSVSCHWT 369

>NDAI0I02370 Chr9 (540379..542661) [2283 bp, 760 aa] {ON} Anc_6.48
           YLR260W
          Length = 760

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 106 FASKLDLTKHYEIFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSL 165
            A ++D+ K   I   SGD    E INGL ++  D   A N L+I   P G+GNA++ S 
Sbjct: 400 IAKEMDIDKFDTIACASGDGIPHEVINGLYRRE-DRVKAFNKLTITQIPCGSGNAMSVSC 458

Query: 166 GLT 168
             T
Sbjct: 459 HWT 461

>TBLA0G00430 Chr7 (86333..89197) [2865 bp, 954 aa] {ON} Anc_6.48
           YOR171C
          Length = 954

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 53/120 (44%), Gaps = 11/120 (9%)

Query: 53  KDTAQLIVIDSIHSGGGRTSDNDFYRNVMEPIFI----KLNLTHLLVKTTSKDSVENFAS 108
           K    ++VI  I+  GG+      +    +PI +    K+++T+      + D       
Sbjct: 574 KRNRSILVI--INQFGGKGKAKKMFITKAKPILLASGCKIDVTYTRYARHAID----IGK 627

Query: 109 KLDLTKHYEIFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLT 168
            LD+ K+  I   SGD    E INGL  Q  D   A   L+I   P G+GNA++ S   T
Sbjct: 628 HLDIDKYDTILCASGDGIPYEIINGL-YQRPDRAKAFEKLAITELPCGSGNAMSVSCFWT 686

>TBLA0G02840 Chr7 complement(759469..762417) [2949 bp, 982 aa] {ON}
           Anc_3.224 YBR038W
          Length = 982

 Score = 33.5 bits (75), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 34  LIEDSTPLSVDRKLQFVPLKDTAQLIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHL 93
           ++E   P  VD+K  F+ +K   + + I+  H    +   ND+YR++   I +   LT+L
Sbjct: 852 IVETDWPQEVDKK--FIEIKSRLKEVEIEEEHFDEAQ-HRNDYYRDIRTRIVMIWMLTNL 908

Query: 94  LVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTISEF 130
           L+      ++    S  D+   Y IF L     ++ F
Sbjct: 909 LLVM----AITQIYSPADVDNKYLIFLLWSVAALAAF 941

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 45/106 (42%), Gaps = 8/106 (7%)

Query: 88  LNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTISEFINGLPKQSLDVNDAKNS 147
           L+ +HL  + T         + + L +   I FL G   +S++    P ++L        
Sbjct: 7   LDFSHLYSEETKSRKSSPLKTCIHLFQDPNIVFLGGGLPLSKY---FPWENLQAESP--- 60

Query: 148 LSILPFPFGTGNALANSLGLTCPTTIFSNYLTSNYSINNFPLYKAI 193
             + PFP G G A +     TC T+I  +  +     N+ PL +A+
Sbjct: 61  --LPPFPNGIGAAPSGDAKDTCVTSIPKDGTSKAGDTNDIPLSRAL 104

>Ecym_8078 Chr8 complement(169093..171789) [2697 bp, 898 aa] {ON}
           similar to Ashbya gossypii ADR071W
          Length = 898

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 52/117 (44%), Gaps = 24/117 (20%)

Query: 263 REYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYSSSL----PKDELMARILKGYENN 318
           R YS+       K + K    P+   +RS L   A SSS+    PK  L AR+ KG E+N
Sbjct: 800 RNYSW-------KKQFKLGNKPEEFKIRS-LSPTAISSSILANKPKPNLRARLDKGIEHN 851

Query: 319 IGDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQL-CCDGLLFNLNDFIHKNDNG 374
             D +  + +  +PI D           Y P+ +      +G+L  LN +  K+D G
Sbjct: 852 HSDNLGESFINSIPIAD-----------YEPTERGDGPSSNGVLGLLNQYYRKSDVG 897

>TPHA0D04390 Chr4 complement(941586..948047) [6462 bp, 2153 aa] {ON}
            Anc_8.207 YER155C
          Length = 2153

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 281  IPSPQSNPLRSQLHIIAYSSSLPKDELMARILKGYENNIGDVVNNTGVTYLPIEDNFIIK 340
            +P P+S+   S+   I+   SL +    A+I   Y NN  D +++  +T   + D+ I+K
Sbjct: 911  VPPPRSSARMSKSISISEPFSLMRSS-YAQINDDYSNNTIDEISSKQITGFDLIDSAILK 969

Query: 341  LNYSQEYSPSSKFQLCCDGLLFNLNDFIHKNDNG 374
               S E S S   +  CD  ++N+N  I + +NG
Sbjct: 970  NISSIEPSNSKLMRSACD--IYNINSHIFRLNNG 1001

>KAFR0H03220 Chr8 complement(615857..617437) [1581 bp, 526 aa] {ON}
           Anc_2.300 YNL029C
          Length = 526

 Score = 30.4 bits (67), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 61/137 (44%), Gaps = 25/137 (18%)

Query: 21  TVLEGSAYKSFNLLIEDSTPLSVDRKLQF---VPL---KDTA-----QLIVIDSIHSGGG 69
             L  S Y+  N  IED  PL +   + F   VP+    DT      ++++++S  +   
Sbjct: 2   ATLRRSLYRIQNY-IEDLNPLVICFVIAFFITVPIVIYTDTGSEIQNKILILNSAQNTDS 60

Query: 70  RTSDNDFYRNVME-------PIFIKLNLTHLLVKTTSK-----DSVENFASKLDLTKHYE 117
           +  D+ FYR  ++       P+++K N T +++    +      ++E+  S  +   HY 
Sbjct: 61  K-HDSTFYRGCVDTNEYLRNPMYVKQNATFVMLTRNEELYEVISTIESIESHFNQWFHYP 119

Query: 118 IFFLSGDTTISEFINGL 134
             FL+ D    EF N +
Sbjct: 120 YVFLNNDEFTDEFQNAI 136

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,712,890
Number of extensions: 2394683
Number of successful extensions: 6460
Number of sequences better than 10.0: 70
Number of HSP's gapped: 6597
Number of HSP's successfully gapped: 70
Length of query: 398
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 286
Effective length of database: 40,638,807
Effective search space: 11622698802
Effective search space used: 11622698802
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)