Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0A031805.705ON88884492e-59
Skud_11.3355.705ON94933183e-39
Kpol_YGOB_1043.725.705ON88873164e-39
YKR095W-A (PCC1)5.705ON88873112e-38
TDEL0B021505.705ON91813071e-37
KLTH0E00990g5.705ON89873043e-37
Smik_11.3595.705ON88873025e-37
SAKL0E14982g5.705ON89872974e-36
Kwal_YGOB_Anc_5.7055.705ON88872931e-35
TBLA0G010305.705ON89872913e-35
Suva_11.3325.705ON1111102872e-34
KAFR0H001905.705ON82812843e-34
KNAG0C066205.705ON101872811e-33
ZYRO0B16368g5.705ON85802801e-33
NDAI0E050605.705ON86842689e-32
KLLA0A00539g5.705ON87852662e-31
TPHA0E002005.705ON85732574e-30
Ecym_40165.705ON125732204e-24
AFR289W5.705ON81802044e-22
CAGL0G02535g5.705ON140551824e-18
ZYRO0B08558g4.365ON75139641.1
KLLA0E06491g7.439ON72772631.6
KLLA0D12430g7.346ON41843631.7
TBLA0C016201.460ON68850622.0
AFR282W5.697ON30727612.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0A03180
         (88 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...   177   2e-59
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...   127   3e-39
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...   126   4e-39
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...   124   2e-38
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...   122   1e-37
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...   121   3e-37
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...   120   5e-37
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...   119   4e-36
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...   117   1e-35
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...   116   3e-35
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...   115   2e-34
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...   114   3e-34
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...   112   1e-33
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...   112   1e-33
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...   107   9e-32
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...   107   2e-31
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...   103   4e-30
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    89   4e-24
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    83   4e-22
CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...    75   4e-18
ZYRO0B08558g Chr2 (666600..668855) [2256 bp, 751 aa] {ON} simila...    29   1.1  
KLLA0E06491g Chr5 complement(585024..587207) [2184 bp, 727 aa] {...    29   1.6  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...    29   1.7  
TBLA0C01620 Chr3 (380064..382130) [2067 bp, 688 aa] {ON} Anc_1.4...    28   2.0  
AFR282W Chr6 (943962..944885) [924 bp, 307 aa] {ON} Syntenic hom...    28   2.4  

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267
          bp, 88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score =  177 bits (449), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 88/88 (100%), Positives = 88/88 (100%)

Query: 1  MKNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRG 60
          MKNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRG
Sbjct: 1  MKNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRG 60

Query: 61 IDDRVLRVGVSSVIDSIKTIIETIDELD 88
          IDDRVLRVGVSSVIDSIKTIIETIDELD
Sbjct: 61 IDDRVLRVGVSSVIDSIKTIIETIDELD 88

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
          [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score =  127 bits (318), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 66/93 (70%), Positives = 72/93 (77%), Gaps = 6/93 (6%)

Query: 1  MKNGREMSLDYVL------NLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNIL 54
          M + REMSLDY L       L+IPF T  QA IA KVL PDPILKPQDFQV+Y S+ NI+
Sbjct: 1  MTSKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM 60

Query: 55 AVHFRGIDDRVLRVGVSSVIDSIKTIIETIDEL 87
           V FR IDDRVLRVGVSSVIDSIKTI+ETIDEL
Sbjct: 61 LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDEL 93

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,
          88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  126 bits (316), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 60/87 (68%), Positives = 72/87 (82%)

Query: 1  MKNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRG 60
          MK  R + +D+ L+ EIPF T+RQA+IA +VL PDPILKPQDFQV Y S DN+L + F+ 
Sbjct: 1  MKTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKS 60

Query: 61 IDDRVLRVGVSSVIDSIKTIIETIDEL 87
          IDDRVLRVGVSSVIDS+KTIIET+DEL
Sbjct: 61 IDDRVLRVGVSSVIDSVKTIIETMDEL 87

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
          {ON}  PCC1Component of the EKC/KEOPS protein complex
          with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
          complex is required for t6A tRNA modification and may
          have roles in telomere maintenance and transcription
          Length = 88

 Score =  124 bits (311), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 60/87 (68%), Positives = 70/87 (80%)

Query: 1  MKNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRG 60
          M + RE SLD+ L L+IPF T RQA IA KVL PDPILKPQDFQV+Y S+ N++ V FR 
Sbjct: 1  MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60

Query: 61 IDDRVLRVGVSSVIDSIKTIIETIDEL 87
          IDDRVLRVGVSS+IDSIKTI+E +D L
Sbjct: 61 IDDRVLRVGVSSIIDSIKTIVEAMDVL 87

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276
          bp, 91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score =  122 bits (307), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 70/81 (86%)

Query: 7  MSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGIDDRVL 66
          MSL++ L LEIPF T+ QA IA +VL+PDPILKPQDFQV+Y + DN+L V F+ IDDRVL
Sbjct: 1  MSLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVL 60

Query: 67 RVGVSSVIDSIKTIIETIDEL 87
          RVGVSSVIDSIKTI+ETIDEL
Sbjct: 61 RVGVSSVIDSIKTIVETIDEL 81

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,
          89 aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score =  121 bits (304), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 59/87 (67%), Positives = 68/87 (78%)

Query: 1  MKNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRG 60
          MK  R+  L Y L LE+PF T++QA+ A KVL PDPILKPQDF VEY S+ + L V F G
Sbjct: 1  MKGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEG 60

Query: 61 IDDRVLRVGVSSVIDSIKTIIETIDEL 87
          +DDRVLRVGVSSVI+SIKTIIETIDE 
Sbjct: 61 VDDRVLRVGVSSVIESIKTIIETIDEF 87

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
          {ON} YKR095W-A (REAL)
          Length = 88

 Score =  120 bits (302), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%)

Query: 1  MKNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRG 60
          M + REM L + L L++PF T +QA IA +VL PDPILKPQDFQ++Y S+ N++ V FR 
Sbjct: 1  MSSKREMPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRS 60

Query: 61 IDDRVLRVGVSSVIDSIKTIIETIDEL 87
          IDDRVLRVGVSSVIDSIKT++E +DEL
Sbjct: 61 IDDRVLRVGVSSVIDSIKTVVEAMDEL 87

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Proposed transcription factor
          involved in the expression of genes regulated by
          alpha-factor and galactose
          Length = 89

 Score =  119 bits (297), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 59/87 (67%), Positives = 68/87 (78%)

Query: 1  MKNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRG 60
          MKN R+MSLD+ L LEIP  T  QA IA K L PDP+LKP+DFQVEY + D  L V F+ 
Sbjct: 1  MKNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKS 60

Query: 61 IDDRVLRVGVSSVIDSIKTIIETIDEL 87
          IDDRVLRVGVSSVI+S+KTIIET+DE 
Sbjct: 61 IDDRVLRVGVSSVIESVKTIIETMDEF 87

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644)
          [267 bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  117 bits (293), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 57/87 (65%), Positives = 66/87 (75%)

Query: 1  MKNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRG 60
          MK+ R ++L Y L LE+PF   +QA  A +VL PDPILKPQDF VEY S  N L V F G
Sbjct: 1  MKSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEG 60

Query: 61 IDDRVLRVGVSSVIDSIKTIIETIDEL 87
          +DDRVLRVGVSSVI+SIKTI+ETIDE 
Sbjct: 61 VDDRVLRVGVSSVIESIKTIVETIDEF 87

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
          {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score =  116 bits (291), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 68/87 (78%)

Query: 2  KNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGI 61
          K    M +++ L L IPF TS+QA IA +VL PDPIL+PQDFQV+Y S+ N L + F+ I
Sbjct: 3  KRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSI 62

Query: 62 DDRVLRVGVSSVIDSIKTIIETIDELD 88
          DDRVLRVGVSSVIDS+KTIIET DEL+
Sbjct: 63 DDRVLRVGVSSVIDSVKTIIETFDELE 89

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score =  115 bits (287), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 72/110 (65%), Gaps = 23/110 (20%)

Query: 1   MKNGREMSLDYVL-----------------------NLEIPFTTSRQAQIAAKVLVPDPI 37
           MK+ REM LD+ L                        L+IPF T +QA IA +VL PDPI
Sbjct: 1   MKSQREMPLDHTLVERIFKGRPSEVFTNYGMFQNTRELKIPFETEKQANIATRVLSPDPI 60

Query: 38  LKPQDFQVEYLSQDNILAVHFRGIDDRVLRVGVSSVIDSIKTIIETIDEL 87
           LKPQDFQ +Y S++N++   FR IDDRVLRVGVSSVIDSIKTIIET+DEL
Sbjct: 61  LKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSSVIDSIKTIIETMDEL 110

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp,
          82 aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score =  114 bits (284), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 54/81 (66%), Positives = 65/81 (80%)

Query: 7  MSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGIDDRVL 66
          M+LD+ L LEIPF  ++QA IA  VL PDPIL+PQDFQV Y ++DN+    F  IDDRVL
Sbjct: 1  MNLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVL 60

Query: 67 RVGVSSVIDSIKTIIETIDEL 87
          RVGVS+VIDS+KTIIET+DEL
Sbjct: 61 RVGVSNVIDSLKTIIETMDEL 81

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
          aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score =  112 bits (281), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 64/87 (73%)

Query: 2  KNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGI 61
          K  R  +LD+ L L +PF T RQA IA++VL PDPILKPQDF V Y +Q   L   F G 
Sbjct: 4  KTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGR 63

Query: 62 DDRVLRVGVSSVIDSIKTIIETIDELD 88
          D RVLRVGVSSVIDS+KTIIE++DELD
Sbjct: 64 DARVLRVGVSSVIDSLKTIIESLDELD 90

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A
          Length = 85

 Score =  112 bits (280), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (83%)

Query: 9  LDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGIDDRVLRV 68
          LD+ L+L IPF   R +++A KVL PDPIL+P+DFQVEY S+ N+L + F+ +DDRVLRV
Sbjct: 4  LDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRV 63

Query: 69 GVSSVIDSIKTIIETIDELD 88
          GVSSVIDS+KTI+ETIDELD
Sbjct: 64 GVSSVIDSVKTIVETIDELD 83

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON}
          Anc_5.705 YKR095W-A
          Length = 86

 Score =  107 bits (268), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 65/84 (77%), Gaps = 4/84 (4%)

Query: 8  SLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLS----QDNILAVHFRGIDD 63
          +LDY L + IPF   R A IA +VL PDPILKP+DFQVEYL      +N+L V F+ ID+
Sbjct: 3  TLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDE 62

Query: 64 RVLRVGVSSVIDSIKTIIETIDEL 87
          RVLRVGVSSV+DSIKTI+ET+DEL
Sbjct: 63 RVLRVGVSSVLDSIKTILETMDEL 86

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,
          87 aa] {ON} highly similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score =  107 bits (266), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 50/85 (58%), Positives = 67/85 (78%)

Query: 3  NGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGID 62
          N  + S ++ L+LEIPF + +QA +A KVL+PDPI+KP+DFQV Y +QD  L   F  +D
Sbjct: 2  NKGDTSFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVD 61

Query: 63 DRVLRVGVSSVIDSIKTIIETIDEL 87
          +R+LRVGV+SVI+SIKTI+ETIDEL
Sbjct: 62 ERILRVGVNSVIESIKTIVETIDEL 86

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp,
          85 aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score =  103 bits (257), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 51/73 (69%), Positives = 63/73 (86%)

Query: 15 LEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGIDDRVLRVGVSSVI 74
          L IPF TS+QA IAA+VL PDP L+P++F+V+Y SQ + L V+F+ +DDRVLRVGVS+VI
Sbjct: 10 LNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNVI 69

Query: 75 DSIKTIIETIDEL 87
          DSIKTIIETIDEL
Sbjct: 70 DSIKTIIETIDEL 82

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 89.4 bits (220), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 42/73 (57%), Positives = 56/73 (76%)

Query: 15  LEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGIDDRVLRVGVSSVI 74
           LE+PF   +QA+IA +VL  DP+L+P+DF+V+Y  Q   L V+F  ID R LRVGVSSVI
Sbjct: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110

Query: 75  DSIKTIIETIDEL 87
           +SIKT++ET+DE 
Sbjct: 111 ESIKTVVETMDEF 123

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
          Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
          (PCC1); 1-intron
          Length = 81

 Score = 83.2 bits (204), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 55/80 (68%)

Query: 9  LDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGIDDRVLRV 68
          +D+ L+L +PF ++R A IAA+ L PDP+L+P++  V + S    L +    ID RVLRV
Sbjct: 1  MDHTLHLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAIDARVLRV 60

Query: 69 GVSSVIDSIKTIIETIDELD 88
            +S+ +++KT++ET DELD
Sbjct: 61 ATNSIFEALKTVVETADELD 80

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
          [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
          unknown function
          Length = 140

 Score = 74.7 bits (182), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%)

Query: 14 NLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGIDDRVLRV 68
          +L +PF T+R A IA +VL PDPIL+P+DFQVEY ++  +L +HF+ IDDRVLR 
Sbjct: 30 DLHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLRT 84

>ZYRO0B08558g Chr2 (666600..668855) [2256 bp, 751 aa] {ON} similar
           to uniprot|P38883 Saccharomyces cerevisiae YHR197W RIX1
           RIbosome eXport essential protein
          Length = 751

 Score = 29.3 bits (64), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 49  SQDNILAVHFRGIDDRVLRVGVSSVIDSIKTIIETIDEL 87
           SQD   A H +   D   R+G+ S++   K I+E  DE+
Sbjct: 226 SQDEHQA-HHKPFHDETWRIGILSILAQFKPILELCDEM 263

>KLLA0E06491g Chr5 complement(585024..587207) [2184 bp, 727 aa] {ON}
           similar to uniprot|Q12311 Saccharomyces cerevisiae
           YPR031W NTO1 Component of the histone acetyltransferase
           complex
          Length = 727

 Score = 28.9 bits (63), Expect = 1.6,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 10/72 (13%)

Query: 17  IPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGIDDRVLRVGVSSVIDS 76
           IP+ +SR        L  D  L  Q+F+ E++   NI+ +       R L +  S +I+ 
Sbjct: 612 IPYISSR--------LENDEYLSVQEFKDEFVG--NIVKITSNERSPRSLVIMGSKLIND 661

Query: 77  IKTIIETIDELD 88
           +  ++  IDELD
Sbjct: 662 LNKLLSKIDELD 673

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score = 28.9 bits (63), Expect = 1.7,   Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 24/43 (55%)

Query: 44  QVEYLSQDNILAVHFRGIDDRVLRVGVSSVIDSIKTIIETIDE 86
           Q++YL  D  + +HF G +    R   S V  S +TI++ IDE
Sbjct: 244 QLQYLIPDTSIELHFVGPESFYDREKRSYVQSSTETIVKRIDE 286

>TBLA0C01620 Chr3 (380064..382130) [2067 bp, 688 aa] {ON} Anc_1.460
           YEL023C
          Length = 688

 Score = 28.5 bits (62), Expect = 2.0,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 12/50 (24%)

Query: 48  LSQDNILAVHFRGIDDRVLRVGV-----------SSVIDSIKTIIETIDE 86
            S+D I+ +HF+G+ D V  VG+           SS++D ++  + +IDE
Sbjct: 195 FSRDYIIKIHFQGLFDSVNSVGILRDRLFPCTQRSSIVDHVRHAV-SIDE 243

>AFR282W Chr6 (943962..944885) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL145C (PAN6)
          Length = 307

 Score = 28.1 bits (61), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 23  RQAQIAAKVLVPDPILKPQDFQVEYLS 49
           R+A IAA   V +P++   DF+V+YLS
Sbjct: 231 REAVIAAANTVWEPLINSGDFRVDYLS 257

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.139    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,685,008
Number of extensions: 301445
Number of successful extensions: 713
Number of sequences better than 10.0: 27
Number of HSP's gapped: 710
Number of HSP's successfully gapped: 27
Length of query: 88
Length of database: 53,481,399
Length adjustment: 60
Effective length of query: 28
Effective length of database: 46,601,439
Effective search space: 1304840292
Effective search space used: 1304840292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)