Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0A031705.706ON1319131961040.0
ZYRO0B16412g5.706ON1372103929120.0
KAFR0H001805.706ON1241104529080.0
KNAG0C066305.706ON1281106428830.0
TDEL0B021405.706ON1147102328620.0
Smik_11.3605.706ON1180104226570.0
CAGL0G02541g5.706ON1295102426230.0
Kpol_1043.735.706ON1260103126220.0
Skud_11.3365.706ON1188103826030.0
Suva_11.3335.706ON1187103425970.0
SAKL0E15004g5.706ON1196104625430.0
YKR096W5.706ON1195103825430.0
Kwal_55.196785.706ON1178104025020.0
KLTH0E00968g5.706ON1148103924600.0
TPHA0E001905.706ON1361106024510.0
YIL151C5.706ON1118103124230.0
Skud_9.175.706ON1118103024200.0
Suva_9.375.706ON1117103024110.0
Smik_9.185.706ON1118103023700.0
AFR290W5.706ON1217103323580.0
Ecym_40155.706ON1257103623610.0
CAGL0H06611g5.706ON1282107523020.0
KLLA0A00528g5.706ON1229104122570.0
NDAI0E050705.706ON155637714761e-179
TBLA0E017105.706ON152641511541e-133
TPHA0D046405.706ON9626021812e-12
Kpol_1055.794.253ON28292752.9
NDAI0B051301.256ON825120763.9
TPHA0B022204.253ON290102744.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0A03170
         (1319 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...  2355   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1126   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...  1124   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...  1115   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1107   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...  1028   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...  1014   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...  1014   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...  1007   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...  1004   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...   984   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   984   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...   968   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   952   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   948   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   937   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   936   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   933   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   917   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   912   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   914   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   891   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   874   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   573   e-179
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   449   e-133
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...    74   2e-12
Kpol_1055.79 s1055 complement(209404..210252) [849 bp, 282 aa] {...    33   2.9  
NDAI0B05130 Chr2 complement(1254612..1257089) [2478 bp, 825 aa] ...    34   3.9  
TPHA0B02220 Chr2 complement(511433..512305) [873 bp, 290 aa] {ON...    33   4.0  

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score = 2355 bits (6104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1162/1319 (88%), Positives = 1162/1319 (88%)

Query: 1    MPQLATHNFIQXXXXXXXXXXXXXXXXIIQLGMDXXXXXXXXXXXAFIQENIRQKRHSSN 60
            MPQLATHNFIQ                IIQLGMD           AFIQENIRQKRHSSN
Sbjct: 1    MPQLATHNFIQLSNNPNSESNLPSPNPIIQLGMDSNNNTNNESNNAFIQENIRQKRHSSN 60

Query: 61   SYSNAKNNPAVKRRIAKPEEVSLKYIDNMEYGTATTGNNSIICQQQTPSKGTLSRRPSLI 120
            SYSNAKNNPAVKRRIAKPEEVSLKYIDNMEYGTATTGNNSIICQQQTPSKGTLSRRPSLI
Sbjct: 61   SYSNAKNNPAVKRRIAKPEEVSLKYIDNMEYGTATTGNNSIICQQQTPSKGTLSRRPSLI 120

Query: 121  KKQMNSTPQPMSYVVSEVPASPFYLPANSFSNNYERSPALLTXXXXXXXXXXXXXXXXLR 180
            KKQMNSTPQPMSYVVSEVPASPFYLPANSFSNNYERSPALLT                LR
Sbjct: 121  KKQMNSTPQPMSYVVSEVPASPFYLPANSFSNNYERSPALLTNNNNININNNNNSNNNLR 180

Query: 181  FNSMNASSIPRENNDVPAIEQLTLPQPMSRTMNYSTEIPXXXXXXXXXXQSAIIPNNEHK 240
            FNSMNASSIPRENNDVPAIEQLTLPQPMSRTMNYSTEIP          QSAIIPNNEHK
Sbjct: 181  FNSMNASSIPRENNDVPAIEQLTLPQPMSRTMNYSTEIPINSNSNNIDDQSAIIPNNEHK 240

Query: 241  NGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEAL 300
            NGE                                                     GEAL
Sbjct: 241  NGENQESENYKNTNNNNEQDTNNNINNTNRDRNNNNNNNNNNNNSSSSTSSSSKKTGEAL 300

Query: 301  VRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTALLS 360
            VRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTALLS
Sbjct: 301  VRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTALLS 360

Query: 361  SQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISLST 420
            SQSQQDLHIG            LWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISLST
Sbjct: 361  SQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISLST 420

Query: 421  MLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLYYHM 480
            MLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLYYHM
Sbjct: 421  MLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLYYHM 480

Query: 481  STVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQLIEYL 540
            STVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQLIEYL
Sbjct: 481  STVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQLIEYL 540

Query: 541  KHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTIDMFRS 600
            KHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTIDMFRS
Sbjct: 541  KHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTIDMFRS 600

Query: 601  RDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXXXXXXXX 660
            RDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKER        
Sbjct: 601  RDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERKDKKEKKK 660

Query: 661  XXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNIEQLRF 720
                        ASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNIEQLRF
Sbjct: 661  SKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNIEQLRF 720

Query: 721  DYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISILLKRE 780
            DYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISILLKRE
Sbjct: 721  DYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISILLKRE 780

Query: 781  GLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMNVFIL 840
            GLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMNVFIL
Sbjct: 781  GLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMNVFIL 840

Query: 841  DLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLGIKDHMF 900
            DLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLGIKDHMF
Sbjct: 841  DLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLGIKDHMF 900

Query: 901  LDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNNNVPM 960
            LDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNNNVPM
Sbjct: 901  LDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNNNVPM 960

Query: 961  DNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNLNFEIPPL 1020
            DNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNLNFEIPPL
Sbjct: 961  DNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNLNFEIPPL 1020

Query: 1021 KSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLILAQXXXXXXXAT 1080
            KSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLILAQ       AT
Sbjct: 1021 KSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLILAQNNNNNTNAT 1080

Query: 1081 DEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYKTYFVFDATSWLRHFA 1140
            DEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYKTYFVFDATSWLRHFA
Sbjct: 1081 DEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYKTYFVFDATSWLRHFA 1140

Query: 1141 HIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLYSDGNLLPLRFT 1200
            HIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLYSDGNLLPLRFT
Sbjct: 1141 HIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLYSDGNLLPLRFT 1200

Query: 1201 GNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEGTSNWGEIDXXX 1260
            GNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEGTSNWGEID   
Sbjct: 1201 GNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEGTSNWGEIDATT 1260

Query: 1261 XXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFSVCSMMGIDEGVCTN 1319
                     KSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFSVCSMMGIDEGVCTN
Sbjct: 1261 TTVSAEEEEKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFSVCSMMGIDEGVCTN 1319

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1126 bits (2912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/1039 (57%), Positives = 717/1039 (69%), Gaps = 96/1039 (9%)

Query: 297  GEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITT 356
             +ALV+KLQDIYKVIVKQEIELQERCSQLTTSQTT+LKNLWTIYK+N DLINNYVTF+TT
Sbjct: 414  SQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTT 473

Query: 357  ALLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFI 416
            ALL SQ++QD+ IG            LWVYGTITFLD+ KNFSNFMDPEVCCQFITHVFI
Sbjct: 474  ALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFI 533

Query: 417  SLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKL 476
            S+S ML DIP KY IPWLQRLGDLSRMAIALYPSGFIDWKLSAE WYMEAMKFTY+HGKL
Sbjct: 534  SISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKL 593

Query: 477  YYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQL 536
            YYHMSTVQQNTLEAFVNLGKSVFCQ+TF PSQQYMQLVIDNIYQRAFVERNNGN+RN QL
Sbjct: 594  YYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQL 653

Query: 537  IEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTID 596
            IEYLKHSEVMLLP+FLE+++LQQVVL+YF+ KFG                    ++  ++
Sbjct: 654  IEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGC-------------------DSNNVN 694

Query: 597  MFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXXXX 656
            +F +R MF QNP+ L+YFFRHAPAFAESHILQLVGFGDPKNPFALLFELP++LK+     
Sbjct: 695  IFDTRKMFCQNPDYLRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKD----- 749

Query: 657  XXXXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNIE 716
                                   + ++  +S M  DD+ +  SD +    T E FF NIE
Sbjct: 750  -----------RKDKKEKRRTKSTTVTETSSTMAIDDLEDEQSDRMS---TPEGFFGNIE 795

Query: 717  QLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISIL 776
             LRF Y +P++LEIW  SLN+IN+ SLKCSM+VL+KFL GPL++ALPH +PW YFIIS+ 
Sbjct: 796  TLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFLKGPLVVALPHFMPWTYFIISLA 855

Query: 777  LKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMN 836
             K + L HE S+ FW+  +  IFPWN I++FLNVL+ Y LDN      S++ D+      
Sbjct: 856  YKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAYMLDN---SWKSSLVDS------ 906

Query: 837  VFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLGIK 896
                 LC +YS+MG  DLL +FN NE LPEVWKCWGTLWFDTI NK     +  E++GIK
Sbjct: 907  -----LCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQSHVEDLESVGIK 961

Query: 897  DHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNN 956
            +HMFLD PIDGI +   DE+GENFWKR  RIIFLFKG+AENF  +G+ +S  A    R N
Sbjct: 962  NHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENF-PIGITLSPVAPVYCRRN 1020

Query: 957  NVPMDNILKMFSFKW-AGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNLNF 1015
            +V   +ILK FSFK   GS+++ V  N        T   ++ +   ++I E     N++ 
Sbjct: 1021 DVSPYHILKSFSFKLRRGSDSELVPMNPPQPST--TAIDLDHLKNTLEIFEEASWENIHM 1078

Query: 1016 EIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQ----LILAQ 1071
            +  P+ S+I  E IFDY GY++L P+  S+DKNGEF S S+YT+W  + +     +I A 
Sbjct: 1079 DTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYANNNTNNTGVIPAH 1138

Query: 1072 XXXXXXXATDEMTDLFTGTLSIDELS-FRQLKRPEF----------RDKSTLLSSTSTEP 1120
                     D   D      S+ E+  F Q+  P +          RD     + +ST  
Sbjct: 1139 GSD-----VDSQRD---AVQSVQEMHIFNQIMEPGYCGGFADDLFLRDALYQTAHSST-- 1188

Query: 1121 FNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTR 1180
                 TYFV D T+WLRHF HIYKLAS+ VLKFA+CLTTF ELRFLRK KD NVVEA+TR
Sbjct: 1189 -----TYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATR 1243

Query: 1181 AIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVK 1240
            AIIT+RQLYS+G LLPLRFTGNVAT IEEHLEFEE+ITWRSHVDEFVIEAV KAQ KF +
Sbjct: 1244 AIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQE 1303

Query: 1241 SKTVENMEGTSNWGEIDXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKGISTFGT 1300
                       N  +++              +  K+VVL+TDD +MR KAQ + + TF T
Sbjct: 1304 ----------MNQLQLEQEEQQHQLRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFST 1353

Query: 1301 QVVFSVCSMMGIDEGVCTN 1319
            + VFS+C+ +G+   +CTN
Sbjct: 1354 KFVFSLCNSIGLRSKICTN 1372

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 45/81 (55%), Gaps = 10/81 (12%)

Query: 51  NIRQKRHSSNSYSNAKNNPAVKRRIAKPEEV---SLKYIDNMEYGTATTGN-NSIICQQQ 106
           N R KR SSN+Y+    N  VKRR+   EE+     +++D     T+ TG  N  I    
Sbjct: 98  NPRLKRSSSNTYNYVSAN-FVKRRLPNQEEIFPQQSQFLD-----TSLTGAINQSISVPN 151

Query: 107 TPSKGTLSRRPSLIKKQMNST 127
           TPSK   SRRPSL KK ++++
Sbjct: 152 TPSKAPTSRRPSLPKKAIDTS 172

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score = 1124 bits (2908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/1045 (57%), Positives = 719/1045 (68%), Gaps = 106/1045 (10%)

Query: 297  GEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITT 356
               L+ KLQ+IYK+IVKQE+ELQ+RCSQLTTSQTT+LKNLW+IYK+N DLINNY+TFITT
Sbjct: 281  SRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITFITT 340

Query: 357  ALLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFI 416
            ALL SQS QD+ IG            LWVYGTITFLDVLKNFSNFMDPEVC QFITHVFI
Sbjct: 341  ALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFI 400

Query: 417  SLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKL 476
            SLSTML D+P K+SIPWLQRLGDLSRMAIALYPSGFIDWKLSAE WYMEAMKFTY+HGKL
Sbjct: 401  SLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKL 460

Query: 477  YYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERN-NGNNRNLQ 535
            YYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPSQQYMQLVIDNIYQR FV+RN NGN RN  
Sbjct: 461  YYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVRNSD 520

Query: 536  LIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTI 595
            LI+YLKHSEVMLLP+FLEN +LQQVVL YF ++FG+                 N+N    
Sbjct: 521  LIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGV---------------DYNDN---- 561

Query: 596  DMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXXX 655
            ++F ++DMF Q P  L+++FRHAPAFAESHILQLVGFG+PKNPFALLF+LP +LKER   
Sbjct: 562  NIFETQDMFFQVPASLRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDK 621

Query: 656  XXXXXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNI 715
                             + ++ + S MSID ++     +N     N  N VT  E+F NI
Sbjct: 622  KEKNK------------SKSSTEISTMSIDTNDSRGPILNTSAYVNEGNIVT--EYFDNI 667

Query: 716  EQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISI 775
            + LR     PN L +W+ SL H+N+ SLKCS+IVL+KFL GPLLIALPH+LPW YFII+ 
Sbjct: 668  DSLRLPIDHPNIL-VWLKSLEHLNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIAT 726

Query: 776  LLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDM 835
             LK +   +  S  FW  +++ I PWN + +FLNVLL Y LDN    T S          
Sbjct: 727  FLKAQSSKNTSSVKFWTIVMRRILPWNTLTSFLNVLLAYILDNF-YQTES---------- 775

Query: 836  NVFILDLCNKYSTM-GFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLG 894
               I  LC  YS    F +LL +FN NE+LPE+WKCWGTLWFD ISNK  ++AD+F  LG
Sbjct: 776  ---IAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLWFDVISNKRALNADTFNGLG 832

Query: 895  IKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYR 954
            I+DHMFLDFP+DGIG+   DETGENFW R LRI+FLFKGIAEN  + GL+VS  A    R
Sbjct: 833  IEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIAENLQT-GLRVSRTAPVHCR 891

Query: 955  NNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNLN 1014
             +++  ++ILK FSFK  G +              Y+    + I + + + E I ETNL+
Sbjct: 892  RDDIDPNHILKSFSFKMEGFDESS-----------YSGQPFSTINKLLPLFENIDETNLD 940

Query: 1015 FEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYD--------- 1065
            F+  P+ S++  E+IF+Y GYKKL  N+ SFD+NGE  S SIYTAW +D D         
Sbjct: 941  FDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDNDNSLNNSQGN 1000

Query: 1066 ------QLILAQXXXXXXXATD-EMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSS--- 1115
                  Q+   Q         + +M +  +   + D+ +F     PE  +K+   +S   
Sbjct: 1001 QYTSNMQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELYMNPEKLNKNMDQASIWT 1060

Query: 1116 TSTEPFNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVV 1175
            T+ +  NR  TYFVFDATSWLRHFAHIYKL++N+VL FAVCLTTFQELRFLRKSKD NVV
Sbjct: 1061 TANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFLRKSKDENVV 1120

Query: 1176 EASTRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQ 1235
             A+ RAIITMRQLYS+G LLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAV+KAQ
Sbjct: 1121 GAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVVKAQ 1180

Query: 1236 EKFVKS-KTVENMEGTSNWGEIDXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKG 1294
             KF+ + ++V   +G                        F +VVL+TDD +M+ KAQ +G
Sbjct: 1181 NKFISANESVTLRKG------------------------FNHVVLVTDDINMKRKAQEQG 1216

Query: 1295 ISTFGTQVVFSVCSMMGIDEGVCTN 1319
            I TF T  +FSVC  +GI + VCTN
Sbjct: 1217 IKTFTTHFIFSVCRKLGIQDNVCTN 1241

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/101 (47%), Positives = 64/101 (63%), Gaps = 10/101 (9%)

Query: 52  IRQKRHSSNSYSNAKNNPAVKRRIAKPEEVSLKYIDNMEYGTATTGNNSIICQQQTPSKG 111
           +RQKRH SNSY   KN    ++RIA+P++  L    N+ Y      +NSI+ +  TP K 
Sbjct: 44  LRQKRHGSNSYI-YKN----QKRIARPDDKILNANININY----IDHNSIVNENATPVKS 94

Query: 112 TLSRRPSLIKKQMNSTPQPMSYVVSEVPASPFYLPANSFSN 152
            LSRRPSL KK  N TPQP S++V+E P SPFY+   S++N
Sbjct: 95  VLSRRPSLSKKSNNVTPQP-SFLVTEPPKSPFYVTNQSYTN 134

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score = 1115 bits (2883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/1064 (55%), Positives = 700/1064 (65%), Gaps = 113/1064 (10%)

Query: 298  EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357
            +ALV+KLQDIYKVIVKQEIELQERCSQLTTSQTT+LKNLWTIYK+N DLINNY TFITTA
Sbjct: 289  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFITTA 348

Query: 358  LLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417
            LL SQ  QD+ IG            LWVYGTITFLDVLKNFSNFMDPEVC QFITHVFIS
Sbjct: 349  LLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFIS 408

Query: 418  LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477
            LS +L DIP K++IPWLQRLGDLSRMAIALYPSGFIDWKLSAE WYMEAMKFTY+HGKLY
Sbjct: 409  LSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 468

Query: 478  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNN-RNLQL 536
            YHMSTVQQNTLEAFVNLGKSVFCQ+TFTPSQQYMQLVIDNIYQR FV+RN G N RN  L
Sbjct: 469  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYRNPDL 528

Query: 537  IEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTID 596
            I+YLKHSEVMLLP+FL + +LQQVVL YFQ++FG              I+   NN     
Sbjct: 529  IDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFG--------------IDYSENN----- 569

Query: 597  MFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXXXX 656
            +F ++DMF Q P  L++FFRHAPAFAESHILQLVGFG+PKNPFALLFELPKYLKER    
Sbjct: 570  IFDTQDMFFQPPSCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKK 629

Query: 657  XXXXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNIE 716
                            A    D    + DN   G +D + L +      ++  E+  NIE
Sbjct: 630  EKNKSKSTSTADVSSTAPKTVDD--QATDNVNEGTNDDHELTA-----TLSGPEYLDNIE 682

Query: 717  QLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISIL 776
             L++    P+ +  W+ SL+ IN+ SLKCSMIVLKKFLHGPLLIALPH LPW  FII+  
Sbjct: 683  TLKYAIETPD-ICTWIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACG 741

Query: 777  LKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMN 836
            +K   L +E +  FW  ++K IFPW+ I +FLNVLL Y LDN G  T             
Sbjct: 742  IKVNELENEKNYKFWRILMKRIFPWDTITSFLNVLLAYVLDNYGNTT------------- 788

Query: 837  VFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLGIK 896
              I +LC +YS M   D+L HFN++EDLPEVWKCWGTLW+D I NKN +DAD+F   GI 
Sbjct: 789  -IIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWGTLWYDAICNKNSVDADTFAGFGIG 847

Query: 897  DHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNN 956
            DHMFLDFPIDGI +  EDETG  FWKR LR+IFLFKGI++ FD  GLK+S+ AG   RN 
Sbjct: 848  DHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFKGISKKFD-FGLKISHEAGVYCRNE 906

Query: 957  NVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNLNFE 1016
                D+ L+ F+FK                LE Y     ++  EF+ + E +   N +  
Sbjct: 907  KA-ADSPLRRFTFK----------------LESYDEPTSSKFNEFIPLCEEVSAINNDAL 949

Query: 1017 IPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQL--------- 1067
              P  S++  E+IF+Y GY+ L  +  SFDKNGE  S SIYT+W +D  +          
Sbjct: 950  ATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMIDTGEAAAAASSATD 1009

Query: 1068 -----------------ILAQXXXXXXXATDEMT----------DLFTGTLSIDELSFRQ 1100
                             I A         T  +T          DLF   +S+ +   R 
Sbjct: 1010 NNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPGLNENDLFKKFMSLGDPRDRN 1069

Query: 1101 LKRPEFRDKSTLLSS---TSTEPFNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCL 1157
            +       KS L+ +   +S +  +R KT+F+FDATSWLRHFAHIYK+A+N VLKF VCL
Sbjct: 1070 VYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKFGVCL 1129

Query: 1158 TTFQELRFLRKSKDANVVEASTRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQI 1217
            TTFQELRFLRKSKD NVVEA+ RAIITMRQLY +  LLPLRFTGNVA DIEEHLEFEEQI
Sbjct: 1130 TTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLLPLRFTGNVANDIEEHLEFEEQI 1189

Query: 1218 TWRSHVDEFVIEAVMKAQEKFVKSKTVEN--MEGTSNWGEIDXXXXXXXXXXXXKSNLFK 1275
            TWRSHVDEFVIEAVMKAQ+KF  +   +    EGT                       F 
Sbjct: 1190 TWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTG------------PPRVPLGGKRFH 1237

Query: 1276 YVVLITDDDSMRMKAQLKGISTFGTQVVFSVCSMMGIDEGVCTN 1319
            YV L+T+D +M+ KAQ +GI TF T  VFS+CS +G+   +CTN
Sbjct: 1238 YVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 42/102 (41%), Gaps = 17/102 (16%)

Query: 54  QKRHSSNSYSNAKNNPAVKRRIAKPEEVSLK---YIDNMEYGTATTGNNSIICQQQTPSK 110
           QKRH S SYS A  N   KRRIA  EE S +   Y DN+            + QQ TP +
Sbjct: 81  QKRHGSASYSFANANFPSKRRIANAEEDSKRISSYSDNL------------LLQQNTPRR 128

Query: 111 GTLSRRPSLIKKQMNSTPQPMSYVVSEVPASPFYLPANSFSN 152
                R S       S  +  S   S    SPF +   S +N
Sbjct: 129 SRDVARKSASGSA--SGCRSASGSGSAPQESPFCMEFTSLAN 168

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1107 bits (2862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/1023 (56%), Positives = 694/1023 (67%), Gaps = 112/1023 (10%)

Query: 297  GEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITT 356
             +ALV+KLQDIYKVIVKQEIELQERCSQLT SQTT+LK LW IYKVN DLINNYVTFITT
Sbjct: 237  SQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITT 296

Query: 357  ALLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFI 416
            ALL  QS QDL IG            LWVYGTITFLDVLKNFSNFMDPEVC QFITHVFI
Sbjct: 297  ALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFI 356

Query: 417  SLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKL 476
            S+S MLADIP++Y+IPW QRLGDLSRMAIALYPSGFIDWKLSAE WYMEAMK+ Y HGKL
Sbjct: 357  SISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKL 416

Query: 477  YYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQL 536
            YYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPSQQYMQLVIDNIYQRAFVERNNGN+RN QL
Sbjct: 417  YYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQL 476

Query: 537  IEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTID 596
            IEYLKHSEVMLLP+FLE+++LQQVVL+YF++KFG+              +T  NN     
Sbjct: 477  IEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGM--------------DTNENN----- 517

Query: 597  MFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXXXX 656
            +F +R MF QNP+QLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELP+ LK+R    
Sbjct: 518  IFDTRQMFDQNPDQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKK 577

Query: 657  XXXXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNIE 716
                            + T    S M+ID  E     I++ FS     Q    +FF NI+
Sbjct: 578  EKRKTKS---------SVTTETSSAMAIDEEEY----IDSSFSLGAQVQ----QFFDNID 620

Query: 717  QLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISIL 776
             L   Y  P SLE+W  SL ++N+ SL CSMIVLKKFL GP+++ALPHLLPW YFII+++
Sbjct: 621  SLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVV 680

Query: 777  LKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMN 836
             K + +T   S+ FW+ ++  IFPWN I+NFLNVL+ YTLDNI    P            
Sbjct: 681  SKVQHITDGASREFWLELVNRIFPWNTIVNFLNVLIAYTLDNIHPSLP------------ 728

Query: 837  VFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLGIK 896
              I  LC + STMG   L++HFN NEDLPEVWKCWG LWFD I +K+ +  DS+E+ GIK
Sbjct: 729  --IDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQMDSYESAGIK 786

Query: 897  DHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNN 956
            DHMFLD PIDGIG+  +DE+G  FWKR  R+IFLFK IAENF +  L VS  A    R  
Sbjct: 787  DHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQT-RLVVSSQAQVHCRRT 845

Query: 957  NVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNLNFE 1016
            + PM+++LK F FK   +   + ++N      +  NTI        ++ E   + N + +
Sbjct: 846  D-PMNHVLKSFCFKLRDT---FYNSN-----SVLQNTI--------EVFEEGSDANKDMQ 888

Query: 1017 IPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLILAQXXXXX 1076
            + P  S++ NE IF Y GYK+L  +   +D+ GEF S S+YT+W  +  +  + Q     
Sbjct: 889  MTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKNEIPQSEPTQ 948

Query: 1077 XXATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYKTYFVFDATSWL 1136
                +E  DLF   ++     F  +  PE +              N   T+FV DATSWL
Sbjct: 949  QQTANE-ADLFIEGINTSLTEF-NIDFPECK-------------MNGKDTFFVLDATSWL 993

Query: 1137 RHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLYSDGNLLP 1196
            RHFAH+YKLASN VL+FA+CLTTFQELRFLRKSKD NVVEA+TRA+IT+RQLY++  +LP
Sbjct: 994  RHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILP 1053

Query: 1197 LRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEGTSNWGEI 1256
            LRFTGNVAT IEEHLEFEEQITWRSHVDEFV EA+ KAQ +  +    EN +        
Sbjct: 1054 LRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQ----ENRD-------- 1101

Query: 1257 DXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFSVCSMMGIDEGV 1316
                             F +VVL+TDD +MR KAQ   I T  T+ VF+ C+ +G    +
Sbjct: 1102 -----------------FHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKI 1144

Query: 1317 CTN 1319
            CTN
Sbjct: 1145 CTN 1147

 Score = 56.2 bits (134), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 55/99 (55%), Gaps = 16/99 (16%)

Query: 53  RQKRHSSNSYSNAKNNPAVKRRIAKPEEVSLKYIDNMEYGTATTGNNSIICQQQTPSKGT 112
           RQKRHSSN Y++A++   VKRR+A  ++   +++DN                  TP K  
Sbjct: 45  RQKRHSSNPYNSAEST-GVKRRVANHDDGITQFLDNGAIPN-------------TPCKEP 90

Query: 113 LS-RRPSLIKKQMNSTPQPMSYVVSEVPASPF-YLPANS 149
           +S RRPS  ++ +N TP+  +  V++  ASP+ Y P NS
Sbjct: 91  VSSRRPSATRRTVNRTPRSTTSYVADASASPYCYSPNNS 129

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score = 1028 bits (2657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/1042 (53%), Positives = 674/1042 (64%), Gaps = 133/1042 (12%)

Query: 297  GEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITT 356
            G AL++KLQ++Y+VIVKQEIELQERCSQLT SQTT+LK+LWTIYK+N +L+NNYVTFITT
Sbjct: 253  GIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITT 312

Query: 357  ALLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFI 416
            ALL SQ   DL IG            LWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFI
Sbjct: 313  ALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFI 372

Query: 417  SLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKL 476
            SLSTM++DIP+KYSI WLQRLGDLSRMAIALYPS FIDWKLSAE WY EAMK+TYNHGKL
Sbjct: 373  SLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKL 432

Query: 477  YYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQL 536
            YYHMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN  L
Sbjct: 433  YYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLL 492

Query: 537  IEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTID 596
            IEYLKHSE MLLP+FLE+ +LQ VVL YF EKFGI                   +    +
Sbjct: 493  IEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGI-------------------DANGCN 533

Query: 597  MFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXXXX 656
            +F   DMFIQNP+  KYFFRH P+FA+SHILQ+VGFG+PKNPFA+LFELPKYLK      
Sbjct: 534  IFNCEDMFIQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLK------ 587

Query: 657  XXXXXXXXXXXXXXXXASTAGDGSMM--SIDNSEMGEDDINNLFSDNVMNQVTSE----- 709
                             ++  D S+   S  NS  G +D      D  M+  TS      
Sbjct: 588  -------ERKDKKERKKTSNNDSSVTESSTGNSRNGNED-----DDETMSSTTSMSDPDL 635

Query: 710  --EFFQNIEQLRFDYFIPNSL--EIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHL 765
              EFF +I+ LR    +P+ L  E W+ +L  +N+ SLKC MIVL+KFLHGPL +ALPH+
Sbjct: 636  LVEFFNDIDTLRRP-ILPSMLTNEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGVALPHV 694

Query: 766  LPWCYFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPS 825
            LPW YFIISI LK   L    SK FWI I+K +FPW+ ++ F+NVL+ Y LDN       
Sbjct: 695  LPWIYFIISICLKSNQLNDPISKEFWIVIIKRMFPWDTMVTFMNVLIAYLLDN------- 747

Query: 826  AVNDTKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGM 885
                   +  N  I DLCN+YS +  ++LL  FNENEDLPE+W CWGTLWFD I  KN  
Sbjct: 748  -------ETSNSIIGDLCNEYSKLNLSELLNSFNENEDLPEIWGCWGTLWFDAICQKNTH 800

Query: 886  ---DADSFENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLG 942
                 D+F+ +GI+D+M LD P DGI +  +DE GE FWKR  RIIFLF+ ++ +F  LG
Sbjct: 801  SISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFLFREVSRSF-PLG 859

Query: 943  LKVSYNAGTEYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNT-----IINR 997
            + V ++       +++  +NIL+   +K                LE  TN      +++ 
Sbjct: 860  VIVRHDPLVNC--SSLQSNNILRDLVYK----------------LEPLTNIRSSVPVLST 901

Query: 998  ITEFVDIKEPIHETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIY 1057
            +    DI E   E N +    P  S+I  ++IF Y GYKKL P+   FDKNGEF S S+Y
Sbjct: 902  LESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLY 961

Query: 1058 TAWPMDYDQLILAQXXXXXXXATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTS 1117
            T+W +      L           +E   L        E+++     PE   K+       
Sbjct: 962  TSWYVPNCNNNLETNISYANERENEALFLECMKSVHPEIAY-----PEIDFKT------- 1009

Query: 1118 TEPFNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEA 1177
                    TYFVFDATSWLRH A I+KLA N +L+FA+CLTTFQELRFLRKSKD NV+EA
Sbjct: 1010 --------TYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEA 1061

Query: 1178 STRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEK 1237
            +TR IIT+RQLY +  +LPLRFTGNVAT IEE+LEFEEQITWR+HVDEFVIE++MKAQEK
Sbjct: 1062 ATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEK 1121

Query: 1238 FVKSKTVENMEGTSNWGEIDXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKGIST 1297
               +K                            S+ F YVVLI+DDD+M+ KA+ K I T
Sbjct: 1122 LENAK-----------------------QPNISSHRFNYVVLISDDDTMKKKAEEKKIRT 1158

Query: 1298 FGTQVVFSVCSMMGIDEGVCTN 1319
              T+ VFS+C+ +G    +CT+
Sbjct: 1159 LSTRFVFSLCTKLGEQRHLCTD 1180

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score = 1014 bits (2623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/1024 (51%), Positives = 688/1024 (67%), Gaps = 98/1024 (9%)

Query: 298  EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357
            +ALV+KLQDIYK IV+QE+ELQE+C+QLT+SQTTDL ++W+IY++N++L+ NYVTFI+TA
Sbjct: 368  QALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFISTA 427

Query: 358  LLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417
            LLSSQSQ DL IG            LWVYGTITFLDVLKNFS+FMDPEVC QFITHVFIS
Sbjct: 428  LLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFIS 487

Query: 418  LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477
            +STMLADIPTKYSIPW+QRLGDLSRMAIALYPSGFIDWKLS+E WY +A+K+TY +GKLY
Sbjct: 488  ISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKYTYGYGKLY 547

Query: 478  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQLI 537
            YHMST+QQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAF+ER + N RN QLI
Sbjct: 548  YHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNSQLI 607

Query: 538  EYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTIDM 597
            EYLKHSEVMLLP F+ N  LQ+VV+ YF+ KFG                    +   +++
Sbjct: 608  EYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGT-------------------DLHDLNI 648

Query: 598  FRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXXXXX 657
            F+ RD+F+QNPE LKYFFRHAPAFAESHILQ VGFGD KNPFALLF+LPK+LK       
Sbjct: 649  FQPRDIFLQNPENLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLK------- 701

Query: 658  XXXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNIEQ 717
                                + S+MS+D          N+ +D++   ++S+++F N+E 
Sbjct: 702  -EKKDKKDRKKTKSSGEPTSNESVMSLD----------NISTDSL---ISSDQYFSNLES 747

Query: 718  LRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISILL 777
            ++  Y  P   +IW+ SL+++NL +++C +IVL+KFLHGP ++ALPHL+ W YFIIS+ L
Sbjct: 748  MQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCL 807

Query: 778  KREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMNV 837
            K E L  E+S+ FW   ++ + P N I++FLNVL+ Y LDN    T              
Sbjct: 808  KSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIAYALDNSYYST-------------- 853

Query: 838  FILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLGIKD 897
             I  +  +  +M   +LL  FN NE+LPEVWKCWGTLWFD I++K+  D +S+E +G+ D
Sbjct: 854  LISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSNTDTNSYEKIGVSD 913

Query: 898  HMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNNN 957
            H+F D PIDGI +  +DE GE FWKR LRIIFLFK IAE FD +G+ +S+ A    R ++
Sbjct: 914  HLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFD-IGITLSHTAPVYCRRDD 972

Query: 958  VPMDNILKMFSFKWAGSNADYVDANL--GDELEIYTNTIINRITEFVDIKEPIHETNLNF 1015
            V +++IL  FSFK        ++ +L  G+ +++    I N +   +++ E  +E N+  
Sbjct: 973  VELNHILGSFSFK--------IEQHLLNGNTVQV---EIENCLGAIIEMTEMPNEVNITM 1021

Query: 1016 EIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLILAQXXXX 1075
            +  P  S+  NE+IF+YTGYK++ P  ++FDKNGE  S + YT+W    + +  +     
Sbjct: 1022 DATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPKSAASPE 1081

Query: 1076 XXXATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYKTYFVFDATSW 1135
               A       F  +  ++E  F      E    S L      +  N   T FV DATSW
Sbjct: 1082 NSVAGSSPGRSFQ-SQDVEENIFSVFTNEEENSTSLL------DGLNLETTSFVLDATSW 1134

Query: 1136 LRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLYSDGNLL 1195
            LRH AHIYKLASN  L F++CLTTFQELRFLRKSKD NV+EA+ RAII +RQLYSDG ++
Sbjct: 1135 LRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEAAARAIIIIRQLYSDGKVI 1194

Query: 1196 PLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEGTSNWGE 1255
            PLRFTGN+AT IEEHLEFEEQITWRSHVDEFVIE++ KAQ+KF++      ++  S    
Sbjct: 1195 PLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQPFVQNPVDNDS---- 1250

Query: 1256 IDXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFSVCSMMGIDEG 1315
                               ++ VL++DD++M+ KA  K I TF T+ VF++CS MG    
Sbjct: 1251 -------------------RFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRL 1291

Query: 1316 VCTN 1319
            +CTN
Sbjct: 1292 ICTN 1295

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score = 1014 bits (2622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/1031 (52%), Positives = 681/1031 (66%), Gaps = 104/1031 (10%)

Query: 297  GEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITT 356
             +ALV+KLQDIYK+I+KQE+ELQERCSQLT SQTT++KNLW IYK+N DLINNYVTFITT
Sbjct: 315  SQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITT 374

Query: 357  ALLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFI 416
            AL  SQS+ DL IG            LWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFI
Sbjct: 375  ALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFI 434

Query: 417  SLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKL 476
            S+S+ML DIP KY+IPWLQ+LGDLSRMA+AL+PSGFIDWKLSAE WYM AM+++Y +GKL
Sbjct: 435  SISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKL 494

Query: 477  YYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERN-NGNNRNLQ 535
            YYHMSTVQQNTLEAFVNLGKSVFCQ TF PSQQY+QLVIDNIYQRAF +RN + N+RN Q
Sbjct: 495  YYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQ 554

Query: 536  -LIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRT 594
             L++YLKHSEVMLLP F+E+ +LQQVVLLYF EKFGI                 NNN   
Sbjct: 555  LLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGI---------------DYNNN--N 597

Query: 595  IDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXX 654
            + MF+ R MFIQN +QLK++FRHA AFAE+ ILQLVG+G+PKNPFALLF LPKYLKER  
Sbjct: 598  VKMFQPRQMFIQNNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRD 657

Query: 655  XXXXXXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQN 714
                               + +    M  + N E       N+F       + SE+FF N
Sbjct: 658  KKEKRKPKNQIVGEDGSSTTFSSVSGMEYMVNMET------NVF-------LGSEDFFNN 704

Query: 715  IEQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIIS 774
            I++L  + F+PNS+ +W  SL + N  + KCSMIVL+KFL+GPL++ALPH+LPW YF+IS
Sbjct: 705  IDKLAINNFMPNSISLWNDSLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLIS 764

Query: 775  ILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKD 834
            I L+ E         FW   +K IFPWN ++ FLNVLL Y +DN    +P          
Sbjct: 765  IALQIEKYQDTAMMEFWYAFIKRIFPWNSMVRFLNVLLAYMIDNCWDNSP---------- 814

Query: 835  MNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNK-NGMDADSFENL 893
                + +LC++Y ++   +LL++FN NEDLPEVWKC G+LWFD I  K N  + DS+   
Sbjct: 815  ----LNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWFDIIDEKRNSQNCDSYTEC 870

Query: 894  GIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLG-LKVSYNAGTE 952
            GIKD+ FLDFP+DGI +   DE G  FWKR++R+IFLF+GI E F+  G L +SYNA   
Sbjct: 871  GIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIVERFNGFGNLAISYNAPVI 930

Query: 953  YRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETN 1012
             R   + +++ L  +SFK    + D +     D L          ++ F    E I   N
Sbjct: 931  NR-RGLGVNSHLVGYSFKLMAKSDDIM---FDDML----------VSNF----EEIDSNN 972

Query: 1013 LNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLILAQX 1072
             +F   PL SMI  E+IF+Y GYK++  +  SFDKNG+  S S Y  W ++ D  +    
Sbjct: 973  SDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTWSINQDTGVNGGP 1032

Query: 1073 XXXXXXATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRY-------K 1125
                  +++  +   +  ++  EL F +   PE+       +    +   R         
Sbjct: 1033 LSNNSSSSNAAS---SDPMNEKEL-FNKCFDPEYDSVDEFWNKEIYDDIGRKFGMELYED 1088

Query: 1126 TYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITM 1185
            TYF+ DATSWLRHFAH+YK+A+N +LKF++CLTTFQELRFLRKSKD NVVEA+TRAIIT+
Sbjct: 1089 TYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEAATRAIITL 1148

Query: 1186 RQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVE 1245
            RQL+S+G LLPLRFTGNVAT IEEHLEFEEQITWRSHVDEFVIEAV+KA+ K  K + + 
Sbjct: 1149 RQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETK-RKEQEMH 1207

Query: 1246 NMEGTSNWGEIDXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFS 1305
            NM+G                           +VL+TDD +M+ KA  KG  TF T+ VF+
Sbjct: 1208 NMKGFQ-------------------------IVLVTDDSNMKNKALEKGSKTFSTRFVFA 1242

Query: 1306 VCSMM-GIDEG 1315
            + + +  IDE 
Sbjct: 1243 ISNYLRTIDES 1253

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 56/108 (51%), Gaps = 13/108 (12%)

Query: 50  ENIRQKRHSSNSYSNAKNNPAVKRRIAKPE--EVSLKYIDNMEYGTATTGNNSIICQQQT 107
           +N+ QKRH S+SY    N   +K+R+AK      +  ++D+   G     N + +  Q T
Sbjct: 61  KNLGQKRHGSSSYYITPN--YIKKRVAKNSYNSATGNFLDSGSNGGGDISNQTSL--QNT 116

Query: 108 PSKGTLSRRPSLIKKQM---NSTPQPMSYVVSEVPASPFYLPANSFSN 152
           P     S +PS+ K  +   ++TPQP +Y+  +   SPF L +N  SN
Sbjct: 117 P---LASPKPSIAKNNIINTSTTPQP-TYITQDSMTSPFVLNSNLPSN 160

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score = 1007 bits (2603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/1038 (53%), Positives = 670/1038 (64%), Gaps = 134/1038 (12%)

Query: 299  ALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTAL 358
            AL++KLQ++YKVIVKQEIELQERCSQLT SQTT+LK+LWTIY++N +LINNYVTFITTAL
Sbjct: 268  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTFITTAL 327

Query: 359  LSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISL 418
            L SQ   DL IG            LWVYGTITFLDVLKNFSNFMDPEVCCQFITHVF+SL
Sbjct: 328  LPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 387

Query: 419  STMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLYY 478
            STM++DIP+KYSI WLQRLGDLSRMAIALYPS FIDWKLSAE WY EAMK+ YNHGKLYY
Sbjct: 388  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 447

Query: 479  HMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQLIE 538
            HMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN  LIE
Sbjct: 448  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 507

Query: 539  YLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTIDMF 598
            YLKHSE MLLP+FLE+ +LQ VV+ YF EKFGI                   +    ++F
Sbjct: 508  YLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGI-------------------DANGCNIF 548

Query: 599  RSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXXXXXX 658
               DMFIQNP+  KYFFRHAP+FA+SHILQ+VGFG+PKNPFA+LFELPKYLKE       
Sbjct: 549  NPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLKE------- 601

Query: 659  XXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTS-------EEF 711
                           S+  D    S+  S  G    +N   D +M+   S        EF
Sbjct: 602  ------RKDKKERKKSSNNDS---SVTESSTGNSRNDNNDDDEIMSSTASISDHDFLAEF 652

Query: 712  FQNIEQLRFDYFIPNSL--EIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWC 769
            F +I+ LR    +P+ L  E W+ +L  +N+ SLKC MIVL+KFLHGPL IALPH+LPW 
Sbjct: 653  FNDIDTLRRP-ILPSMLTSEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWI 711

Query: 770  YFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVND 829
            YFII+  LK   L+   SK FW+ I+K +FPW+ I+ F+NVL+ Y LDN  L        
Sbjct: 712  YFIIATCLKSNQLSDPTSKDFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEAL-------- 763

Query: 830  TKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDA-- 887
                  N  I +LC+KY T+  A LL+ FNE+E+LPE+W CWGTLWFDTI  KN      
Sbjct: 764  ------NPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWGTLWFDTICQKNAHSISS 817

Query: 888  -DSFENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVS 946
             D+F+ +GIKD+M LD P DGI +  +DE+GE FWKR  RIIFLF+ ++  F  +G+ VS
Sbjct: 818  DDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFLFRELSRTF-PIGVIVS 876

Query: 947  YNAGTEYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELE----IYTNT-IINRITEF 1001
                      N P+         K + S +  +  NL  +LE    I +NT I+  +   
Sbjct: 877  ----------NDPL--------IKCSSSQSSIILRNLVYKLEPLSNIRSNTPILTALENS 918

Query: 1002 VDIKEPIHETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWP 1061
            VDI E   + N++    P  S+ + ++IF YTGYKKL P+   FD+NGEF S S+YT W 
Sbjct: 919  VDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYTRWY 978

Query: 1062 MDYDQLILAQXXXXXXXATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPF 1121
            +     I            DE  DLF   +  D                           
Sbjct: 979  LPNGNNISEALVNSDIEKGDE--DLFLECMKPD-----------------------CPGI 1013

Query: 1122 NRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRA 1181
            +   TYFVFDATSWLRH A I+KLA N +LKFA+CLTTFQELRFLRKSKD NV+EA+TR 
Sbjct: 1014 DFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRG 1073

Query: 1182 IITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKS 1241
            IIT+RQLY +  +LPLRFTGNVAT IEE+LEFEEQITWR+HVDEFVIE++ KAQEK   +
Sbjct: 1074 IITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENA 1133

Query: 1242 KTVENMEGTSNWGEIDXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQ 1301
                     SN                       YVVLI+DDD+M+ KA+ K I T  T+
Sbjct: 1134 GQPHVTPRHSN-----------------------YVVLISDDDTMKKKAEEKEIKTLSTK 1170

Query: 1302 VVFSVCSMMGIDEGVCTN 1319
             VFS+C+ +G    +CT+
Sbjct: 1171 FVFSLCTKLGEKRHLCTD 1188

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score = 1004 bits (2597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/1034 (53%), Positives = 670/1034 (64%), Gaps = 126/1034 (12%)

Query: 299  ALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTAL 358
            AL++KLQ++YKVIVKQEIELQERCSQLT SQTT+LK+LWTIY++N +L+NNYVTFITTAL
Sbjct: 267  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTAL 326

Query: 359  LSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISL 418
            L SQ Q DL IG            LWVYGTITFLDVLKNFSNFMDPEVCCQFITHVF+SL
Sbjct: 327  LPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 386

Query: 419  STMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLYY 478
            STM++DIP+KYSI WLQRLGDLSRMAIALYPS FIDWKLSAE WY EAMK+ YNHGKLYY
Sbjct: 387  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYY 446

Query: 479  HMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQLIE 538
            HMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN  LIE
Sbjct: 447  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 506

Query: 539  YLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTIDMF 598
            YLKHSE MLLP+FLE+ +LQ VVL YF EKFGI                   +    ++F
Sbjct: 507  YLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGI-------------------DANGCNIF 547

Query: 599  RSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXXXXXX 658
               DMFIQNP+  KYFFRHAP+FA+SHILQ+VGFG+PKNPFA+LFELPK+LK        
Sbjct: 548  NPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLK-------- 599

Query: 659  XXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTS-------EEF 711
                          +S        S  ++   E+D N    D +M+  TS        EF
Sbjct: 600  ----ERKDKKERKKSSNNESSITESSTSNSRNENDDN----DEIMSSTTSISERDSLIEF 651

Query: 712  FQNIEQLRFDYFIPNSL---EIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPW 768
            F +I+ LR    I +S+   E W+ SL  +N+ SLKC MIVL+KFLHGPL IALPH LPW
Sbjct: 652  FNDIDTLRRP--IVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPW 709

Query: 769  CYFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVN 828
             YFIISI LK   L+   SK FWI I+K IFPW+ ++ F+N+L+   LDN  + +P    
Sbjct: 710  IYFIISICLKSSQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDN-EMTSP---- 764

Query: 829  DTKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNG---M 885
                      I  LC++YS +  A+LL  F E E+LPE+W CWGTLWFDTI  KN     
Sbjct: 765  ---------IIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGTLWFDTICQKNTNSIS 815

Query: 886  DADSFENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKV 945
              D FE +GIKD+M LD PIDGI + + DE GE FWKR  R IFLF+ ++ +F    + V
Sbjct: 816  SDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLFRELSRSFQ---IGV 872

Query: 946  SYNAGTEYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIK 1005
              N  +    +++  +NIL   S+K          + LG  +       +N +   +D+ 
Sbjct: 873  IINNESSINRSSLQSNNILGNLSYKLEPL------STLGSSI-----PTLNTLEGIIDVF 921

Query: 1006 EPIHETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYD 1065
            E   E N++    P  S+I    IF+YTGYKKL PN   FDKNGEF S S+YT+W     
Sbjct: 922  ETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSW----- 976

Query: 1066 QLILAQXXXXXXXATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYK 1125
                         + +  T++ +     +E  F +  + + R+             +   
Sbjct: 977  --------YVPNGSNNPETNINSNCEKENEGQFLECLKSDDRE------------IDLNT 1016

Query: 1126 TYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITM 1185
            TYFVFDATSWLRH A I+KLA N +LKFA+CLTTFQELRFLRKSKD NV+EA+TR IIT+
Sbjct: 1017 TYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITI 1076

Query: 1186 RQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVE 1245
            RQLY +  +LPLRFTGNVAT IEE+LEFEEQITWR+HVDEFVIE++MKAQEK   +  + 
Sbjct: 1077 RQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLP 1136

Query: 1246 NMEGTSNWGEIDXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFS 1305
                                     S  F YV+LI+DDD+M+ KA+ K I T  T+ VFS
Sbjct: 1137 -----------------------VSSCRFNYVILISDDDTMKKKAEEKKIKTLSTRFVFS 1173

Query: 1306 VCSMMGIDEGVCTN 1319
            +C+ +G    +CT+
Sbjct: 1174 LCTKLGEQRHLCTD 1187

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score =  984 bits (2543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/1046 (50%), Positives = 680/1046 (65%), Gaps = 115/1046 (10%)

Query: 297  GEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITT 356
             +ALV+KLQDIY+ IVKQEIELQERCSQLT SQTTD+KNLW IYKVN +LINNY++FITT
Sbjct: 243  SQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFITT 302

Query: 357  ALLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFI 416
            ALL SQ +QDL IG            LWVYGTITFLDVLKNFSNFMDPEVCCQFI+HVF+
Sbjct: 303  ALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHVFM 362

Query: 417  SLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKL 476
            S+S ML D+P +YSIPWL+RLGDLSRMAIALYPSGFIDWKLSAE WY +A+ +TY HGKL
Sbjct: 363  SISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHGKL 422

Query: 477  YYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQL 536
            YYHMSTVQQNTLEAFVNLGKSVFCQ+TF PSQQYMQLVIDNIYQRAF ER+ G++RN  +
Sbjct: 423  YYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRNFPI 482

Query: 537  IEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTID 596
            +EYLKHSEVMLLP+FLE+ ELQ+VVL +FQ++FG+                  NN   +D
Sbjct: 483  VEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWP----------------NN---VD 523

Query: 597  MFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXXXX 656
             F  + +FIQ+ E+L+YFF HAPAFAESHILQLVGFGDP+NPFA+LFELPK+LKER    
Sbjct: 524  FFDHKQIFIQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAILFELPKFLKERKERK 583

Query: 657  XXXXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNIE 716
                                                   NL   N  + ++ + +F+NI+
Sbjct: 584  ERRRSKSSPPLP--------------------------TNLDDGNGSSSISVDHYFENID 617

Query: 717  QLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISIL 776
              R  Y  P  ++IW  SL+++NL S++CSM VLKKFLH PLL ALPHLLPW +F++S+ 
Sbjct: 618  SHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFLHAPLLTALPHLLPWAHFLVSVA 677

Query: 777  LKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMN 836
            ++   L+ +  K FW+  ++ IFPWN +++FLN L+ + LDN              ++M+
Sbjct: 678  IRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDN-------------SRNMS 724

Query: 837  VFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLGIK 896
              +  LC +Y+ M    L++HF  +E+LPEVWKCWGTLWFDTISNK+ + A S ++ GI+
Sbjct: 725  S-VEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASSVQSTGIR 783

Query: 897  DHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNN 956
            DH+FLD PIDGI +  +DE+G  FWKR  R+IF+FKG+A+ F   G++VS    +  R+ 
Sbjct: 784  DHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEF-HYGIRVSDTPISTRRD- 841

Query: 957  NVPMDNILKMFSFKWAGSNADYVDANLGDEL-EIYTNTIINRITEFVDIKEPIHETNLNF 1015
             V   + LK FSFK+             +EL + + N +  +   F+ + EPI   N NF
Sbjct: 842  -VTTLHALKRFSFKF-------------EELPQEWDNEVFLQSDNFIKVFEPISPINSNF 887

Query: 1016 EIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGE------FSSGSIYTAWPMDYDQLIL 1069
            E  P  SMI  E IF++ GY+++ P+   F+KNG+      ++SG +        D   +
Sbjct: 888  EAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNV 947

Query: 1070 AQXXX--XXXXATDEMTDLFTGT--------------LSIDELSFRQLKRPEFRDKSTLL 1113
             +         A +   D    T              + +D      L+   F       
Sbjct: 948  KRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLAC 1007

Query: 1114 SSTSTEPFNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDAN 1173
            ++ S        TYFV DATSWLRHFAH+YKLA+N+VLKFA+CLTTFQELRFLRKSKD +
Sbjct: 1008 NADSN------VTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDES 1061

Query: 1174 VVEASTRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMK 1233
            VVEA+TRA+IT RQLY +  LLPLRFTGN+AT +EEHLEFEEQITWRSHVDEFVIEAV K
Sbjct: 1062 VVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYK 1121

Query: 1234 AQEKFVKSKTVENMEGTSNWGEIDXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLK 1293
            +Q KF K   ++  +    +   D              + F +VVL+TDD +MR KA+  
Sbjct: 1122 SQRKF-KGLNLQARDQGQEYIPTD----------PKDDDKFNFVVLVTDDLNMRTKAEAH 1170

Query: 1294 GISTFGTQVVFSVCSMMGIDEGVCTN 1319
             I  F ++ +F+ C+ +G ++ VC N
Sbjct: 1171 DIHIFSSRFMFAFCNQLGYNQKVCIN 1196

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 53/111 (47%), Gaps = 11/111 (9%)

Query: 52  IRQKRHSSNSYSNAKNNPAVKRRIAKPEEVSLKYIDNMEYGTATTGNNSIICQQQTPSKG 111
           + QKRH+SNSY    +  A +R    P  +S     N E   +       +    TPSK 
Sbjct: 30  LHQKRHNSNSYDYYDSGYAKRR----PNTLSQNVSQNDELAASAA---CFLDSNLTPSKH 82

Query: 112 TLSRRPSLIKKQMNSTPQPMSYVVSEVPASPFYLPANSFSNNYERSPALLT 162
                PS  ++  + TPQP  +  ++ P SPFYLP  S S+N E +  ++T
Sbjct: 83  QECT-PSSFQRATDETPQP--FYPADTPQSPFYLPTTS-SSNLEAASKVIT 129

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  984 bits (2543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/1038 (53%), Positives = 664/1038 (63%), Gaps = 129/1038 (12%)

Query: 297  GEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITT 356
            G AL++KLQ++YKVIVKQEIELQERCSQLT SQTT+LK+LWTIYK+N DL+NNYVTFITT
Sbjct: 272  GIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITT 331

Query: 357  ALLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFI 416
            ALL SQ   DL IG            LWVYGTITFLDVLKNFSNFMDPEVCCQFITHVF+
Sbjct: 332  ALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFV 391

Query: 417  SLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKL 476
            SLSTM++DIP+KYSI WLQRLGDLSRMAIALYPS FIDWKLSAE WY EAMK+ YNHGKL
Sbjct: 392  SLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKL 451

Query: 477  YYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQL 536
            YYHMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN  L
Sbjct: 452  YYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLL 511

Query: 537  IEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTID 596
            IEYLKHSE MLLP+FLE+ +LQ VVL YF EKFGI                   +    +
Sbjct: 512  IEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGI-------------------DANGCN 552

Query: 597  MFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXXXX 656
            +F + DMF+QNP+  KYFFRH P+FA+SHILQ+VGFG+PKNPFA+LFELPKYLK      
Sbjct: 553  IFNAEDMFVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLK------ 606

Query: 657  XXXXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTS-------E 709
                             S+  D    S+  S  G    +N   D +M+  TS        
Sbjct: 607  -------ERKDKKERKKSSNNDS---SVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLA 656

Query: 710  EFFQNIEQLRFDYFIPNSL--EIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLP 767
            EFF +I+ LR    +P+ L  E W+ +L  +N+ SLKC +IVL+KFLHGPL IALPH+LP
Sbjct: 657  EFFNDIDTLRRP-ILPSMLTNEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILP 715

Query: 768  WCYFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAV 827
            W YFIISI LK   L+   SK FW+ I+K  FPW+ ++ F+NVL+ Y LDN         
Sbjct: 716  WIYFIISICLKSSQLSDPVSKEFWMIIVKRAFPWDTMVTFMNVLIVYLLDN--------- 766

Query: 828  NDTKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGM-- 885
                 +  N  I DLC+ Y  +  ++LL+ FNE E+LPE+  CWGTLWFDTI  KN    
Sbjct: 767  -----QTSNSIIGDLCDDYDKLSLSELLELFNEGEELPEILGCWGTLWFDTICEKNTHSI 821

Query: 886  -DADSFENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLK 944
               D+F+ +GIKD+M LD P DGI +  +DE GE FWKR  R IFLF+ ++ +F  +G+ 
Sbjct: 822  SSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFLFRELSRSF-PIGVI 880

Query: 945  VSYNAGTEYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNT-IINRITEFVD 1003
            +  N    YR ++    NIL    FK            L     I+ N  ++  +   +D
Sbjct: 881  IR-NDPLIYR-SSFQNTNILGSLVFK------------LEPLCNIHNNIPVLGALESIID 926

Query: 1004 IKEPIHETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAW--P 1061
            I E   E N +    P  S+   ++IF Y GYKKL  +   FDKNGEF S S+YT W  P
Sbjct: 927  ISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTTWYVP 986

Query: 1062 MDYDQLILAQXXXXXXXATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPF 1121
               +  I          +  E   LF   +  D         PE   K+           
Sbjct: 987  NSNNTNI---EDNINYNSEKENEGLFLECIKSD--------YPEIDFKT----------- 1024

Query: 1122 NRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRA 1181
                TYFVFDATSWLRH A I+KLA N +L+FA+CLTTFQELRFLRKSKD NV+EA+TR 
Sbjct: 1025 ----TYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRG 1080

Query: 1182 IITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKS 1241
            IIT+RQLY +  +LPLRFTGNVAT IEE+LEFEEQITWR+HVDEFVIE+VMKAQEK    
Sbjct: 1081 IITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEK---- 1136

Query: 1242 KTVENMEGTSNWGEIDXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQ 1301
                 +E  S                      F YVVLI+DDD+M+ KA+ K I T  T+
Sbjct: 1137 -----LESASE--------------PRLSPRRFNYVVLISDDDAMKKKAEEKEIKTLSTR 1177

Query: 1302 VVFSVCSMMGIDEGVCTN 1319
             VFS+C+ +G    +CT+
Sbjct: 1178 FVFSLCTKLGEQRHLCTD 1195

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score =  968 bits (2502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/1040 (51%), Positives = 674/1040 (64%), Gaps = 121/1040 (11%)

Query: 298  EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357
            +ALV+KLQDIY+ IVKQE+ELQERC+QLTTSQTTDLKNLW IYK+NI+LINNYV FITTA
Sbjct: 242  QALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTA 301

Query: 358  LLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417
            LL SQ +QDL IG            LWV+GTITFLDVLKNFSNFMDPEVCCQFITHVFIS
Sbjct: 302  LLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 361

Query: 418  LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477
            +STML D+P K+S PW +RLGDLSRMAIALYPSGFIDWKLSAE WY +A+   + HGKLY
Sbjct: 362  ISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLY 421

Query: 478  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQLI 537
            YHMSTVQQNTLEAFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN GN+RN  ++
Sbjct: 422  YHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMV 481

Query: 538  EYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTIDM 597
            EYLKHSEVMLL +FLE+ ELQ+VVL +FQ KFG+      STS T             D 
Sbjct: 482  EYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGV------STSNT-------------DF 522

Query: 598  FRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXXXXX 657
            F  RDMF+Q+ E++KYFFRHAPAFAESHILQ VGFGDPKNPFALLFELPK+LKE      
Sbjct: 523  FNPRDMFLQDGERVKYFFRHAPAFAESHILQTVGFGDPKNPFALLFELPKFLKE------ 576

Query: 658  XXXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNIEQ 717
                             +    S  SI+ +                + ++  E+ +N++ 
Sbjct: 577  --------RKERKERRKSKSSHSFTSIETT----------------SHLSPSEYLENVDS 612

Query: 718  LRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISILL 777
             R+ Y  P  L IW  SL+HIN+ S +CS IV +KFL GPL++A+ H+LPW YF++S+ L
Sbjct: 613  PRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLVVAVTHMLPWSYFLLSLAL 672

Query: 778  KREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMNV 837
            K + L   + K FWI +++ IFPWN I++FLN+L+ + LDN    +P             
Sbjct: 673  KIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNNWKTSP------------- 719

Query: 838  FILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNK-NGMDADSFENLGIK 896
             I  LC +  ++    L++HF+E+EDLPE+W+CWG LWFD I++K NG D D   N G K
Sbjct: 720  -IDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVI-NSGSK 777

Query: 897  DHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNN 956
            DH F D P DGI +  +DE GE FWKR  R+IF+FKGIA+ F SLGL +S  A    R  
Sbjct: 778  DHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEF-SLGLTLSAFAPQSRR-- 834

Query: 957  NVPM--DNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNLN 1014
              PM   + L+ FSF     N + + A    +++ +   + N+I  F    E I   NL+
Sbjct: 835  --PMTAGHPLQNFSF-----NFEEIPAQ--SQIQSF---VRNQIPLF----EEIATGNLD 878

Query: 1015 FEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLILAQXXX 1074
              I P +SM+  E IFD+ GY+++  +   F+K+G   S S+YT+  ++   +       
Sbjct: 879  PNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFN 938

Query: 1075 XXXXATDEMTDLFTGTLSIDELSFRQLKR--------PEFRDKSTLLSSTSTEPFNRYK- 1125
                   E ++       I EL   +L+R        PEF +++  +      PF     
Sbjct: 939  TERYGRSEDSNK-PENAQITEL--ERLERDWLDNCMNPEFIEQAYEMKF----PFGDLSC 991

Query: 1126 ------TYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEAST 1179
                  +YFV DATSWLRHFAH++KLA+N+VL+F +CLTTFQELRFLRKSKD +VVEA+T
Sbjct: 992  NCDSGVSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAAT 1051

Query: 1180 RAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFV 1239
            RA+IT+RQLYSD  LLPLRFTGNVAT +EEHLEFEEQITWRSHVDEFVIEAV KAQ+KF 
Sbjct: 1052 RAVITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFE 1111

Query: 1240 KSKTVENMEGTSNWGEIDXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKGISTFG 1299
                     G       D                F +V L++DD +MR+KA  + I TF 
Sbjct: 1112 AINAQAKEAGHDFIATTDEEP-------------FHFVALVSDDTNMRVKAHTQRIQTFS 1158

Query: 1300 TQVVFSVCSMMGIDEGVCTN 1319
            T+ +F+VC+ +G+    CTN
Sbjct: 1159 TRFMFAVCNQIGLAHQACTN 1178

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score =  952 bits (2460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1039 (49%), Positives = 664/1039 (63%), Gaps = 119/1039 (11%)

Query: 298  EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357
            +ALV+KLQDIY+ IVKQE+ELQERCSQLT SQTTDLKNLW IYKVN +LINNYV FITTA
Sbjct: 212  QALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFITTA 271

Query: 358  LLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417
            LL SQ +QDL IG            LWV+GTITFLDVLKNFSNFMDPEVCCQFITHVFIS
Sbjct: 272  LLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 331

Query: 418  LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477
            +S ML D+P K++ PWL+RLGDLSRMAIALYPSGFIDWKLSAE WY +A+   + HGKLY
Sbjct: 332  ISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHGKLY 391

Query: 478  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQLI 537
            YHMSTVQQNTLEAFVNLGKSVFC++TF PSQQYMQLVIDNIYQRAF ERN GN RN  ++
Sbjct: 392  YHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNSLMV 451

Query: 538  EYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTIDM 597
            EYLKHSEVMLL +FLE+ ELQ+VVL +FQ KFGI                 +NNT   D 
Sbjct: 452  EYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGI----------------SSNNT---DY 492

Query: 598  FRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXXXXX 657
            F  + +F+Q+ E+ KYFFRHAPAFAESHILQ+VGFG+PKNPFALLFELPK+L        
Sbjct: 493  FSHQAIFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFL-------- 544

Query: 658  XXXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNIEQ 717
                                                 N+  S    +  +  E+ ++++ 
Sbjct: 545  ----------------------KERKERKERRKSKSSNSFTSMEAPSPTSPIEYLESVDS 582

Query: 718  LRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISILL 777
             RF Y  P  L IW  SL+HIN  S+KCS +VL+KFLHGPL+ A  HLLPW YF++S+ +
Sbjct: 583  PRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAI 642

Query: 778  KREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMNV 837
            + + L   + K FWI + + +FPWN I+NFLN+++ + LDN    T S            
Sbjct: 643  RIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDN-AWKTSS------------ 689

Query: 838  FILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLGIKD 897
             I +LC ++ ++    L+ HF++NEDLPEVWKCWG LWFD IS+K+ +  +      ++D
Sbjct: 690  -IDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVDEGATYNSVQD 748

Query: 898  HMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNNN 957
            HMF D P+DGI +  +DETG  FWKR  R++F+FKGIA+ F+ +GL ++       R  +
Sbjct: 749  HMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFN-MGLTLASVPLQSRR--S 805

Query: 958  VPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNLNFEI 1017
            +   + L+ F FK+     D     L          I  ++  F    E I E NL+   
Sbjct: 806  LAAGHPLQNFCFKFEDPPVDSESYAL----------ISTQMPAF----ENISERNLDPNA 851

Query: 1018 PPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLILAQXXXXXX 1077
            PP +SM+  + +F+  GY++L  +   F+K G   + S+YT+  ++   +          
Sbjct: 852  PPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPI---------H 902

Query: 1078 XATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTE----------PFNRYK-- 1125
               D  T+ ++ +  +++    Q+K  +  ++  L +  + E          PF      
Sbjct: 903  GGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCN 962

Query: 1126 -----TYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTR 1180
                 +YFV DATSWLRHFAH+YKLA+N VL+FA+CLTTFQELRFLRKSKD +VVEA+TR
Sbjct: 963  CDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATR 1022

Query: 1181 AIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVK 1240
            A+IT+RQLYS+  LLPLRFTGNVAT +EEHLEFEEQITWRSHVDEFVIEAV KAQ KF +
Sbjct: 1023 AVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKF-E 1081

Query: 1241 SKTVENMEGTSNWGEIDXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKGISTFGT 1300
            +   +  EG  ++                +   F ++ L++DD +MR+KA  + I TF +
Sbjct: 1082 ALNAQAKEGGHDF------------IPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSS 1129

Query: 1301 QVVFSVCSMMGIDEGVCTN 1319
            + +F+VC+ +G+    CTN
Sbjct: 1130 RFMFAVCNQIGLAHHACTN 1148

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  948 bits (2451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/1060 (49%), Positives = 671/1060 (63%), Gaps = 127/1060 (11%)

Query: 297  GEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITT 356
             + LV+KLQDIYK IVKQEIELQERC +LT SQTT+LKNLWTIY+VN +L++NY+TFITT
Sbjct: 381  SQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITFITT 440

Query: 357  ALLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFI 416
            A+  +Q + D  IG            LWVYGTITFLD+LKNFSNFMDPEVCCQFI HVFI
Sbjct: 441  AIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFHVFI 500

Query: 417  SLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKL 476
            S+S MLADIP KY + W Q+LGDLSRMAIALYPS FIDWKLSAE WYM AM+FTY HGKL
Sbjct: 501  SISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGHGKL 560

Query: 477  YYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNN-RNLQ 535
            YYHMSTVQQNTLEAFVNLGKS+FC+ TF PSQQY+QLVI NIYQRA+ + NN NN RN Q
Sbjct: 561  YYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGRNDQ 620

Query: 536  -LIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRT 594
             L++Y+KH EV LLP F E+ ELQQVVL+YF +KFG            +  N  +NN   
Sbjct: 621  LLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFG------------VDYNNSSNN--- 665

Query: 595  IDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXX 654
              MF SR MF+QN +Q K F+R++ AFAES ILQ+VG+G+ K+PF+LLFELPKYLK+R  
Sbjct: 666  --MFISRKMFVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKE 723

Query: 655  XXXXXXXXXXXXXXXXXXA--STAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFF 712
                                       ++ ++ N        NN+F       +T+EEFF
Sbjct: 724  KKEKRKPKTMLILKITQPRLYHRWVGTTLPTMPN--------NNVF-------LTAEEFF 768

Query: 713  QNIEQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFI 772
            +NI+ + +  F+PNS++IW  SL + N +S+KCSMIV KKFLH P +IALPH LPWCYFI
Sbjct: 769  ENIDTINYPSFMPNSVDIWNHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFI 828

Query: 773  ISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQ 832
            ISI+L+ +   +     FW+  ++ IFPWN I+ FLNVLL Y +DN            +Q
Sbjct: 829  ISIVLQLDKHKNVAMNEFWVEFVRRIFPWNSIVKFLNVLLAYMVDNCW----------EQ 878

Query: 833  KDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADS--- 889
              +N    +LC  Y++M   +LL +FNENE+LPEVWKC G+LWFDTI  K+ ++ D    
Sbjct: 879  SILN----ELCPFYNSMSLDELLTYFNENEELPEVWKCRGSLWFDTIMEKSNLNKDKNPE 934

Query: 890  -----------FENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENF 938
                       ++  G+KD+ F DFPIDG  +   DE GE FWKR  R+IFLFK +AE++
Sbjct: 935  VINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEIGERFWKRAARVIFLFKKLAESY 994

Query: 939  DSL-GLKVSYNAGT------EYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYT 991
              L GL +SY A        EY+ N V  +  L  FSFK   S+   +   L D +E + 
Sbjct: 995  TGLGGLILSYEAPVFNRRKDEYKVNTVCQE--LLEFSFKLNASSDGVM---LDDIIESF- 1048

Query: 992  NTIINRITEFVDIKEPIHETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEF 1051
                          E   E N +    P+ SM+  + IFDY GYK++ PN  SFDKNG+F
Sbjct: 1049 --------------ETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFDKNGDF 1094

Query: 1052 SSGSIYTAWPMDYDQLILAQXXXXXXXATDEMTDLFTGTLSI----------DELSFRQL 1101
             S S + +W +    L            TD+     +G  S           + L F + 
Sbjct: 1095 ISTSFFNSWSI--KNLTNELSRNTCSSITDDAISSGSGNDSAAASTNNDPMNELLVFNEC 1152

Query: 1102 KRPEFRDKSTLLS-----STSTEPFNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVC 1156
              P+++      S      + T    + KTYF+ DATSWLRHFAHIYK+A++ +LKFA+C
Sbjct: 1153 FDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKIATSKILKFAIC 1212

Query: 1157 LTTFQELRFLRKSKDANVVEASTRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQ 1216
            LTTFQELR+LRKSKD NVVEA+TRAIIT+RQLY + NLLPLRFTGNVAT IEEHLEFEEQ
Sbjct: 1213 LTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEEHLEFEEQ 1272

Query: 1217 ITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEGTSNWGEIDXXXXXXXXXXXXKSNLFKY 1276
            ITWRSHVDEFVIEAV+KA+EK        NM+                     + ++F  
Sbjct: 1273 ITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDE-----------------KEKSIFG- 1314

Query: 1277 VVLITDDDSMRMKAQLKGISTFGTQVVFSVCSMM-GIDEG 1315
            ++L+TDD +M+ KA  + I TF T+ +FS+ + +  ++EG
Sbjct: 1315 IILVTDDITMKNKAMDRKIKTFSTRFIFSMANYIRTMEEG 1354

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  937 bits (2423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/1031 (48%), Positives = 660/1031 (64%), Gaps = 126/1031 (12%)

Query: 298  EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357
            +  ++KLQ+IYK+IV QE ELQ+RC  LTTSQTT+LK+LW IY++N +LI NY+ FI TA
Sbjct: 205  QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264

Query: 358  LLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417
            LL++Q   DL +G            LWVYG ITFLDVLKNFSNFMDPEVCCQFI + FIS
Sbjct: 265  LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324

Query: 418  LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477
            +S ML DIP KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE WY E+MK+ Y  GKLY
Sbjct: 325  VSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384

Query: 478  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGN------- 530
            YH++TVQQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF++R++G+       
Sbjct: 385  YHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNNEIA 444

Query: 531  NRNLQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNN 590
            +RN QLI+YLKH+EVMLLP+FLEN +LQ VVL+YF++KFG                  N 
Sbjct: 445  HRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFG---------------KDFNG 489

Query: 591  NTRTIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLK 650
            N    D+F ++DMF QNPE L+Y+FRHAPAFAES +LQL+GFG+PKNPFALLF+LPKYLK
Sbjct: 490  N----DVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLK 545

Query: 651  ERXXXXXXXXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEE 710
             +                                  SE  E    + ++D    Q++SE 
Sbjct: 546  LKK--------------------------DKREKKRSEATE---TSSYTDPFDVQISSES 576

Query: 711  FFQNIEQLRFDYF-IPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWC 769
            +FQNI+ L   +  IP +L IW+ SLNHIN+ S++CS+ VL KFLH PL++ALPH L W 
Sbjct: 577  YFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWL 636

Query: 770  YFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVND 829
            +FI++IL K E +  +    FWI  L+   PWN I+   NVL+ Y LDN           
Sbjct: 637  HFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGNVLVCYMLDN----------- 685

Query: 830  TKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADS 889
                 ++ F+     K+ ++   DL++++NENE+LPE+WKCWGTLWFD I        D 
Sbjct: 686  -----LHPFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAIKK-----CDV 735

Query: 890  FENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNA 949
             E  G++DH+F D P+DGI +  +DE GE FW R++R + L KGIA+ F  LGLKVS+ A
Sbjct: 736  MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLGLKVSFQA 795

Query: 950  GTEYRNNNVPMDNILKMFSFKWAGSNAD-YVDANLGDELEIYTNTIINRITEFVDIKEPI 1008
                R N++P D  LK  +FK    + D Y D N  D+L            + ++I E I
Sbjct: 796  SVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDL-----------YDTIEINEEI 844

Query: 1009 HETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLI 1068
               N++ +  P  S+++ E IF+YTGY +L P+   FDKNG F+S  IY+ W    + + 
Sbjct: 845  EAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGNGVT 904

Query: 1069 LAQXXXXXXXATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYKTYF 1128
            L         + + + D+    LS   L + ++    F DK    S  S E +N    YF
Sbjct: 905  L-------DVSGESIYDVANNNLS---LHWEKI----FFDKIAAASKGSDENYN-CTLYF 949

Query: 1129 VFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMRQL 1188
            V DATSWLRHFAHI+KLA N+ LKFA+CLTTFQELR+LR SKD  VVEA+TR++IT+RQL
Sbjct: 950  VIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQL 1009

Query: 1189 YSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVENME 1248
            Y +  ++P+RFTGN+AT +EE+LEFEEQITW++HVDEFVI+A+ K  ++F   +  +   
Sbjct: 1010 YDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDE-- 1067

Query: 1249 GTSNWGEIDXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFSVCS 1308
               N G+                   ++ VL+TDDD+M  KA+ + I T  T+ +FS+ S
Sbjct: 1068 -NKNKGK-------------------EFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGS 1107

Query: 1309 MMGIDEGVCTN 1319
             +GI+ G+CTN
Sbjct: 1108 KLGINSGLCTN 1118

 Score = 55.8 bits (133), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 54/105 (51%), Gaps = 10/105 (9%)

Query: 52  IRQKRHSSNSYSNAKNNPAVKRRIAKPEEVSLKYIDNMEYGTATTGNNSIICQQQTPSK- 110
           + QKRHSS+S+++   +   KRR+          +D +  G      NS I  Q TPSK 
Sbjct: 40  LHQKRHSSSSHNDTPESSFAKRRVPG-------IVDPVGKGFIDGITNSQISAQNTPSKT 92

Query: 111 GTLSRRPSLIKKQMNSTPQPMSYVVS--EVPASPFYLPANSFSNN 153
              SRRPS+ +K M STPQ  +  +   +VP SP+Y+     + N
Sbjct: 93  DDASRRPSISRKVMESTPQVKTSSIPTMDVPKSPYYVNRTMLARN 137

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  936 bits (2420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/1030 (47%), Positives = 656/1030 (63%), Gaps = 124/1030 (12%)

Query: 298  EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357
            +  ++KLQ+IY++IV QE ELQ+RC  LTTSQTT+LK+LW IY++N +LI NY+ FI TA
Sbjct: 205  QTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264

Query: 358  LLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417
            LL++Q   DL +G            LWVYG ITFLDVLKNFSNFMDPEVCCQFI + FIS
Sbjct: 265  LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324

Query: 418  LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477
            +S+ML DIP KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE WY E+MK+ Y  GKLY
Sbjct: 325  VSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384

Query: 478  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVER-------NNGN 530
            YH++TVQQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF++R       N   
Sbjct: 385  YHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETA 444

Query: 531  NRNLQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNN 590
            +RN QLI+YLKH+EVMLLP+FLEN +LQ VVL+YF++KFG                  N 
Sbjct: 445  HRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFG---------------KDFNG 489

Query: 591  NTRTIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLK 650
            N    D+F ++DMF QNPE L+Y+FRHAPAFAES +LQL+GFG+PKNPFALLF+LPKYLK
Sbjct: 490  N----DIFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLK 545

Query: 651  ERXXXXXXXXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEE 710
             +                                +  + G  ++   + D   +Q++SE 
Sbjct: 546  LKRHKR----------------------------EKKKSGATEVPQ-YRDPFDDQISSES 576

Query: 711  FFQNIEQLRFDYF-IPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWC 769
            +FQNI+ L  ++  IP +L IW+ SLNHIN+ S++CS+ VL KFLH PL++ALPH L W 
Sbjct: 577  YFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWL 636

Query: 770  YFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVND 829
            +FI++IL K E +  +    FWI  L+   PWN ++N  NVL+ Y LDNI          
Sbjct: 637  HFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMVNLANVLVCYMLDNI---------- 686

Query: 830  TKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADS 889
                  + F+     ++ ++   DL+++FNENE+LPE+WKCWG+LWFD I        D 
Sbjct: 687  ------HPFLERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAIKK-----CDV 735

Query: 890  FENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNA 949
             E  G++DH+F D P+DGI +  +DE GE FW R++R I + KG+A+ F  LGLKV++ A
Sbjct: 736  MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFPDLGLKVNFQA 795

Query: 950  GTEYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIH 1009
                R N++  D  LK F+FK      +  D N  +EL+   +TI        +I E I 
Sbjct: 796  PVFCRRNDISPDYFLKNFTFKLDEYEEN--DHNDNNELDELYDTI--------EINEKIE 845

Query: 1010 ETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLIL 1069
              N +    P  S+++ E+IF+YTGY +L P+   FDKNG F+S  IY+ W    + ++L
Sbjct: 846  RVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVGNGMVL 905

Query: 1070 AQXXXXXXXATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYKTYFV 1129
                     +++ M D     LS             F D+ T       +  N    YFV
Sbjct: 906  -------DVSSESMYDAANNNLSPHWEKI-------FFDRITTAGHNGDKNGN-CSVYFV 950

Query: 1130 FDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLY 1189
             DATSWLRHFAHI+KLA N++LKFA+CLTTFQELR+LR SKD NVVEA+TR++IT+RQLY
Sbjct: 951  IDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLY 1010

Query: 1190 SDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEG 1249
             +  ++PLRFTGN+AT++EE+LEFEEQITW +HVDEFVI+A+ K  + F   + ++  + 
Sbjct: 1011 DEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKN 1070

Query: 1250 TSNWGEIDXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFSVCSM 1309
             +N                       Y VL+TDDD+M  KA+ K I T  T+ +FS+ S 
Sbjct: 1071 KNN----------------------AYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSK 1108

Query: 1310 MGIDEGVCTN 1319
            +GI+ G+CTN
Sbjct: 1109 IGINSGLCTN 1118

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 12/108 (11%)

Query: 52  IRQKRHSSNSYSNAKNNPAVKRRI-AKPEEVSLKYIDNMEYGTATTGNNSIICQQQTPSK 110
           + QKRHSS+S+++   +  VKRR+    E V   +ID +  G  +         Q TPSK
Sbjct: 40  LHQKRHSSSSHNDTPESSFVKRRVPGVVEPVGKGFIDGIASGQVSV--------QNTPSK 91

Query: 111 -GTLSRRPSLIKKQMNSTPQPMSYVVS--EVPASPFYLPANSFSNNYE 155
              +SRRPS+ +K M +TP+  +  +S  +VP SP+Y+  ++ + N E
Sbjct: 92  TDDISRRPSISRKAMETTPKVNTASISTIDVPKSPYYMNKSAITRNME 139

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  933 bits (2411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/1030 (47%), Positives = 657/1030 (63%), Gaps = 124/1030 (12%)

Query: 298  EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357
            +  ++KLQ+IYK+IV QE ELQ+RC  LTTSQTT+LK+LW IYK+N +LI NY+ FI TA
Sbjct: 204  QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITA 263

Query: 358  LLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417
            LL++Q   DL +G            LWVYG ITFLDVLK+FSNFMDPEVCCQFIT+ FI 
Sbjct: 264  LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYAFIC 323

Query: 418  LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477
            +S ML DIP KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE WY E+MK+ Y  GKLY
Sbjct: 324  ISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 383

Query: 478  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGN------- 530
            YH++T+QQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF++R++GN       
Sbjct: 384  YHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNNETA 443

Query: 531  NRNLQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNN 590
            +RN QLI+YLKH+EVMLLP+FLEN +LQ VVLLYF++KFG                  N 
Sbjct: 444  HRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFG---------------KDFNG 488

Query: 591  NTRTIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLK 650
            N    D+F ++DMF QNPE L+Y+FRHAPAFAES ILQL+GFG+PKNPFALLF+LPK+LK
Sbjct: 489  N----DVFSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLK 544

Query: 651  ERXXXXXXXXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEE 710
                                              +  + G  +I + + D   +Q +SE 
Sbjct: 545  F----------------------------KKDKREKKKSGAAEIPH-YRDPFDDQGSSES 575

Query: 711  FFQNIEQLRFDYF-IPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWC 769
            +FQNI+ L  D+   P ++ IW+ SLN+IN+ S++CS+ VL KFLH PL +ALPH L W 
Sbjct: 576  YFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWL 635

Query: 770  YFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVND 829
            +FII++L K E +  E    FWI  L+   PWN ++ F NVL+ Y LDN           
Sbjct: 636  HFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMVTFSNVLVCYMLDN----------- 684

Query: 830  TKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADS 889
                 ++ F+     K+ ++   DL+++FNENE+LPEVWKCWG+LWFD +        D 
Sbjct: 685  -----LHPFLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAVKK-----CDV 734

Query: 890  FENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNA 949
             E  G++DH+F D P+DGI +  +DE GE FW R++R I   KGIA+ F  LGLKV++ A
Sbjct: 735  MEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFPDLGLKVNFQA 794

Query: 950  GTEYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIH 1009
                R N++  D  LK  +FK      D  + N  +EL+   +TI        +I E I 
Sbjct: 795  SVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDN--NELDELYDTI--------EINELIE 844

Query: 1010 ETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLIL 1069
              N++ +  P  S+++ E IF+YTGY +L  +   FDKNG F+S  IYT W    + + L
Sbjct: 845  TVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQWSNVGNGVTL 904

Query: 1070 AQXXXXXXXATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYKTYFV 1129
                     +++ + D  T  LS+         +  F    T+  +T  +       YFV
Sbjct: 905  -------DVSSESLYDSTTNDLSL------HWAKILFDKVFTIGKNTDDD--GSCSVYFV 949

Query: 1130 FDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLY 1189
             DATSWLRHFAHI+KLA N++LKFA+CLTTFQELR+LR SKD NVVEA+TR++IT+RQLY
Sbjct: 950  IDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLY 1009

Query: 1190 SDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEG 1249
             +  ++P+RFTGN+AT IEE+LEFEEQITW++HVDEFVI+A+ K  + F   +T++  +G
Sbjct: 1010 DEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKG 1069

Query: 1250 TSNWGEIDXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFSVCSM 1309
             S                       ++ VL+TDDD+M  KA+ K I T  T+ +FS+ S 
Sbjct: 1070 RSK----------------------EFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSK 1107

Query: 1310 MGIDEGVCTN 1319
            +GI+ G+CTN
Sbjct: 1108 LGINSGLCTN 1117

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 55/108 (50%), Gaps = 12/108 (11%)

Query: 52  IRQKRHSSNSYSNAKNNPAVKRRI-AKPEEVSLKYIDNMEYGTATTGNNSIICQQQTPSK 110
           + QKRHSS+S+++   +   KRR+    E V   +ID +          S I  Q  P K
Sbjct: 40  LHQKRHSSSSHNDTPESSFAKRRVPGVVEPVGKGFIDGI--------TTSQISMQNIPFK 91

Query: 111 GT-LSRRPSLIKKQMNSTPQ--PMSYVVSEVPASPFYLPANSFSNNYE 155
              +SRRPS+ +K M +TPQ    S    ++P SP+Y+   + + N E
Sbjct: 92  AEDISRRPSISRKAMETTPQLHTSSNSAMDIPKSPYYVNRTAITRNME 139

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1030 (47%), Positives = 644/1030 (62%), Gaps = 124/1030 (12%)

Query: 298  EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357
            +  ++KLQ+IYK+IV QE ELQ+RC  LTTSQTT+LK+LW IY++N +LI NY+ FI TA
Sbjct: 205  QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264

Query: 358  LLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417
            LL++Q   DL +G            LWVYG ITFLDVLKNFSNFMDPEVCCQFI + FIS
Sbjct: 265  LLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324

Query: 418  LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477
            +S ML DIP KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE WY E+MK+ Y  GKLY
Sbjct: 325  VSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384

Query: 478  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVER-------NNGN 530
            YH++TVQQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF++R       N   
Sbjct: 385  YHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNNETA 444

Query: 531  NRNLQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNN 590
            ++N QLI+YLKH+EVMLLP+FLEN +LQ VVL+YF+ KFG                  N 
Sbjct: 445  HKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFG---------------KDFNG 489

Query: 591  NTRTIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLK 650
            N    D+F ++DMF QNPE L+Y+FRHAPAFAES +LQL+GFG+PKNPFALLF+LPKYLK
Sbjct: 490  N----DVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLK 545

Query: 651  ERXXXXXXXXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEE 710
             +                     S+A +                   + D   ++ + E 
Sbjct: 546  LKKDKREKK-------------RSSATETPQ----------------YRDPFHDKKSPES 576

Query: 711  FFQNIEQLRFDYF-IPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWC 769
            +FQNI+ L  ++  IP +L IW+ SLNHIN+ S++CS+ VL KFLH P +IALPH L W 
Sbjct: 577  YFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWL 636

Query: 770  YFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVND 829
            YF+++IL + E +  +    FWI  L+   PWN +++  NVL+ Y LDN           
Sbjct: 637  YFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVSLANVLVCYMLDN----------- 685

Query: 830  TKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADS 889
                 ++ F+      + +    DL++HFNENE+LPE+WKCWG+LWFD I        D 
Sbjct: 686  -----LHPFLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAIKK-----CDV 735

Query: 890  FENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNA 949
             E  G++DH+F D P+DGI +  +DE GE FW R++R I L KGIA+ F  LGLKV++ A
Sbjct: 736  MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFPDLGLKVNFQA 795

Query: 950  GTEYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIH 1009
                R N++P D  L+ F+FK        +DA   DE     N  ++ + E ++I E I 
Sbjct: 796  PVFCRRNDIPQDYFLRKFTFK--------LDA--YDEGNNNDNNELDELYETIEINEKID 845

Query: 1010 ETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLIL 1069
              NL+    P  S++  E IF+YTGY +L P+   FDKNG F+S  IY+ W    + + +
Sbjct: 846  NVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGNGVPI 905

Query: 1070 AQXXXXXXXATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYKTYFV 1129
                      TD    L    +  D ++    K  +  D  T+              YFV
Sbjct: 906  DVSNEPIYDVTDNDLSLHWEKIFFDRIA-AAYKNCDENDNCTI--------------YFV 950

Query: 1130 FDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLY 1189
             DATSWLRHFAHI+KLA N +L FA+CLTTFQELR+LR SKD NVVEA+TR++IT+RQLY
Sbjct: 951  VDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLY 1010

Query: 1190 SDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEG 1249
             +  ++P+RFTGN+AT +EE+LEFEEQITW++HVDEFVI+A+ K  + F   + +   + 
Sbjct: 1011 DERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKN 1070

Query: 1250 TSNWGEIDXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFSVCSM 1309
             +                       ++ VL+TDDD+M  KA+ K I T  T+ +FS+ S 
Sbjct: 1071 KNK----------------------QFAVLVTDDDNMNKKAKDKMIKTCNTKYLFSLGSK 1108

Query: 1310 MGIDEGVCTN 1319
            +GI+ G+CTN
Sbjct: 1109 LGINSGLCTN 1118

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (54%), Gaps = 12/108 (11%)

Query: 52  IRQKRHSSNSYSNAKNNPAVKRRI-AKPEEVSLKYIDNMEYGTATTGNNSIICQQQTPSK 110
           + QKRHSS+S+++   +   KRR+    E V   +ID +  G         I  Q TPSK
Sbjct: 40  LHQKRHSSSSHNDTPESSFAKRRVPGVVEPVGKGFIDGVTNGQ--------ISAQNTPSK 91

Query: 111 -GTLSRRPSLIKKQMNSTPQPMSYVVS--EVPASPFYLPANSFSNNYE 155
              +SRRPS+ +K M STPQ  +  +S  +VP SP+Y+   + + N E
Sbjct: 92  VDDVSRRPSISRKVMESTPQAKTASISTMDVPKSPYYVNRTAVARNME 139

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  912 bits (2358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/1033 (48%), Positives = 639/1033 (61%), Gaps = 109/1033 (10%)

Query: 298  EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357
            +AL+ KLQ+IY+ IV+QE ELQ+RCSQLTTSQTTDLKNLW IYKVN +LI+NY  FITTA
Sbjct: 283  QALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFMFITTA 342

Query: 358  LLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417
            LL +Q + DL IG            LWVYGTITFLDVLKNFSNFMDPEVCCQFI +VFIS
Sbjct: 343  LLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIIYVFIS 402

Query: 418  LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477
            +S ML DIP K+SI WL+RLGDLSRMAIALYPSGFIDWKLSAE WY EA+K+T+ HGKLY
Sbjct: 403  ISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFGHGKLY 462

Query: 478  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQLI 537
            YHMSTVQQNTL AFVNLGKSVFC++TF PSQQYMQLVIDNIYQRAF ERN+G++RN  L+
Sbjct: 463  YHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRNAHLV 522

Query: 538  EYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTIDM 597
            EYLKH+EVMLLP+FLE+SELQ VVL +F++KFG+                    T  +D 
Sbjct: 523  EYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGV--------------------TSNVDF 562

Query: 598  FRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXXXXX 657
            F  R +F+Q+ E+LK+FFRHA  +AESH+LQLVGFGDP+NPFALLFELPK+LKER     
Sbjct: 563  FDPRLVFVQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKER----- 617

Query: 658  XXXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNIEQ 717
                            ST  D S+                  D+        EFF+ I+ 
Sbjct: 618  ---KDRREKRKSKSSTSTQYDTSI------------------DDDCAFAAPSEFFETIDS 656

Query: 718  LRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISILL 777
             ++ Y  P+ + IW  SL++ N+ ++KCSMIVL+KFLHGPLL ALPHLLPW YF+ +   
Sbjct: 657  TKYIYKFPDDINIWKESLSYANVTAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNS 716

Query: 778  KREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMNV 837
            +   +  ++ + FW+ +++ +FP+N II FLNVLL Y                 Q   N 
Sbjct: 717  RVITIPQDEIRRFWVALVRQLFPFNTIITFLNVLLLYM--------------NNQTQANF 762

Query: 838  FILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLGIKD 897
               +   ++  M  ADL+ +F ENE+LPEVW+CWGTLWFD ++ K+  +     + G+KD
Sbjct: 763  PFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHITNLTDINSTGVKD 822

Query: 898  HMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNNN 957
            HMF+D PIDGI +   DE+GE FWKR  R+I LF+ +A     +GL+   + G  +R+  
Sbjct: 823  HMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALEC-PVGLR-EISGGRNWRS-- 878

Query: 958  VPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNLNFEI 1017
                       FK+    +++ D  L               T   D  E I   NL+   
Sbjct: 879  ---------LVFKFEEPPSEWCDMYL------------EPFTLVFDTFEQISPVNLDQRA 917

Query: 1018 PPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPM---------DYDQLI 1068
             P   M  + DI    GY+ L P+   F++NG+  +GS+YT   +         D++   
Sbjct: 918  TPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFNGKR 977

Query: 1069 LAQXXXXXXXATDEMTDLFTGTLS--IDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYKT 1126
            L +          +   L        +DE       + + R +  L         + + T
Sbjct: 978  LLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLPRGDLHCFADTHVT 1037

Query: 1127 YFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMR 1186
            YFV DAT+WLRHF H+YKLA+N++LKFA+CLTTFQELRFLRKSKD +V+EA+TRA+IT+R
Sbjct: 1038 YFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVR 1097

Query: 1187 QLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVEN 1246
            QLY +  LLPLRFTGNVA  +EEHLE EEQ+TWRSHVDEFVIEA+ KAQ+KF        
Sbjct: 1098 QLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKF-------- 1149

Query: 1247 MEGTSNWGEIDXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFSV 1306
                 N    D                F ++ L+TDD +MR KA  + I  F T+ +FSV
Sbjct: 1150 -----NALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSV 1204

Query: 1307 CSMMGIDEGVCTN 1319
            C+ +G  + VCTN
Sbjct: 1205 CNELGHAKNVCTN 1217

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  914 bits (2361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1036 (49%), Positives = 646/1036 (62%), Gaps = 113/1036 (10%)

Query: 298  EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357
            + LV KLQ+IYK IVKQE ELQERCSQLTTSQTTDLKNLW IYK+N +LI+NY TFITTA
Sbjct: 321  QTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFTFITTA 380

Query: 358  LLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417
            LL +Q + DL IG            LW+YGTITFLDVLKNFSNFMDPEVCCQFI +VFIS
Sbjct: 381  LLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIVYVFIS 440

Query: 418  LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477
            +S +L +IP  +S+ WL+RLGDLSRMAIALYPSGFIDWKLSAE WY EA+K+ + HGKLY
Sbjct: 441  ISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFGHGKLY 500

Query: 478  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQLI 537
            YHMSTVQQNTL AFVNLGKSVFC++TF PSQQYMQLVIDNIYQRAF ERN+G++R   ++
Sbjct: 501  YHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRYSHIV 560

Query: 538  EYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTIDM 597
            EYLKH+EVMLLP+FLEN E Q VVL +F +KFG                     T + + 
Sbjct: 561  EYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGA--------------------TGSANF 600

Query: 598  FRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXXXXX 657
            F    +F+Q+ E+LK+FFRHA  +AESHILQLVGFGDP+NPFALLFELPK +KE      
Sbjct: 601  FDPSLIFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIKE------ 654

Query: 658  XXXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNIEQ 717
                            STA + S MSID++ +G+                  +FF+ +  
Sbjct: 655  -----RKERKEKRKSKSTASNQSDMSIDDTFLGD----------------PVQFFETLNS 693

Query: 718  LRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISILL 777
             +  Y     L IW  SLN++N  S++CSM+VL+KFL+  LL ALPHLLPW YF++++ L
Sbjct: 694  TKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGL 753

Query: 778  KREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMNV 837
            + + + +EDSK FWI  ++ IFPW  I NFLNVLL Y            +ND  QK    
Sbjct: 754  RLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVLLLY------------IND--QKPTKF 799

Query: 838  FILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLGIKD 897
             I +    Y  M   +LL++F ENEDLPEVW CWGTLWFD I++K+  +     + G+KD
Sbjct: 800  PIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVSNLVDIHSTGVKD 859

Query: 898  HMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNNN 957
            HMFLD P+DGI +   DE+GE FWKR +R+I LF+GIA  F   G    +N   ++    
Sbjct: 860  HMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQF-PFGF-TEFNGSDDW---- 913

Query: 958  VPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNLNFEI 1017
                   K   FK+    A++ +  LG   + Y         EF    E I   N + + 
Sbjct: 914  -------KSLVFKFNEPPAEWKEQYLGSFSKEY--------GEF----ESISFVNTDLQS 954

Query: 1018 PPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAW--------PMDYDQL-I 1068
            PP K M+   DI    GYK+L P+   F+KNG+  +GS+YT+         P D +    
Sbjct: 955  PPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVPNDSEDFGS 1014

Query: 1069 LAQXXXXXXXATDEMTDLFT-----GTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNR 1123
              +        T E  D         T  IDE    +      R +  L         + 
Sbjct: 1015 TKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQYFTDT 1074

Query: 1124 YKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAII 1183
            + TYFV DAT+WLRHF H+YKLA++++LKFA+CLTTFQELRFLRKSKD +V+EA+TRA+I
Sbjct: 1075 HVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVI 1134

Query: 1184 TMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKT 1243
            T+RQLY +  LLPLRFTGNVA  +EEHLE EEQ+TWRSHVDEFVIEA+ KAQ KF +   
Sbjct: 1135 TVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFNQLNK 1194

Query: 1244 VENMEGTSNWGEIDXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVV 1303
                 G  +   ID                F ++ L+TDD +MR KA+ + I  F T+ +
Sbjct: 1195 DAKASGRESITTID-------------DGKFNFIALVTDDINMRNKARAQSIRAFSTKFM 1241

Query: 1304 FSVCSMMGIDEGVCTN 1319
            F++C  +G+ + VCT+
Sbjct: 1242 FAICHEIGLSKKVCTD 1257

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  891 bits (2302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1075 (45%), Positives = 646/1075 (60%), Gaps = 119/1075 (11%)

Query: 298  EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357
            +AL+ KLQDIYK I+ QE+ELQ  CS +T+SQTTDLK +W +YK+N++L+NNYV FITTA
Sbjct: 274  QALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITTA 333

Query: 358  LLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417
            LL SQSQ DL IG            LWVYGTITFLDVLK+FSNFMDPE+CCQFI HVFIS
Sbjct: 334  LLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFIS 393

Query: 418  LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477
            ++ M   IP K+SIPW  RLGDLSRMA ALYP G  DWKLSAE WY EAMK+TY  GKLY
Sbjct: 394  IANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGKLY 453

Query: 478  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQLI 537
            YHM+TVQQN+L AF+NLGKSVFC++ F P+QQY+QLVIDNIYQRA++ R   ++ N+Q++
Sbjct: 454  YHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNVQIL 513

Query: 538  EYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTIDM 597
            +YLKH+E+M+LP F+EN ELQ++  +YF EKFG               + + NN      
Sbjct: 514  DYLKHNEIMVLPNFMENFELQRMAYVYFSEKFG--------------QDFVGNN-----F 554

Query: 598  FRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXXXXX 657
            F +R MF+QN E +K++FRH+P FA++HILQ+VG+G+  N FALL+ELPK++K+      
Sbjct: 555  FDTRSMFVQNLESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEI--- 611

Query: 658  XXXXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNIEQ 717
                            S     S   +DN  M  D ++   S N ++ V   E+F ++E 
Sbjct: 612  ----------------SRQRKKSKTGVDN--MSIDTLSFQVSGNEIHDVG--EYFNSLEN 651

Query: 718  LRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISILL 777
            +  ++ +P +++IW+ SL + N   + C M+VL+KFL GP + ALPHLLPW YF+IS+  
Sbjct: 652  IDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAF 711

Query: 778  KREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMNV 837
            K E L   +S+ FW   ++ IFPWN IINFLNVL+ +  DN               D   
Sbjct: 712  KIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFLKDN--------------SDSCS 757

Query: 838  FILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLGIKD 897
             +  LC  YS +   ++L +F+ENE+LPEVW CWG+LWFDTI NK+       +  GIKD
Sbjct: 758  LVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYSGLKTAGIKD 817

Query: 898  HMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNNN 957
              FLD P DGI +  ED+ G  FWKR  RI+FLFKG AE FD  GL++     T   + N
Sbjct: 818  VNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKFDQ-GLRL-----TNINSLN 871

Query: 958  VPMDNILKMFSFKWAGSNADYV-------DANLGDELEIYTNTIINRITEFVDIKEPIHE 1010
               +NI   F+ K    N D++       D    DE       + +  TE +   E I E
Sbjct: 872  SEEENI---FTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLPAFESISE 928

Query: 1011 TNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQL--- 1067
             N+  +  P  S+I  E IFDY GYKKL P    +DKNG  + G+IY+ W   ++QL   
Sbjct: 929  NNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEA-FNQLGNG 987

Query: 1068 ILAQXXXXXXXATDEMTD----------LFTGTLSIDELS-----FRQLKRPEF------ 1106
            +  +         D + D          LF   L  DE         +++R         
Sbjct: 988  LKPRMENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESSDHLAEVEREGDETEDET 1047

Query: 1107 ---------------RDKSTLLSSTSTEPFNR---YKTYFVFDATSWLRHFAHIYKLASN 1148
                           RD  T+  +       R   Y TYF+FDAT+WLRHFAHIYK+A +
Sbjct: 1048 EETNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIYKIAYS 1107

Query: 1149 HVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLYSDGNLLPLRFTGNVATDIE 1208
             +L F +CLTTFQELRFLR+S+D NV+EA+TRA+I +R LY    ++PLRF G +A+ IE
Sbjct: 1108 GLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIASHIE 1167

Query: 1209 EHLEFEEQITWRSHVDEFVIEAVMKAQEKF----VKSKTVENMEGTSNWGEIDXXXXXXX 1264
            EHLEFEEQITWRSHV+EFVIEAV K+QE      + +++ +      N    D       
Sbjct: 1168 EHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENMDTADSADTKQR 1227

Query: 1265 XXXXXKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFSVCSMMGIDEGVCTN 1319
                  +N     VL+TDD +M  KA+ +GI T  T+ +FS+CS +G+  G+CTN
Sbjct: 1228 GNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGICTN 1282

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/1041 (46%), Positives = 637/1041 (61%), Gaps = 116/1041 (11%)

Query: 300  LVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTALL 359
            LV KLQ+IYK IVKQE ELQERCS LTT QTTDLKNLW  YK+N +LI+NY+ FITTALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 360  SSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISLS 419
             SQS+  L IG            LWVYGTITFLDVLKNFSNFMDPEVCCQFI +VFI+LS
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 420  TMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLYYH 479
             ML D+P KYSIPWL+RLGDLSRMAIALYPSGF+DWKLSAE WY E++KFT+ HGKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 480  MSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQLIEY 539
            MSTVQQNTLEAFVNLGKSVFC++ F PS QYMQLVIDNIYQRAF ER++  NR   +++Y
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523

Query: 540  LKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTIDMFR 599
            LKH+EVMLLP+FLE+SELQ VV+ YFQ KFG+                    + + + F 
Sbjct: 524  LKHTEVMLLPSFLESSELQNVVIHYFQHKFGV--------------------SSSGNFFD 563

Query: 600  SRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERXXXXXXX 659
               +FIQ+ E+LK+FFRH+  F++SHILQL GFGDPKNPFA+LFEL K+LK R       
Sbjct: 564  PNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSR------- 616

Query: 660  XXXXXXXXXXXXXASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNIEQLR 719
                           +  +GS+  ++ S                 Q ++E+FF  I+  +
Sbjct: 617  ----KERKERKKSTKSTSEGSLDPVEFSS--------------QQQASTEDFFSTIDSPK 658

Query: 720  FDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISILLKR 779
              Y  P  L +W  SL++IN+ S+KC MIVL++FL+GP++ ALPH+LPW  FIISI ++ 
Sbjct: 659  VPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRL 718

Query: 780  EGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMNVFI 839
            + +     K FWI  ++ IFPW+ +I F+N L+ Y +          V  TK  D++  +
Sbjct: 719  DQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCM----------VTGTKNFDIDAHM 768

Query: 840  LDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLGIKDHM 899
                + Y  M   +LL    ENE+LPE W CWG+LWF+TIS K+ +D  + E+ G+ D +
Sbjct: 769  ----STYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTL 824

Query: 900  FLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNNNVP 959
            FLD P +GI +  +DE G  +W+R  R + LF  I E     G    Y  G +  N   P
Sbjct: 825  FLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDG----YGHGCKKLN---P 877

Query: 960  MDNILKMFSFKWAGSNADYVDANLGDE---------LEIYTNTIINRITEFVDIKEPIHE 1010
                 K   F++     D +   L  E          EI +N         ++  + + +
Sbjct: 878  EATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISN---------LNCSDNLQD 928

Query: 1011 TNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLILA 1070
             +        KSMI    I +  G+K + P+   F+KNG+  + S+YT  P++   +   
Sbjct: 929  GS--------KSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGG 980

Query: 1071 QXXXXXXXATDE---MTDLFTGTLSIDELS---FRQLKRPEFRDKSTL----LSSTSTEP 1120
                      +    + D    + +ID+L          P+FR +  L    L + + + 
Sbjct: 981  DDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQA 1040

Query: 1121 FNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTR 1180
             +   T+FV DAT+WLRHFAHIYKLA++ VLKFA+CLTTFQELRFLRKSKD +V+EA+TR
Sbjct: 1041 -DTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATR 1099

Query: 1181 AIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKF-- 1238
            A+I +RQLY +  LL LRFTGNVA  +EEHLE EEQ+TW+SHVDEFVI+A+ KAQ+KF  
Sbjct: 1100 AVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNV 1159

Query: 1239 VKSKTVENMEGTSNWGEIDXXXXXXXXXXXXKSNLFKYVVLITDDDSMRMKAQLKGISTF 1298
            + +  +E  +      E               +  F +V L+TDD +MR KAQ  GI TF
Sbjct: 1160 LNNDAIEKGKDCIPLSE-----------DGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTF 1208

Query: 1299 GTQVVFSVCSMMGIDEGVCTN 1319
             T+ VF++C  +G + GVCTN
Sbjct: 1209 STRFVFAICRELGRETGVCTN 1229

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 55/117 (47%), Gaps = 24/117 (20%)

Query: 49  QENIRQKRHSSNSYSNAKNNPAVKRRIAK--PEEVSL----------KYIDNMEYGTATT 96
              + QKRH+SNS     +N  +KRR     PE V +          +Y+D     +  T
Sbjct: 11  HSGLHQKRHNSNSVDYYDSN-IIKRRTGDGVPENVDISVAEIPQEPCQYLDT----SLLT 65

Query: 97  GNNSIICQQQTPSKGTLSRRPSLIKKQMNSTPQPMSYVVS-EVPASPFYLPANSFSN 152
             + I   ++TPS   +++  +L   QM  TPQP     S E P SPFYLP  S +N
Sbjct: 66  SPSKIRHHEKTPS---ITKPHTL---QMEQTPQPRGVDTSGEFPQSPFYLPTTSQTN 116

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  573 bits (1476), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 283/377 (75%), Positives = 317/377 (84%), Gaps = 24/377 (6%)

Query: 297 GEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITT 356
            +AL++KLQDIYK+IVKQEI+LQ+RCSQLTTSQTTDLKNLWTIYK+N+DLINNY+ FIT 
Sbjct: 395 SQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITN 454

Query: 357 ALLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFI 416
           ALL +QS+ DLHIG            LWVYGTITFLDVLK+FSNFMDPEVCCQFI+HVFI
Sbjct: 455 ALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFI 514

Query: 417 SLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKL 476
           ++S +L DIP KYSI WLQRLGDLSRMAIALYPSGFIDWKLSAE WY EAMKFTY+HGKL
Sbjct: 515 AISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKL 574

Query: 477 YYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQL 536
           YYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGN+RNLQL
Sbjct: 575 YYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQL 634

Query: 537 IEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTI-PSTSE-------------- 581
           IEYLKH+EVMLLPTFLE+ +LQ VVL+YFQ KFGIL+ T  P TS+              
Sbjct: 635 IEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVNIPY 694

Query: 582 ------TISINTMNNNTR---TIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGF 632
                 T S ++ +N TR   TID+FR++DMFIQNP+ LKYFFRH+  FA+SHILQLVGF
Sbjct: 695 SSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGF 754

Query: 633 GDPKNPFALLFELPKYL 649
           GDPKNPFALLFELPK+L
Sbjct: 755 GDPKNPFALLFELPKFL 771

 Score =  564 bits (1453), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 320/637 (50%), Positives = 410/637 (64%), Gaps = 81/637 (12%)

Query: 676  AGDGSMMSID-----NSEMGEDDINNLFSDNVMNQVTSEEFFQNIEQLRFDYFIPNSLEI 730
            + DGSMMSID     N      +IN LF +N  N +  EEFF+NI+ L+F Y IP ++EI
Sbjct: 829  SKDGSMMSIDYINNINLNSNSSNINQLFDNNYSN-ILCEEFFENIDLLQFPYKIPQTIEI 887

Query: 731  WMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISILLKRE-GLTHEDSKI 789
            W+ SL +INLISLKCS+IVLKKFL+GP+LIALPHLL W +FIISILLK E  +T   SKI
Sbjct: 888  WLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWIHFIISILLKIENSITDNQSKI 947

Query: 790  FWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMNVFILDLCNKYSTM 849
            FW   LK I PWN I+NFLNVL+ Y LDNI        ND   K     I+ L NKY++M
Sbjct: 948  FWYSFLKCIIPWNSIVNFLNVLMVYLLDNI--------NDENFK----LIISLSNKYNSM 995

Query: 850  GFADL---LQHFNENEDLPEVWKCWGTLWFDTISNKN----------------------- 883
              + L   L+ FN+NE+LPE+WKCWGTLWFD I NKN                       
Sbjct: 996  SSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNNNTTTTTKNNG 1055

Query: 884  ------GMDAD-SFENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAE 936
                    D D +   +GI+DH  LD P+DGIG+V  DE G NF+KR++R+IFL K + E
Sbjct: 1056 EDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRLIFLCKSMIE 1115

Query: 937  NFDSLGLKVSYNAGTEYRNNNVPMDNILKMFSFKWAG-------------SNADYVDANL 983
             F +LGLK+S+      RN  +P + IL  F+FK                 N +  + N 
Sbjct: 1116 TFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTEQNIENENENE 1175

Query: 984  GDELEIYTNTIINRITEFVDIKEPIHETNLNFEI-PPLKSMIANEDIFDYTGYKKLEPNS 1042
             D+LE +  +I++ I EF  I EPI E NLN ++ PPL  +  NE+IF+Y GYK+L  N 
Sbjct: 1176 NDDLE-FNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLGYKRLNFNI 1234

Query: 1043 RSFDKNGEFSSGSIYTAWPMDYDQL-----ILAQXXXXXXXATDEMTDLFTGTLSIDELS 1097
            +SF +NGE  SGSIY++WP+DY++         Q       +T +  ++  G ++ ++ S
Sbjct: 1235 QSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNENVTVGDITPEDAS 1294

Query: 1098 FRQLKRPEFRDKSTLLSSTSTE--------PFNRYKTYFVFDATSWLRHFAHIYKLASNH 1149
            F++  +  F  K +  S+ S            N+++T+FVFDATSWLRHFAHIYKL+ N 
Sbjct: 1295 FKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHFAHIYKLSKNG 1354

Query: 1150 VLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLYSDGNLLPLRFTGNVATDIEE 1209
             LKFAVCLTTFQELRFLRKSKD NVVEASTRAIITMRQLY +G LLPLRFTGNVATDIEE
Sbjct: 1355 FLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFTGNVATDIEE 1414

Query: 1210 HLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVEN 1246
            HLEFEEQITWRSHVDEFVIEA++++QE+F K+K+++N
Sbjct: 1415 HLEFEEQITWRSHVDEFVIEAIIRSQERF-KTKSIQN 1450

 Score = 58.9 bits (141), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 65/154 (42%), Gaps = 54/154 (35%)

Query: 53  RQKRHSSNSYSNAKNNPAVKRRIAKPEEV---------------------------SLKY 85
           R KRHSSNSY+N K  P  KRRIA    +                           +  +
Sbjct: 80  RPKRHSSNSYNNYKTIPFTKRRIAACTPININNNNDNYNNNENMILMNNNNNNNNINNSF 139

Query: 86  IDNMEY-GTATTGNNSIICQQQTPSKG-TLSRRPSLIKKQ-------------------- 123
           IDN++Y        N     Q TPSKG T+SRRPS+I ++                    
Sbjct: 140 IDNLDYLSNTNNNTNMSTMAQYTPSKGTTISRRPSIIIRKQQQQQQQSHFTTATTIKSPS 199

Query: 124 ----MNSTPQPMSY-VVSEVPASPFYLPANSFSN 152
               +N TPQ  +Y   SE P SP+YL  NS+SN
Sbjct: 200 NHTSVNITPQASNYDPASEPPNSPYYLTTNSYSN 233

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  449 bits (1154), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 232/415 (55%), Positives = 287/415 (69%), Gaps = 61/415 (14%)

Query: 297 GEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITT 356
            + L++KLQ+IYK+IV QE+ELQ++C++L+TSQ+T LK LW+IYK+N DLINNY+ FI T
Sbjct: 266 NQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILT 325

Query: 357 ALLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFI 416
           +L  SQS  D  IG            LW+YGTITFLD+LKNF+NFMDPE+  QFITHVF 
Sbjct: 326 SLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFE 385

Query: 417 SLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKL 476
           S+S M++D+P  +  PW QRLGDLSRMAIALYPS FIDWKLS+E WY+E+MKFT++HGKL
Sbjct: 386 SISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKL 445

Query: 477 YYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNN----- 531
           YYH+STVQQN LEAFVNLGKSVFC +TF PSQ+YMQLVIDNIYQRAF+ERN+ ++     
Sbjct: 446 YYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSSNNA 505

Query: 532 ---------------RNLQ---LIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILE 573
                          +N Q   LIEYLKHSEVMLLP FLEN  L+ VVL YF   FG + 
Sbjct: 506 GSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIA 565

Query: 574 V-----------------------------------TIPSTSETISINTMNNNTRTIDMF 598
           +                                    IPS+S  I+  ++  N   I++F
Sbjct: 566 IQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQIN--AINLF 623

Query: 599 RSRDMFIQ-NPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKER 652
             R++F Q N + LKYFF+++  FAESHILQL+GFGDPKNPFALLF+LPKYLKER
Sbjct: 624 NFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYLKER 678

 Score =  253 bits (647), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 124/284 (43%), Positives = 184/284 (64%), Gaps = 17/284 (5%)

Query: 700  DNVMNQVTSEEFFQNIEQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLL 759
            D +++ ++ ++FF N+E L+  +F+PNSLEIW  SL +IN+ISL CS+IVLKKFL+GPL 
Sbjct: 780  DEMLDNLSPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLF 839

Query: 760  IALPHLLPWCYFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNI 819
            ++LPH+LPW YFIIS+ L+ E L + +S+IFW+  ++ IFPWN I+++LNV++   LDN 
Sbjct: 840  VSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNC 899

Query: 820  GLPTPSAVNDTKQKDMNVFILDLCNKYSTMGFADLLQHFNENE-DLPEVWKCWGTLWFDT 878
                            N  I  L N YS     +LL  FNENE +LPEVWKC+G+LWFD 
Sbjct: 900  Y--------------ENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDV 945

Query: 879  IS-NKNGMDADSFENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAEN 937
            I+ N      D  +N+ +KD   L++PIDG+ +   +E G NFWKR+ R+IFLFK +   
Sbjct: 946  IAENYQIYSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITR 1005

Query: 938  FDSL-GLKVSYNAGTEYRNNNVPMDNILKMFSFKWAGSNADYVD 980
            F+   GL +S N       +++P ++IL+ F+FK    + +Y++
Sbjct: 1006 FNGFGGLTISSNTSVYCNRSDIPNNHILRTFAFKLLPDDDNYMN 1049

 Score =  251 bits (641), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 152/338 (44%), Positives = 198/338 (58%), Gaps = 40/338 (11%)

Query: 1005 KEPIHETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDY 1064
            K  I  T+LN E  P  S+I NE +F+Y GYK+  P+  +FDKNGE  S S+YT+  +D 
Sbjct: 1152 KNSIQNTDLNCE--PGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDT 1209

Query: 1065 --DQLILAQXXXXXXXATDEMTDLFTGTLS---------------------IDELSFRQL 1101
                   A        A DE  +  + T                       +++  F ++
Sbjct: 1210 INGSSSNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269

Query: 1102 KRPEFRD-----KSTLLSSTSTEPFNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVC 1156
              P++++     +  +   TS +      TYFV DATSWLRHFAH+YKLA+N +LKFA+C
Sbjct: 1270 LDPDYKNIDEIWRGEMFHDTSIQ---FSDTYFVLDATSWLRHFAHVYKLATNGILKFAIC 1326

Query: 1157 LTTFQELRFLRKSKDANVVEASTRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQ 1216
            LTTFQELRFLRKSKD NV+EA+TRAIIT+RQLYS+  LLPLRFTGN+AT IEEHLEFEEQ
Sbjct: 1327 LTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQ 1386

Query: 1217 ITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEGTSNWGEIDXXXXXXXXXXXXKSNLFKY 1276
            ITWRSHVDEFVIEA+ +AQ K   ++  E+   TS+                    +F  
Sbjct: 1387 ITWRSHVDEFVIEAIKRAQLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDMIF-- 1444

Query: 1277 VVLITDDDSMRMKAQLK----GISTFGTQVVFSVCSMM 1310
             VL+TDD SM  K Q +     I TF T+ VFS+C+M+
Sbjct: 1445 -VLVTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 125/602 (20%), Positives = 235/602 (39%), Gaps = 140/602 (23%)

Query: 727  SLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISILLKREGLTHED 786
            SL  W   +  ++   L  + ++ KKFL   + I+ P +LPW  F IS+  +   +T   
Sbjct: 477  SLSNWKILIEQMDDTLLHSNKLLFKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRH 536

Query: 787  SKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMNVFILDL--CN 844
              + W  +L+ + PW+DI+ +LN       ++I +    ++N    K +   I ++  C+
Sbjct: 537  VLLLWKDLLQNLLPWDDIVTYLN-------ESIDMVNKHSIN---SKTLRALIKNIKSCS 586

Query: 845  KYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLGIKDHMFLDFP 904
             Y      DLL +     +  E+  C G +WFD++++K    A    N  +      +  
Sbjct: 587  LY------DLLYYMMYESNFQEISMCEGFIWFDSLASK-IKQASITTNESLMKFKSYNAS 639

Query: 905  IDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNNNVP-MDNI 963
             D + Y  +D+     W R L II L K +  ++  L + VS    +   ++ +   D++
Sbjct: 640  EDSLIYDDDDQVYTKMWTRALLIILLIKNVINDYPEL-IDVSIRGQSLTNSSCIKNSDSL 698

Query: 964  LKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNLNFEIPPLKSM 1023
               + F W            G EL    N +I        I + +H  N  F+       
Sbjct: 699  TNDYLFDW------------GFELN-NNNAVI--------IDDTLHGRNRIFK------- 730

Query: 1024 IANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLILAQXXXXXXXATDEM 1083
                  F Y       P+ + FDKNG+ + G    +   +YD +            ++E 
Sbjct: 731  ------FSYI------PDFQDFDKNGDITWGYSLIS---NYDYI------YSNDFNSEED 769

Query: 1084 TDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYKTY--------FVFDATSW 1135
             + F                   R    LLS+ +    ++ K Y        F+ D  +W
Sbjct: 770  GNFFQ------------------RYSRRLLSAHNDYSEDKSKKYLPKLENNYFMVDTLAW 811

Query: 1136 LRHFAHIYKLASNHVLKFAVCLTTFQELRFLRK-SKDANVVEASTRAIITMRQLYSDGNL 1194
            L+H   + +  +   +K  + ++   +L  L+  S+  +V  +++R +I +  LY+   +
Sbjct: 812  LKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLYAMNQI 871

Query: 1195 LPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEGTS--N 1252
              L+             EFE  I                       SK ++N++G+   N
Sbjct: 872  NILK-------------EFESPI-----------------------SKALKNIDGSQILN 895

Query: 1253 W-GEIDXXXXXXXXXXXXKSNLFKY----VVLITDDDSMRMKAQLKGISTFGTQVVFSVC 1307
            + G+              + N+ +     VV+++DD       + KG +   T+V+FSV 
Sbjct: 896  FNGKFKNDLLTKENGPGQQLNMIELRMDNVVVVSDDKLSLATFKKKGYNVVSTKVLFSVA 955

Query: 1308 SM 1309
            S+
Sbjct: 956  SL 957

 Score = 62.8 bits (151), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 95/211 (45%), Gaps = 25/211 (11%)

Query: 336 LWTIYKVNIDLINNYVTFITTALLSSQSQQDLHIGXXXXXXXXXXXXLWVYGTITFLDVL 395
           L  ++K++  +++ Y  FI  AL  + +Q+DL  G            L  +     L+++
Sbjct: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203

Query: 396 KNFSNFM----------DPEVCCQFITHVFISLSTMLADIPTKYSIPWLQRLGDLSRMAI 445
           +N+ N M          + +   +FI    I ++ ML +IP K+   W   +GDL+R+ +
Sbjct: 204 ENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLM 263

Query: 446 ALYPSGFIDWKLSAEEWY-----MEAMKFTYNHGK----------LYYHMSTVQQNTLEA 490
            L       ++L++   Y     + A+ ++ N+GK           Y+++S VQ ++L  
Sbjct: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323

Query: 491 FVNLGKSVFCQETFTPSQQYMQLVIDNIYQR 521
            V L K +  + T    +   QL ID I  +
Sbjct: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISK 354

>Kpol_1055.79 s1055 complement(209404..210252) [849 bp, 282 aa] {ON}
           complement(209404..210252) [849 nt, 283 aa]
          Length = 282

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 47/92 (51%), Gaps = 4/92 (4%)

Query: 683 SIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNIEQLRFDYFIPN--SLEIWMASLNHINL 740
           +I++S  G+  I  +F++ V  ++T + F +N E+L  DY   +   L+ W + +  INL
Sbjct: 130 NIEDSLKGKISIVKIFTNPVAEKMT-DSFTKN-EELDVDYANKDFEKLKDWNSQIVEINL 187

Query: 741 ISLKCSMIVLKKFLHGPLLIALPHLLPWCYFI 772
           I  K   I+ K F    L   +P  L   YF+
Sbjct: 188 IDSKAKEIIFKLFGMSKLRKLVPSFLHKNYFL 219

>NDAI0B05130 Chr2 complement(1254612..1257089) [2478 bp, 825 aa] {ON}
            Anc_1.256
          Length = 825

 Score = 33.9 bits (76), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 17/120 (14%)

Query: 1138 HFAHIYKLASNHVLKFAVCLTTFQELRF------LRKSKDANVVEASTRAIITMRQLYSD 1191
            H + I KL+ N V    V +    +         LRK +   V++   +  I  R+ + +
Sbjct: 529  HLSKIKKLSKNMVKSLKVKMNNRYKFNMVLDDLDLRKRRPGPVLDRLVKKSIDRRKRHKE 588

Query: 1192 GNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTV-ENMEGT 1250
            GNLL +         +++ ++F+E +T R           MK  EK  ++ T  +N EGT
Sbjct: 589  GNLLKILLEELDPASLKDDIKFDENVTNRP----------MKTLEKERRNVTTKKNKEGT 638

>TPHA0B02220 Chr2 complement(511433..512305) [873 bp, 290 aa] {ON}
           Anc_4.253 YLR393W
          Length = 290

 Score = 33.1 bits (74), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 48/102 (47%), Gaps = 10/102 (9%)

Query: 676 AGDGSM-MSIDNSEMGEDDINNLFSDNVMNQVTSEEF---FQNIEQLRFDY-FIPNSLEI 730
           +G GS  ++I++    +  I NLFS+   N++         +NI+ L  D+  +P  ++I
Sbjct: 124 SGRGSKEINIEDKLKDKISIVNLFSNKTANELADTSLKNERRNIDYLNKDFESLPKDVQI 183

Query: 731 WMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFI 772
                  INLI  K  M++ K F    L   +P  L   YFI
Sbjct: 184 V-----QINLIDSKAKMLIFKLFAMRSLRSLIPSFLKDTYFI 220

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 129,980,612
Number of extensions: 5774572
Number of successful extensions: 17101
Number of sequences better than 10.0: 47
Number of HSP's gapped: 17350
Number of HSP's successfully gapped: 90
Length of query: 1319
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1197
Effective length of database: 39,492,147
Effective search space: 47272099959
Effective search space used: 47272099959
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)