Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0A031605.708ON55255229830.0
NDAI0E050805.708ON55155226780.0
KNAG0C066405.708ON54753626190.0
YKR097W (PCK1)5.708ON54955226190.0
Skud_11.3375.708ON54955226070.0
Smik_11.3615.708ON54955226060.0
Suva_11.3345.708ON54853326050.0
TDEL0B021205.708ON54855225810.0
CAGL0H06633g5.708ON54453325690.0
SAKL0E15048g5.708ON54255225230.0
KLLA0A00484g5.708ON54355325110.0
ZYRO0B16456g5.708ON54855225000.0
KAFR0H001605.708ON54955324750.0
Ecym_40135.708ON54255224440.0
AFR292W5.708ON54155224420.0
KLTH0E00902g5.708ON54454223940.0
Kwal_55.196635.708ON54454223570.0
TPHA0E001705.708ON57853322970.0
Kpol_1043.755.708ON55853822890.0
TBLA0E017005.708ON57652322710.0
Suva_7.275singletonON961131642e-13
SAKL0B05126g8.762ON706119860.080
NDAI0A005601.67ON71482800.39
ZYRO0F17050g1.67ON71489780.65
KLTH0F02024g1.67ON734100770.91
CAGL0E00385g1.67ON60895751.6
TPHA0B046201.67ON72087742.0
Kpol_2000.791.67ON70786742.2
Smik_15.983.168ON71522732.8
YOL060C (MAM3)3.168ON70622732.9
Skud_15.933.168ON71822733.0
ZYRO0B04774g3.168ON69740723.9
KLTH0B01100g1.527ON1298116715.5
Suva_15.1053.168ON71746707.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0A03160
         (552 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...  1153   0.0  
NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...  1036   0.0  
KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...  1013   0.0  
YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...  1013   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...  1008   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...  1008   0.0  
Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...  1008   0.0  
TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...   998   0.0  
CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...   994   0.0  
SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...   976   0.0  
KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...   971   0.0  
ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...   967   0.0  
KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...   957   0.0  
Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...   946   0.0  
AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...   945   0.0  
KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...   926   0.0  
Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...   912   0.0  
TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...   889   0.0  
Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...   886   0.0  
TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...   879   0.0  
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    68   2e-13
SAKL0B05126g Chr2 (442475..444595) [2121 bp, 706 aa] {ON} simila...    38   0.080
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...    35   0.39 
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...    35   0.65 
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...    34   0.91 
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...    33   1.6  
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...    33   2.0  
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...    33   2.2  
Smik_15.98 Chr15 complement(178216..180363) [2148 bp, 715 aa] {O...    33   2.8  
YOL060C Chr15 complement(214017..216137) [2121 bp, 706 aa] {ON} ...    33   2.9  
Skud_15.93 Chr15 complement(173073..175229) [2157 bp, 718 aa] {O...    33   3.0  
ZYRO0B04774g Chr2 (383089..385182) [2094 bp, 697 aa] {ON} simila...    32   3.9  
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...    32   5.5  
Suva_15.105 Chr15 complement(186482..188635) [2154 bp, 717 aa] {...    32   7.2  

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
           Anc_5.708 YKR097W
          Length = 552

 Score = 1153 bits (2983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/552 (100%), Positives = 552/552 (100%)

Query: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60
           MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS
Sbjct: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60

Query: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120
           SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD
Sbjct: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120

Query: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180
           HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF
Sbjct: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180

Query: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240
           PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA
Sbjct: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240

Query: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300
           NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA
Sbjct: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300

Query: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360
           EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH
Sbjct: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360

Query: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420
           PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF
Sbjct: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420

Query: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480
           LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA
Sbjct: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480

Query: 481 KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540
           KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR
Sbjct: 481 KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540

Query: 541 ATPDVLAAGPQI 552
           ATPDVLAAGPQI
Sbjct: 541 ATPDVLAAGPQI 552

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON}
           Anc_5.708 YKR097W
          Length = 551

 Score = 1036 bits (2678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/552 (87%), Positives = 523/552 (94%), Gaps = 1/552 (0%)

Query: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60
           MSPIK S++ PID +DS  VEQ IR+EL LS+DVTTIRRNAPAA+LYEDALHER T+I+S
Sbjct: 1   MSPIKASNT-PIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISS 59

Query: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120
           +GAL+AYSG KTGRSPRDKRIVEEETSKD++WWGPVNKPCSE+TW+INRERAADYLRTRD
Sbjct: 60  TGALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRD 119

Query: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180
           HLYIVDAFAGWDP+YRIKVRVVCARAYHA+FMTNMLIRPTQEELA FGEPDFT+WNAGQF
Sbjct: 120 HLYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQF 179

Query: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240
           PAN +TQDMSSKTTIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNILTLHSSA
Sbjct: 180 PANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSA 239

Query: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300
           NQGI+NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS 
Sbjct: 240 NQGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSH 299

Query: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360
           EKEPEIF AIKYGSILENVIYD  TRVV YDD+++TENTRCAYPIE+IPSAKIPCLAD+H
Sbjct: 300 EKEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTH 359

Query: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420
           P NIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTE+GVTEPE TFSSCFGQPF
Sbjct: 360 PSNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPF 419

Query: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480
           LALHPIRYATMLA+KIS HSA+AWLINTGWTGSSYV+GGKRCPLKYTRAILDSIHDGSLA
Sbjct: 420 LALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLA 479

Query: 481 KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540
           KQ +ETLP+FNL VPT VN VPKE+LNPAKNW++GEAKY+ AVS L SLFVENFK YQD+
Sbjct: 480 KQEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDK 539

Query: 541 ATPDVLAAGPQI 552
           ATP+VLAA P+I
Sbjct: 540 ATPEVLAAAPRI 551

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON}
           Anc_5.708 YKR097W
          Length = 547

 Score = 1013 bits (2619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/536 (87%), Positives = 510/536 (95%)

Query: 15  SDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIASSGALIAYSGSKTGR 74
           +D+  VEQ IR+EL LS++V TIRRNAPAAVLYEDALHERKTVIASSGALIAYSG KTGR
Sbjct: 10  TDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTGR 69

Query: 75  SPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRDHLYIVDAFAGWDPK 134
           SP+DKRIVEEETSKDNVWWGPVNKPCSE+TW INRERAADYLRTRDHLYIVDAFAGWDPK
Sbjct: 70  SPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPK 129

Query: 135 YRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQFPANKNTQDMSSKTT 194
           YRIKVRVVCARAYHA+FMTNMLIRP++EELA FGEPDFT+WNAGQFPAN +TQDMSSK+T
Sbjct: 130 YRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKST 189

Query: 195 IEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSANQGIQNGDVTLFFG 254
           IEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSANQGI+NGDVTLFFG
Sbjct: 190 IEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFG 249

Query: 255 LSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAIKYGS 314
           LSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLSAEKEPEIF+AI++GS
Sbjct: 250 LSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGS 309

Query: 315 ILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGV 374
           +LENV YD+ +  VDYDD++ITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGV
Sbjct: 310 VLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGV 369

Query: 375 LPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYATMLAE 434
           LPPV+KL+PEQVMYHFISGYTSKMAGTE+GVTEPE TFSSCFGQPFLALHPIRYA MLA 
Sbjct: 370 LPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAA 429

Query: 435 KISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLAKQSYETLPIFNLSV 494
           K+S H A+A+LINTGWTGSSYV+GGKRCPLKYTRAILD+IHDGSLA+ +YE+LPIFNL V
Sbjct: 430 KMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEV 489

Query: 495 PTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDRATPDVLAAGP 550
           PTAVNGVP E+LNPAKNW++GEAKY+ AVS L SLFVENFK YQD+ATPDVLAAGP
Sbjct: 490 PTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAGP 545

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
           PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
           gluconeogenesis, catalyzes early reaction in
           carbohydrate biosynthesis, glucose represses
           transcription and accelerates mRNA degradation,
           regulated by Mcm1p and Cat8p, located in the cytosol
          Length = 549

 Score = 1013 bits (2619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/552 (85%), Positives = 516/552 (93%), Gaps = 4/552 (0%)

Query: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60
           MSP K++++    +  +  VEQ IR+EL LS++VTTIRRNAPAAVLYED L E KTVI+S
Sbjct: 1   MSPSKMNAT----VGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISS 56

Query: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120
           SGALIAYSG KTGRSP+DKRIVEE TSKD +WWGPVNKPCSE+TW+INRERAADYLRTRD
Sbjct: 57  SGALIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRD 116

Query: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180
           H+YIVDAFAGWDPKYRIKVRVVCARAYHA+FMTNMLIRPT+EELA FGEPDFT+WNAGQF
Sbjct: 117 HIYIVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQF 176

Query: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240
           PAN +TQDMSSK+TIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSA
Sbjct: 177 PANLHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSA 236

Query: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300
           NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLSA
Sbjct: 237 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSA 296

Query: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360
           EKEPEIF+AIK+GS+LENVIYD+ + VVDYDD+SITENTRCAYPI+YIPSAKIPCLADSH
Sbjct: 297 EKEPEIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSH 356

Query: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420
           PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTE+GVTEPE TFSSCFGQPF
Sbjct: 357 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPF 416

Query: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480
           LALHPIRYATMLA K+S H A+A+LINTGWTGSSYV+GGKRCPLKYTRAILDSIHDGSLA
Sbjct: 417 LALHPIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLA 476

Query: 481 KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540
            ++YETLPIFNL VPT VNGVP E+LNPAKNWS+GE+KY  AV+ L +LFV+NFK YQDR
Sbjct: 477 NETYETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDR 536

Query: 541 ATPDVLAAGPQI 552
           ATPDVLAAGPQ 
Sbjct: 537 ATPDVLAAGPQF 548

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score = 1008 bits (2607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/552 (85%), Positives = 514/552 (93%), Gaps = 4/552 (0%)

Query: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60
           MSP K+ ++       +  VEQ IR+EL LS++VTTIRRNAPAAVLYED L E+KTVI+S
Sbjct: 1   MSPSKMHAT----TGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISS 56

Query: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120
           SGALIAYSG KTGRSP+DKRIVEE TSKD +WWGPVNKPCSE+TW+INRERAADYLRTRD
Sbjct: 57  SGALIAYSGVKTGRSPKDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRD 116

Query: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180
           H+YIVDAFAGWDPKYRIKVRVVCARAYHA+FMTNMLIRPT+EELA FGEPDFT+WNAGQF
Sbjct: 117 HIYIVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQF 176

Query: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240
           PAN +TQDMSSK+TIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSA
Sbjct: 177 PANLHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSA 236

Query: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300
           NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLSA
Sbjct: 237 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSA 296

Query: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360
           EKEPEIF+AIK+G++LENV YD+ + VVDYDD+SITENTRCAYPI+YIPSAKIPCLADSH
Sbjct: 297 EKEPEIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSH 356

Query: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420
           PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTE+GVTEPE TFSSCFGQPF
Sbjct: 357 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPF 416

Query: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480
           LALHPIRYATMLA K+SHH ++A+LINTGW+GSSYV+GGKRCPLKYTRAILDSIHDGSLA
Sbjct: 417 LALHPIRYATMLATKMSHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLA 476

Query: 481 KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540
            ++YE+LPIFNL VPT V GVP E+LNPAKNWS+GEAKY  +V+ L +LFVENFK YQDR
Sbjct: 477 NETYESLPIFNLQVPTKVKGVPAELLNPAKNWSQGEAKYKGSVTNLANLFVENFKIYQDR 536

Query: 541 ATPDVLAAGPQI 552
           ATPDVLAAGPQ 
Sbjct: 537 ATPDVLAAGPQF 548

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score = 1008 bits (2606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/552 (85%), Positives = 513/552 (92%), Gaps = 4/552 (0%)

Query: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60
           MSP K++ +    +  +  VEQ IR+EL LS++VTTIRRNAPAAVLYED L E+KTVI+S
Sbjct: 1   MSPSKMNCT----VGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISS 56

Query: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120
           SGALIAYSG KTGRSP+DKRIVEE TSKD +WWGPVNKPCSE+TW+INRERAADYLRTRD
Sbjct: 57  SGALIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRD 116

Query: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180
           H+YIVDAFAGWDPKYRIKVRVVCARAYHA+FMTNMLIRPT+EELA FGEPDFT+WNAGQF
Sbjct: 117 HIYIVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQF 176

Query: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240
           PAN +TQDMSSK+TIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSA
Sbjct: 177 PANLHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSA 236

Query: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300
           NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLSA
Sbjct: 237 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSA 296

Query: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360
           EKEPEIF+AIK+G++LENV YD+ + VVDYDD+SITENTRCAYPI+YIPSAKIPCLADSH
Sbjct: 297 EKEPEIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSH 356

Query: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420
           PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTE+GVTEPE TFSSCFGQPF
Sbjct: 357 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPF 416

Query: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480
           LALHPIRYATMLA K+S H A+A+LINTGWTGSSYV+GGKRCPLKYTRAILDSIHDGSLA
Sbjct: 417 LALHPIRYATMLAAKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLA 476

Query: 481 KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540
            ++YE+LPIFNL VPT V GVP E+LNPAKNWS+GE KY  AV+ L +LFVENFK YQDR
Sbjct: 477 NETYESLPIFNLQVPTKVKGVPAELLNPAKNWSQGETKYKGAVTSLATLFVENFKIYQDR 536

Query: 541 ATPDVLAAGPQI 552
           ATPDVLAAGPQ 
Sbjct: 537 ATPDVLAAGPQF 548

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
           (REAL)
          Length = 548

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/533 (87%), Positives = 505/533 (94%)

Query: 20  VEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIASSGALIAYSGSKTGRSPRDK 79
           VEQ IR+EL LS++VTTIRRNAPAAVLYED L E+KTVI+SSGALIAYSG KTGRSP+DK
Sbjct: 16  VEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIAYSGVKTGRSPKDK 75

Query: 80  RIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRDHLYIVDAFAGWDPKYRIKV 139
           RIVEE TSKD +WWGPVNKPCSE+TW+INRERAADYLRTRDH+YIVDAFAGWDPKYRIKV
Sbjct: 76  RIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYRIKV 135

Query: 140 RVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQFPANKNTQDMSSKTTIEINF 199
           RVVCARAYHA+FMTNMLIRPT+EELA FGEPDFT+WNAGQFPAN +TQDMSSK+TIEINF
Sbjct: 136 RVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIEINF 195

Query: 200 KAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSANQGIQNGDVTLFFGLSGTG 259
           KAMEMIILGTEYAGEMKKGIFTVMFYLMPV+HNILTLHSSANQGI+NGDVTLFFGLSGTG
Sbjct: 196 KAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIKNGDVTLFFGLSGTG 255

Query: 260 KTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAIKYGSILENV 319
           KTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLSAEKEPEIF+AI++G++LENV
Sbjct: 256 KTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGAVLENV 315

Query: 320 IYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPVS 379
            YD+N+ VVDYDD+SITENTRCAYPI+YIPSAKIPCLADSHPKNIILLTCDASGVLPPVS
Sbjct: 316 KYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLPPVS 375

Query: 380 KLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYATMLAEKISHH 439
           KLTPEQVMYHFISGYTSKMAGTE+GVTEPE TFSSCFGQPFLALHPIRYATMLA K+S H
Sbjct: 376 KLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSQH 435

Query: 440 SADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLAKQSYETLPIFNLSVPTAVN 499
            A+A+LINTGWTGSSYV+GG RC LKYTRAILDSIHDGSLAK SYE+LPIFNL VPT VN
Sbjct: 436 RANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASYESLPIFNLQVPTKVN 495

Query: 500 GVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDRATPDVLAAGPQI 552
           GVP E+LNPAKNWS+GEAKY  AV+ L +LFVENFK YQDRATPDVLAAGPQ 
Sbjct: 496 GVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPDVLAAGPQF 548

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
           Anc_5.708 YKR097W
          Length = 548

 Score =  998 bits (2581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/552 (84%), Positives = 510/552 (92%), Gaps = 4/552 (0%)

Query: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60
           MSP K++ S    ++D   VEQ IR EL LS +V TIRRNAPAA+LYEDAL+E+KT IAS
Sbjct: 1   MSPSKMNRS----VTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIAS 56

Query: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120
           SGALIAYSG KTGRSP+DKRI+EEETSKDN+WWGPVNKP  EKTW+INRERAADYLRTR 
Sbjct: 57  SGALIAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRT 116

Query: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180
           HLYIVDAFAGWDP+YRIKVRVVCARAYHA+FMTNMLIRPT EELA FGEPDFT+WNAGQF
Sbjct: 117 HLYIVDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQF 176

Query: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240
           PAN +TQ MSSKTT+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSA
Sbjct: 177 PANYHTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSA 236

Query: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300
           NQGIQ  DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI L+A
Sbjct: 237 NQGIQKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTA 296

Query: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360
           EKEPEI+NAIK+GSILENV+YD  TR VDY+D+SITENTRCAYPIE+IPSAKIPCLADSH
Sbjct: 297 EKEPEIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSH 356

Query: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420
           P+N++LLTCDASGVLPP+SKLTPEQVMYHFISGYTSKMAGTE+GVTEPE+TFSSCFGQPF
Sbjct: 357 PQNLVLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPF 416

Query: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480
           LALHPIRYATMLA+K+S H A+AWLINTGWTGSSYV GGKRCPLKYTRAILD+IHDGSLA
Sbjct: 417 LALHPIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLA 476

Query: 481 KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540
           K+SYETLP FNL +PT VNGVPKE+LNP+KNW EGEAKY+TAV+ L  LFVENFK YQDR
Sbjct: 477 KESYETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDR 536

Query: 541 ATPDVLAAGPQI 552
           ATP+VLAAGPQ+
Sbjct: 537 ATPEVLAAGPQV 548

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097w PCK1
          Length = 544

 Score =  994 bits (2569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/533 (85%), Positives = 501/533 (93%)

Query: 20  VEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIASSGALIAYSGSKTGRSPRDK 79
           VE+ IR ELGLS++VT IRRNAPAAVLY+DAL E+KTVI+S+GALIAYSG KTGRSP+DK
Sbjct: 12  VEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRSPKDK 71

Query: 80  RIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRDHLYIVDAFAGWDPKYRIKV 139
           RIVEEETS+DNVWWGPVNKPCSE+TW INRERAADYLRTR+ LY+VDAFAGWDPKYRIKV
Sbjct: 72  RIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYRIKV 131

Query: 140 RVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQFPANKNTQDMSSKTTIEINF 199
           RVVCARAYHA+FMTNMLIRPT+EELA FGEPDFT+WNAGQFPAN  TQDM+SKTTIEINF
Sbjct: 132 RVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIEINF 191

Query: 200 KAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSANQGIQNGDVTLFFGLSGTG 259
           KAMEM+ILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSS NQGI+NGDVTLFFGLSGTG
Sbjct: 192 KAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSGTG 251

Query: 260 KTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAIKYGSILENV 319
           KTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKEPEIF+AI++GS+LENV
Sbjct: 252 KTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLENV 311

Query: 320 IYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPVS 379
           IYD  +  VDYDD+SITENTRCAYPI++IPSAKIPCLA +HPKNIILLTCDASGVLPPVS
Sbjct: 312 IYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPPVS 371

Query: 380 KLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYATMLAEKISHH 439
           KLTPEQVMYHFISGYTSKMAGTE+GVTEPE TFSSCFGQPFL+LHP+RYATMLAEK+  H
Sbjct: 372 KLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMHEH 431

Query: 440 SADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLAKQSYETLPIFNLSVPTAVN 499
           SA+AWLINTGWTGSSYV+GGKRC LKYTRAILD+IHDGSLAK  +E+LPIFNL VP AV 
Sbjct: 432 SANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKAVE 491

Query: 500 GVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDRATPDVLAAGPQI 552
           GVP E+LNPA+NWSEGEAKY +AVSKL  LFVENFKTYQD+AT DVLAAGPQ+
Sbjct: 492 GVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 542

 Score =  976 bits (2523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/552 (82%), Positives = 499/552 (90%), Gaps = 10/552 (1%)

Query: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60
           MSP K  +S           EQ IR EL LS++V TIRRNAPAA+LYEDAL ERKT I+S
Sbjct: 1   MSPSKTYAS----------AEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISS 50

Query: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120
           SGALIAYSG KTGRSPRDKRIV+E TS DNVWWGPVNK CSE+TW INRERAADYLRTRD
Sbjct: 51  SGALIAYSGEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRD 110

Query: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180
           HLYIVDA+AGWDP+YRIKVRVVCARAYHA+FMTNMLIRPT++ELA FGEPDFT+WNAGQF
Sbjct: 111 HLYIVDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQF 170

Query: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240
           PAN +T  M+SKTT+EINFK MEMIILGTEYAGEMKKGIFTVMFYLMPV HN+LTLHSSA
Sbjct: 171 PANTHTTGMTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSA 230

Query: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300
           NQGI + DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCI LSA
Sbjct: 231 NQGIADNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSA 290

Query: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360
           EKEPEI+NAIK+GS+LENVIY+  TR VDY+D+SITENTRCAYPI+YIPSAKIPCLAD+H
Sbjct: 291 EKEPEIYNAIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNH 350

Query: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420
           P NI+LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTE+GVTEPE+TFSSCFGQPF
Sbjct: 351 PSNIVLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPF 410

Query: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480
           LALHP++YATMLAEK++ H+A+AWLINTGWTGSSYV+GGKRCPLKYTRAILDSIHDGSLA
Sbjct: 411 LALHPMKYATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLA 470

Query: 481 KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540
           K+ YETLP FNL +PT VN VP E+LNPAKNW EGEAKY++AV  L  LFVENFKTYQDR
Sbjct: 471 KEKYETLPTFNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDR 530

Query: 541 ATPDVLAAGPQI 552
           AT  VL+AGPQ+
Sbjct: 531 ATSQVLSAGPQL 542

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 543

 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/553 (81%), Positives = 502/553 (90%), Gaps = 11/553 (1%)

Query: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60
           MSP K  +S           E++IR ELGLS +V TIRRNAPAA+LYEDAL ER T I++
Sbjct: 1   MSPTKTQNS----------AEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISN 50

Query: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120
           +GALIAYSG KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSE+TW INRERAADYLRTRD
Sbjct: 51  AGALIAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRD 110

Query: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180
           H+YIVDA+AGWDP+YRIKVRVVCARAYHA+FMTNMLIRP++EEL  FGEPDFT+WNAGQF
Sbjct: 111 HIYIVDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQF 170

Query: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240
           PAN +T  M+SKTT+EINFK MEM+ILGTEYAGEMKKGIFTVMFYLMPV HN+LTLHSSA
Sbjct: 171 PANTHTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSA 230

Query: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300
           NQGIQ+ DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKC+ LSA
Sbjct: 231 NQGIQDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSA 290

Query: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360
           EKEPEIFNAIK+GS+LEN+IYD NTR VDY+D++ITENTRCAYPIEYIPSAKIPCLAD H
Sbjct: 291 EKEPEIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHH 350

Query: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420
           PKNI+LLTCDASGVLPPVSKLTP+QVMYHFISGYTSKMAGTE+GVTEPE+TFSSCFGQPF
Sbjct: 351 PKNIVLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPF 410

Query: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480
           L+LHP++YATMLAEK++ H+A+AWLINTGWTGSSYV GGKRCPLKYTRAILD+IHDGSLA
Sbjct: 411 LSLHPMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLA 470

Query: 481 KQSYETLPIFNLSVPTAV-NGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQD 539
           K+ YE LPIFNL +P AV + VP  +LNP+KNW+EGEAKY++ V  L +LFVENFKTYQD
Sbjct: 471 KEEYEVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQD 530

Query: 540 RATPDVLAAGPQI 552
           +AT  VLAAGPQ+
Sbjct: 531 KATEQVLAAGPQL 543

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 548

 Score =  967 bits (2500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/552 (80%), Positives = 495/552 (89%), Gaps = 4/552 (0%)

Query: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60
           MSP KV    P+ I+D+  VE+ IRKEL L  +V TIR NAPAA LYED L E+KT + S
Sbjct: 1   MSPSKV----PVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVS 56

Query: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120
           SGAL AYSGSKTGRSP+DKRI+EEETSK+ VWWGPVNKP SEKTW+INRERAADYLRTRD
Sbjct: 57  SGALAAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRD 116

Query: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180
           HLYI+DA+AGWDP+YRIKVRV+CARAYHA+FMTNMLIRP+ EELA FGEPDFT+WNAGQF
Sbjct: 117 HLYIIDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQF 176

Query: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240
           PAN+NT+ M+SKTT+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSA
Sbjct: 177 PANRNTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSA 236

Query: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300
           NQGI+ GDVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI+L+A
Sbjct: 237 NQGIERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTA 296

Query: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360
           EKEPEI+NAIK+GS+LENV++D + R VDY D SITENTRCAYPI+YIPSAKIPCLAD H
Sbjct: 297 EKEPEIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKH 356

Query: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420
           P NI+LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTE+GVTEPE+TFSSCFGQPF
Sbjct: 357 PSNIVLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPF 416

Query: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480
           LALHP+RYATMLA+K+  H+A+AWL+NTGWTGSSY  GGKRCPLKYTRAILDSIHDGSL+
Sbjct: 417 LALHPMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLS 476

Query: 481 KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540
           K  YETLPIFNL  P  VNGVP  +LNPAK+W EG  KY++AV  L + F ENFK YQD+
Sbjct: 477 KADYETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQ 536

Query: 541 ATPDVLAAGPQI 552
           ATPDVLAAGPQ 
Sbjct: 537 ATPDVLAAGPQF 548

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
           Anc_5.708 YKR097W
          Length = 549

 Score =  957 bits (2475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/553 (80%), Positives = 501/553 (90%), Gaps = 5/553 (0%)

Query: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALH-ERKTVIA 59
           MSP KV++     + D   VEQ IR+EL LS  VTTIRRNAP +VLYEDAL  E+ T+I+
Sbjct: 1   MSPSKVTTP----LKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIIS 56

Query: 60  SSGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTR 119
           S+GALIAYSG KTGR P+DKRIVEE  SK+++WWGPVNKPCSE+TW INRERAADYLRTR
Sbjct: 57  STGALIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTR 116

Query: 120 DHLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQ 179
           +H+YIVDAFAGWDPKYRIKVRVVCARAYHA+FMTNMLIRPT++EL  FG+PDFT+WNAGQ
Sbjct: 117 EHIYIVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQ 176

Query: 180 FPANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSS 239
           FPAN +T+DMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP++HN+LTLHSS
Sbjct: 177 FPANFHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSS 236

Query: 240 ANQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLS 299
           AN+GI+  DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLS
Sbjct: 237 ANEGIEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLS 296

Query: 300 AEKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADS 359
            EKEPEIFN+IK+GSILENV+YD  +R VDYDD+SITENTRCAYPIE+IPSAKIPC+A+S
Sbjct: 297 VEKEPEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANS 356

Query: 360 HPKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQP 419
           HPKNIILLTCDASGVLPPVSKLT +QVMYHFISGYTSKMAGTE+GVTEP+ TFSSCFGQP
Sbjct: 357 HPKNIILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQP 416

Query: 420 FLALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSL 479
           FLALHP++YATMLAEK+  H A+AWLINTGWTGSSY+ GGKRCPL YTRAILD+IHDGSL
Sbjct: 417 FLALHPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSL 476

Query: 480 AKQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQD 539
            K+S+ETLPIFNL VP  VN VP ++LNP+KNW EGE KYS AV KL  LF+ENFKTY+D
Sbjct: 477 EKESFETLPIFNLKVPKNVNNVPTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYED 536

Query: 540 RATPDVLAAGPQI 552
           +AT +VLAAGP++
Sbjct: 537 KATKEVLAAGPRL 549

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AFR292W
          Length = 542

 Score =  946 bits (2444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/552 (79%), Positives = 491/552 (88%), Gaps = 10/552 (1%)

Query: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60
           MSP KV  S           E+ IR ELGLS  V  IRRNAPAA+LYEDAL ER T I+S
Sbjct: 1   MSPSKVFQSP----------EEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISS 50

Query: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120
           +GALIAYSG KTGRSP+DKRIV+E TS + VWWGPVN+  SE+TW INRERA DYLRTR+
Sbjct: 51  TGALIAYSGEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTRE 110

Query: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180
           HLYIVDAFAGWDP+YRIK+R+VC RAYHA+FMTNMLIRPT+EELA FGEPDFT+WNAGQF
Sbjct: 111 HLYIVDAFAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQF 170

Query: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240
           PAN +T+ MSSKTT+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP+ HN+LTLHSSA
Sbjct: 171 PANTHTEGMSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSA 230

Query: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300
           NQGI  GDVTLFFGLSGTGKTTLSAD HRLLIGDDEHCWSD GVFNIEGGCYAKCI LSA
Sbjct: 231 NQGIAKGDVTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSA 290

Query: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360
           EKEPEIFNAI+YGS+LENV+Y+  +RVVDYDD+SITENTRCAYPIEYIPSAKIPCL++SH
Sbjct: 291 EKEPEIFNAIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSH 350

Query: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420
           P NI+LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTE+GVTEPE+TFSSCFGQPF
Sbjct: 351 PSNIVLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPF 410

Query: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480
           LALHP++YATMLAEK+S H+A+AWLINTGWTG+SYV+GGKRCPLKYTRAILD+IH GSLA
Sbjct: 411 LALHPMKYATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLA 470

Query: 481 KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540
              YETLP+F LS+P AV GVP E+LNP++NW EGE KYS AV+ L +LFV+NFK YQD+
Sbjct: 471 NADYETLPVFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQ 530

Query: 541 ATPDVLAAGPQI 552
           AT +VL AGPQ+
Sbjct: 531 ATKEVLYAGPQL 542

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score =  945 bits (2442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/552 (79%), Positives = 490/552 (88%), Gaps = 11/552 (1%)

Query: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60
           MSP KV           Q  E+ IR ELGLS  V TIRRNAPAAVLYEDAL ERKT I+S
Sbjct: 1   MSPSKVY----------QTPEEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISS 50

Query: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120
           +GALIAYSG KTGRSP+DKRIV+E TS DN+WWGPVN+  SEKTW INRERAAD+LRTR+
Sbjct: 51  TGALIAYSGEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTRE 110

Query: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180
           HLYIVDA+AGWDP+YRIK+R+VC RAYHA+FMTNMLIRPT+EELA FGEPDFT+WNAGQF
Sbjct: 111 HLYIVDAYAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQF 170

Query: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240
           PAN +T+ MSSKTT+EINF+AMEM+ILGTEYAGEMKKGIFTVMFYLMP+ HN+LTLHSSA
Sbjct: 171 PANTHTEGMSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSA 230

Query: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300
           NQG  N DVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD GVFNIEGGCYAKCI LS 
Sbjct: 231 NQG-PNNDVTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSG 289

Query: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360
           EKEPEIFNAIKYGS+LENV+YD  TRVVDY+D+SITENTRCAYPIEYIPSA+IPCL+++H
Sbjct: 290 EKEPEIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENH 349

Query: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420
           P NI+LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTE+GVTEPE+TFSSCFGQPF
Sbjct: 350 PSNIVLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPF 409

Query: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480
           LALHP++YATMLAEK+S H+A AWLINTGWTGSSY  GGKRCPLKYTRAILDSIHDG+LA
Sbjct: 410 LALHPMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLA 469

Query: 481 KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540
           +  YETLP+F LS+P AV GVP E+LNPAKNW EGE KY++AVS L S F ENFK YQD+
Sbjct: 470 QAEYETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQ 529

Query: 541 ATPDVLAAGPQI 552
           AT +V+ AGPQI
Sbjct: 530 ATEEVVRAGPQI 541

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 544

 Score =  926 bits (2394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/542 (78%), Positives = 477/542 (88%)

Query: 11  PIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIASSGALIAYSGS 70
           P    +    +  IR+EL L E+V TIRRNAPAA+LYEDAL E KT IASSGALIA+SGS
Sbjct: 3   PTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFSGS 62

Query: 71  KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRDHLYIVDAFAG 130
           KTGRSP+DKRIV+E TS  N+WWGPVNK CSEKTW +NRERAADYLRTRDHLYIVDA+AG
Sbjct: 63  KTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAYAG 122

Query: 131 WDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQFPANKNTQDMS 190
           WDP+YRIK+RVVCARAYHA+FMTNMLIRPT+EEL  FGEPDFT+WNAGQFPAN +T  M+
Sbjct: 123 WDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDGMT 182

Query: 191 SKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSANQGIQNGDVT 250
           SKTT+EINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMPV HN+LTLHSSANQGI++ DVT
Sbjct: 183 SKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQDVT 242

Query: 251 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAI 310
           LFFGLSGTGKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  KEPEIFNAI
Sbjct: 243 LFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAI 302

Query: 311 KYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCD 370
           K+GS+LENV YD  TRVVDY+D  ITENTRCAYPIEYIPSAKIPCLA+SHPKNI+LLTCD
Sbjct: 303 KFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLTCD 362

Query: 371 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYAT 430
           ASGVLPPVSKLTP QVMYHFISGYTSK+AGTEEGVTEPE+TFSSCFGQPFLALHP++YAT
Sbjct: 363 ASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYAT 422

Query: 431 MLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLAKQSYETLPIF 490
           MLAEK+S H A+AWLINTGWTG+S+V+GG RCPLKYTRAILD++HDGSLA++ +ETLP F
Sbjct: 423 MLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLPTF 482

Query: 491 NLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDRATPDVLAAGP 550
            L VP  VN VP+ ILNPAKNW EGE KY   V  L  LF ENFK YQDRA+ DV++AGP
Sbjct: 483 RLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISAGP 542

Query: 551 QI 552
            +
Sbjct: 543 VL 544

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
           YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
           [contig 159] FULL
          Length = 544

 Score =  912 bits (2357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/542 (77%), Positives = 476/542 (87%)

Query: 11  PIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIASSGALIAYSGS 70
           P  I +   V+  IRKEL L E+V TIRRNAPAA+LYEDAL E KT I++SGALIA+SGS
Sbjct: 3   PSKIRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFSGS 62

Query: 71  KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRDHLYIVDAFAG 130
           KTGRSP+DKRIV+E TS  N+WWGPVNK CSEKTW +NRERAAD+LRTRDHLYIVDA+AG
Sbjct: 63  KTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAYAG 122

Query: 131 WDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQFPANKNTQDMS 190
           WDP+YRIK+RVVCARAYHA+FMTNMLI+PT +EL  FGEPDFT+WNAGQFPAN +T  M+
Sbjct: 123 WDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDGMT 182

Query: 191 SKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSANQGIQNGDVT 250
           SKTTIEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP+ H +LTLHSSANQGI++ DVT
Sbjct: 183 SKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDNDVT 242

Query: 251 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAI 310
           LFFGLSGTGKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  KEPEIFNAI
Sbjct: 243 LFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAI 302

Query: 311 KYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCD 370
           ++GS+LENV YD  TR VD+++  ITENTRCAYPIEYIPSAKIPCLAD HPKNI+LLTCD
Sbjct: 303 RFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLTCD 362

Query: 371 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYAT 430
           ASGVLPPVSKLTPEQVMYHFISGYTSK+AGTEEGVTEPE+TFSSCFGQPFLALHP++YAT
Sbjct: 363 ASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYAT 422

Query: 431 MLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLAKQSYETLPIF 490
           MLA+K+SHH ADAWLINTGWTG S+V+GG RCPLKYTRAILD+IHDG+LAK+ YETLP F
Sbjct: 423 MLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLPTF 482

Query: 491 NLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDRATPDVLAAGP 550
           NL +P  VN VP  ILNPA++W  GEAKY T V  L +LFVENFK Y+  A+ +++ AGP
Sbjct: 483 NLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCAGP 542

Query: 551 QI 552
            +
Sbjct: 543 LL 544

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
           Anc_5.708 YKR097W
          Length = 578

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/533 (75%), Positives = 460/533 (86%), Gaps = 1/533 (0%)

Query: 18  QIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIASSGALIAYSGSKTGRSPR 77
           +++E+ I   L  +  +  I+RN P A LYED L E KT ++S+GALIAYSG KTGRSP+
Sbjct: 45  KLLEEFISDNLS-NHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPK 103

Query: 78  DKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRDHLYIVDAFAGWDPKYRI 137
           DKRIVEEE SKDN+WWGPVNK CSE+TW INRERA DYL TRD LY++DAF GWDP+YRI
Sbjct: 104 DKRIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRI 163

Query: 138 KVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQFPANKNTQDMSSKTTIEI 197
           K+RVVCARAYHA+FM NMLIRPT+EEL  FG+PDFT+WNAGQF AN  T DMSSKT++EI
Sbjct: 164 KIRVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEI 223

Query: 198 NFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSANQGIQNGDVTLFFGLSG 257
           NFK MEM ILGTEYAGEMKKGIFTVMFYLMP+YHN+LTLHSSANQ   NGDVTLFFGLSG
Sbjct: 224 NFKEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSG 283

Query: 258 TGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAIKYGSILE 317
           TGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI LS EKEP+IFNAIK+GS+LE
Sbjct: 284 TGKTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLE 343

Query: 318 NVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPP 377
           N IYD+ T  VDYD+++ITENTRCAYPI+YI +AKIPCLAD HP N+ILLTCDASGVLPP
Sbjct: 344 NCIYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPP 403

Query: 378 VSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYATMLAEKIS 437
           VSKLTPEQVMYHFISGYTSKMAGTE GVTEP+ TFSSCFGQPFLALHP++YA+MLAEK+ 
Sbjct: 404 VSKLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMD 463

Query: 438 HHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLAKQSYETLPIFNLSVPTA 497
            H A+AWL+NTGWTGSSYV+GG RCPLKYTRAILD+IHDGSL  + YETLPIFNL +P  
Sbjct: 464 KHKANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKN 523

Query: 498 VNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDRATPDVLAAGP 550
            NGVP E+LNPA +W++    Y TAV +LG LF ENFKTY+D+AT +V+ AGP
Sbjct: 524 ANGVPSELLNPAGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGP 576

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
           (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/538 (76%), Positives = 467/538 (86%), Gaps = 2/538 (0%)

Query: 15  SDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIASSGALIAYSGSKTGR 74
           S+S +   ++ K L  ++D+T I+RN P A LYED L E  T ++S+GAL+AYSG KTGR
Sbjct: 23  SNSNVKLDNVMKCL-YNKDIT-IKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGR 80

Query: 75  SPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRDHLYIVDAFAGWDPK 134
           SP+DKRIVEE +SKDN+WWGPVNKPCSE TW+INRERA DYL TR  LY++DA+AGWD  
Sbjct: 81  SPKDKRIVEEPSSKDNIWWGPVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDAN 140

Query: 135 YRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQFPANKNTQDMSSKTT 194
           YRIK+RVVCAR YHA+FM NMLIRPT EEL  FGEPDFTIWNAG F AN  T+DM+SKT+
Sbjct: 141 YRIKIRVVCARPYHALFMNNMLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTS 200

Query: 195 IEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSANQGIQNGDVTLFFG 254
           IEINFK+MEM+ILGTEYAGEMKKGIFTVMFYLMPVYHN+LTLHSSANQG+ NGDVTLFFG
Sbjct: 201 IEINFKSMEMVILGTEYAGEMKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFG 260

Query: 255 LSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAIKYGS 314
           LSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI L+ EKEPEIFNAIK+GS
Sbjct: 261 LSGTGKTTLSADPHRELIGDDEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGS 320

Query: 315 ILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGV 374
           +LEN +YD+NT VVDYDD+ ITENTRCAYPI++I SAKIPCL D HP N+ILLTCDASGV
Sbjct: 321 VLENCVYDENTHVVDYDDSRITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGV 380

Query: 375 LPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYATMLAE 434
           LPPVSKLTPEQVMYHFISGYTSKMAGTE+GVTEPE TFS+CFGQPFLALHP++YA MLA+
Sbjct: 381 LPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLAD 440

Query: 435 KISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLAKQSYETLPIFNLSV 494
           K++HH A AWLINTGWTG+SY  GGKRCPLKYTRAILD+IH+GSLA + YETLP+FNL +
Sbjct: 441 KMNHHKASAWLINTGWTGASYTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPI 500

Query: 495 PTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDRATPDVLAAGPQI 552
           P  V  VP E+LNP+K WS+ +  YS AV KLGSLFV+NF  YQD+AT DV+AAGP +
Sbjct: 501 PKNVENVPSELLNPSKTWSDPDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
           Anc_5.708 YKR097W
          Length = 576

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/523 (77%), Positives = 463/523 (88%), Gaps = 4/523 (0%)

Query: 34  VTTIRRNAPAAVLYEDALHERKTVIASSGALIAYSGSKTGRSPRDKRIVEEETSKDNVWW 93
           +  I+ N  AA+LYEDAL E KTVI+SSGALIAYSG+KTGRSP+DKRIV E+ SKDNVWW
Sbjct: 54  LINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGAKTGRSPKDKRIVYEDGSKDNVWW 113

Query: 94  GPVNKPCSEKTWTINRERAADYLRTRDHLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMT 153
           GPVNKPCSEKTW INRER  DYL TR +LY++DA+ GWDP+YR+KVRVVCARAYHA+FMT
Sbjct: 114 GPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRYRLKVRVVCARAYHALFMT 173

Query: 154 NMLIRPTQEELATFGEPDFTIWNAGQFPANKNTQDMSSKTTIEINFKAMEMIILGTEYAG 213
           NMLIRPT+EEL  F EPDFT+WNAG F AN  T DM+SKT++EINFKAMEMIILGTEYAG
Sbjct: 174 NMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSVEINFKAMEMIILGTEYAG 233

Query: 214 EMKKGIFTVMFYLMPVYHNILTLHSSANQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIG 273
           EMKKGIFTVMFYLMP++HNILTLHSSAN+GI+  DVT+FFGLSGTGKTTLSADP+RLLIG
Sbjct: 234 EMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGLSGTGKTTLSADPNRLLIG 293

Query: 274 DDEHCWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAIKYGSILENVIYDKNTRVVDYDDT 333
           DDEHCWSD GVFNIEGGCYAKCI L+ EKEPEIF+AI++GS+LENV Y++    VDY+D 
Sbjct: 294 DDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSVLENVTYNELNHKVDYNDC 353

Query: 334 SITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPVSKLTPEQVMYHFISG 393
           +ITENTRCAYPI+YI SAKIPCLA+SHPKN+ILLTCDASGVLPPVSKLTPEQVMYHFISG
Sbjct: 354 AITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVLPPVSKLTPEQVMYHFISG 413

Query: 394 YTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYATMLAEKISHHSADAWLINTGWTGS 453
           YTSKMAGTE+GVTEPE+TFSSCFGQPFLALHPI YATMLA+K+  + ++AWLINTGWTGS
Sbjct: 414 YTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAKKMDQYKSNAWLINTGWTGS 473

Query: 454 SYVNGGKRCPLKYTRAILDSIHDGSLAKQSYETLPIFNLSVPTAVNGVPKEILNPAKNWS 513
           SY  GG RCPLKYTRAILD+IHDG+LA ++YETLP+FNL +PT VNGVP EILNP  +W+
Sbjct: 474 SYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQIPTHVNGVPNEILNPENSWN 533

Query: 514 EGEAK----YSTAVSKLGSLFVENFKTYQDRATPDVLAAGPQI 552
               K    Y+ AV+KL +LFVENFK YQD+AT DVLAAGPQ+
Sbjct: 534 SPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGPQV 576

>Suva_7.275 Chr7
           complement(476201..476281,476285..476410,476414..476494)
           [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 67.8 bits (164), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/113 (41%), Positives = 59/113 (52%), Gaps = 22/113 (19%)

Query: 381 LTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYATMLAEKISHHS 440
           LT E+VMYHF SG+ S   G         S       +PFLALHPI Y T++A K+  HS
Sbjct: 1   LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKMFAHS 58

Query: 441 ADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLAKQ-----SYETLP 488
             A+LINTG+   + VN              DSIHD SLAK+     +Y+ LP
Sbjct: 59  --AYLINTGYALKTRVN-------------FDSIHDDSLAKELFRAPTYKCLP 96

>SAKL0B05126g Chr2 (442475..444595) [2121 bp, 706 aa] {ON} similar
           to uniprot|Q05670 Saccharomyces cerevisiae YMR232W FUS2
           Cytoplasmic protein localized to the shmoo tip required
           for the alignment of parental nuclei before nuclear
           fusion during mating
          Length = 706

 Score = 37.7 bits (86), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 52/119 (43%), Gaps = 15/119 (12%)

Query: 68  SGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWT-INRERAADYL---------R 117
           + SK GR   DK I++++    N+ W   N+P  +KT++ ++  +  DY+         +
Sbjct: 100 NASKRGRDEEDKEIIQKKPPSLNLVWDAFNEPSQKKTYSPLDLHKFKDYMTLESPRIDPK 159

Query: 118 TRDHLYIVDAFAGWDPKYRIKVRV---VCARAYHA--IFMTNMLIRPTQEELATFGEPD 171
             + L  +      + KY   + +   V  R  H    F   +L + + EEL  FG  D
Sbjct: 160 LSNLLQTIQNLVETEEKYARVLEISNAVYRRELHENRKFKNKLLNKNSNEELLLFGNID 218

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 6/82 (7%)

Query: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLL-IGDDEHCWSDTGVFNIEGGCYAKCINLS 299
           N  I  G+     G SG+GK+T+++   R   + +      D  + N     Y + I  +
Sbjct: 467 NLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIGDNDIRNFSLRKYRRLIG-T 525

Query: 300 AEKEPEIFNAIKYGSILENVIY 321
            ++EP +FN    GSIL+N+IY
Sbjct: 526 VQQEPSLFN----GSILDNIIY 543

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 45/89 (50%), Gaps = 20/89 (22%)

Query: 241 NQGIQNGDVTLFFGLSGTGKTTLSA--------DPHRLLIGDDEHCWSDTGVFNIEGGCY 292
           N  IQ G+     G SG+GK+T+++        D   + IGD     +D   FN+    Y
Sbjct: 470 NLTIQPGEHICIAGPSGSGKSTIASLLVRYYDVDQGGISIGD-----TDLRTFNLRK--Y 522

Query: 293 AKCINLSAEKEPEIFNAIKYGSILENVIY 321
            + I +   +EP +FN    G+ILEN++Y
Sbjct: 523 RRLIGV-VHQEPVLFN----GTILENILY 546

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 49/100 (49%), Gaps = 20/100 (20%)

Query: 244 IQNGDVTLFFGLSGTGKTTLSA--------DPHRLLIGDDEHCWSDTGVFNIEGGCYAKC 295
           I  G+     G SG GK+T+++        D   +LIG       +   FN+    Y + 
Sbjct: 474 IDPGEHVCIVGPSGGGKSTVASLLLRFYDVDAGAILIGGQ-----NIADFNLR--KYRRL 526

Query: 296 INLSAEKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSI 335
           + +  ++EP +FN    G+ILEN++Y    R+++ +D  +
Sbjct: 527 VGI-VQQEPMLFN----GTILENILYTVPQRLLNEEDGRV 561

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 47/95 (49%), Gaps = 10/95 (10%)

Query: 230 YHNILTLHSSANQGIQNGDVTLFFGLSGTGKTTLSA---DPHRLLIGDDEHCWSDTGVFN 286
           Y N  ++ S  N  I  G+   F G SG GK+T+S+     +R   G+      D   FN
Sbjct: 375 YSNGKSVLSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYDISAFN 434

Query: 287 IEGGCYAKCINLSAEKEPEIFNAIKYGSILENVIY 321
           +    Y + + +  ++EP +FN    G+IL+N+ Y
Sbjct: 435 LRK--YRRMLGV-VQQEPLLFN----GTILDNITY 462

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 46/87 (52%), Gaps = 20/87 (22%)

Query: 244 IQNGDVTLFFGLSGTGKTTLS--------ADPHRLLIGDDEHCWSDTGVFNIEGGCYAKC 295
           I+ G+   F G SG+GK+T+S        A    +LIG+D        + ++    Y K 
Sbjct: 476 IEPGEHICFVGPSGSGKSTVSQLLLRYYDATEGNILIGEDN-------IKSLSLRKYRKL 528

Query: 296 INLSAEKEPEIFNAIKYGSILENVIYD 322
           + +  ++EP +FN    G+I++N++Y+
Sbjct: 529 LGV-VQQEPMLFN----GTIIDNILYN 550

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 20/86 (23%)

Query: 244 IQNGDVTLFFGLSGTGKTTLSADPHR--------LLIGDDEHCWSDTGVFNIEGGCYAKC 295
           I+ G+   F G SG+GK+T+S+   R        +L+G ++       + N     Y + 
Sbjct: 479 IEPGEHVCFVGPSGSGKSTVSSLLLRYYDVAKGSILVGGED-------IKNFSLRKYRRL 531

Query: 296 INLSAEKEPEIFNAIKYGSILENVIY 321
           + +  ++EP +FN    G+ILEN++Y
Sbjct: 532 LGV-VQQEPMLFN----GTILENILY 552

>Smik_15.98 Chr15 complement(178216..180363) [2148 bp, 715 aa] {ON}
           YOL060C (REAL)
          Length = 715

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 17/22 (77%)

Query: 498 VNGVPKEILNPAKNWSEGEAKY 519
           V GVPK I+ PAK+W E +++Y
Sbjct: 628 VKGVPKTIIGPAKDWDESKSEY 649

>YOL060C Chr15 complement(214017..216137) [2121 bp, 706 aa] {ON}
           MAM3Protein required for normal mitochondrial
           morphology, has similarity to hemolysins
          Length = 706

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 17/22 (77%)

Query: 498 VNGVPKEILNPAKNWSEGEAKY 519
           V GVPK I+ PAK+W E +++Y
Sbjct: 618 VKGVPKTIIGPAKDWDESKSEY 639

>Skud_15.93 Chr15 complement(173073..175229) [2157 bp, 718 aa] {ON}
           YOL060C (REAL)
          Length = 718

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 17/22 (77%)

Query: 498 VNGVPKEILNPAKNWSEGEAKY 519
           V GVPK I+ PAK+W E +++Y
Sbjct: 629 VKGVPKTIIGPAKDWDESKSEY 650

>ZYRO0B04774g Chr2 (383089..385182) [2094 bp, 697 aa] {ON} similar
           to uniprot|Q12296 Saccharomyces cerevisiae YOL060C
          Length = 697

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%)

Query: 476 DGSLAKQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEG 515
           D +L   SY++     +     V GVPK I+ PAKNW E 
Sbjct: 600 DNTLLSSSYQSTKHGIVESIITVKGVPKTIIEPAKNWDEA 639

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 50/116 (43%), Gaps = 9/116 (7%)

Query: 236  LHSSANQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD-TGVFNIEGGCYAK 294
            ++   N  ++ G+     GLSG+GK+TL     RL        W D   V   E     K
Sbjct: 1077 VYRGLNLSVKAGETVALVGLSGSGKSTLWHLITRLYRVPSGSIWFDGLDVNEWEEWALRK 1136

Query: 295  CINLSAEKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPS 350
             I +  E+ P +F     GSI +N+ Y  +T V   D+  I E       ++++ S
Sbjct: 1137 RIAV-VEQRPSLFR----GSIFDNLTYGLSTSV---DEREIRELLELVGMMDFVNS 1184

>Suva_15.105 Chr15 complement(186482..188635) [2154 bp, 717 aa] {ON}
           YOL060C (REAL)
          Length = 717

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 12/46 (26%)

Query: 498 VNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDRATP 543
           V GVPK I+ P+K+W E  +++            +N+KT ++ ++P
Sbjct: 632 VKGVPKTIIGPSKDWDESRSEH------------DNYKTDRENSSP 665

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,826,358
Number of extensions: 2663658
Number of successful extensions: 7111
Number of sequences better than 10.0: 40
Number of HSP's gapped: 7262
Number of HSP's successfully gapped: 40
Length of query: 552
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 437
Effective length of database: 40,294,809
Effective search space: 17608831533
Effective search space used: 17608831533
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)