Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0A006001.83ON54454425780.0
NDAI0F042001.83ON56654318820.0
CAGL0J08184g1.83ON57252318660.0
Smik_5.241.83ON59054218660.0
Suva_5.41.83ON59053518620.0
NDAI0A006101.83ON56554918540.0
Skud_5.261.83ON59053518560.0
YEL063C (CAN1)1.83ON59053618510.0
KNAG0C007901.83ON57951417750.0
SAKL0C02662g1.83ON54851417520.0
TDEL0C061801.83ON58352017520.0
Skud_14.701.83ON57355417510.0
KNAG0C05920singletonON59953217480.0
NCAS0B085701.83ON53251617410.0
Smik_14.671.83ON57355417430.0
YNL270C (ALP1)1.83ON57353417280.0
TPHA0B044801.83ON60351417230.0
SAKL0C02684gsingletonON58853816950.0
SAKL0C02640gsingletonON54855116900.0
Suva_14.731.83ON49746916740.0
KAFR0D007001.83ON57453916660.0
Kpol_2000.651.83ON59553616590.0
TBLA0A054501.83ON60651416510.0
Ecym_10871.83ON57050916400.0
Kwal_33.134011.83ON55954616320.0
KLTH0F02398g1.83ON55555116160.0
ZYRO0F16654g1.83ON58053616140.0
Kpol_2000.641.84ON61054616090.0
KLLA0C02343g1.83ON58154116060.0
Ecym_10881.84ON56753315960.0
NCAS0A006101.84ON60751615860.0
TBLA0A054601.84ON60853415810.0
TDEL0C061701.84ON57352115750.0
Smik_14.681.84ON61151215750.0
CAGL0J08162g1.84ON59751015720.0
Skud_14.711.84ON61251415710.0
TPHA0B044701.84ON59952415610.0
NDAI0F041901.84ON59951415610.0
YNL268W (LYP1)1.84ON61154415610.0
KLLA0C02365g1.84ON57953415560.0
Suva_14.751.84ON61151415530.0
SAKL0C02728g1.84ON56251815440.0
Kwal_33.134111.84ON56054115380.0
KLTH0F02420g1.84ON62153715400.0
KAFR0D039401.83ON59753015340.0
KNAG0F004801.84ON59755315160.0
AFR667C1.84ON56353814840.0
ZYRO0F16632g1.84ON60751414300.0
AFR668W1.83ON55647714190.0
Kpol_358.3na 1ON5755668251e-102
KAFR0B06430singletonON5935398221e-102
KLLA0E16281gna 1ON6055348221e-102
Skud_16.12na 1ON6075548191e-101
Smik_6.473na 1ON6065328171e-101
YPL265W (DIP5)na 1ON6085238161e-101
Kwal_33.15545na 1ON5765218051e-100
Suva_16.40na 1ON6065188061e-99
CAGL0A01199gna 1ON6135418062e-99
Ecym_2480na 1ON5865357972e-98
SAKL0G14916gna 1ON5815537841e-96
KNAG0L02470singletonON6385107854e-96
NCAS0D02260na 1ON5975437824e-96
Kwal_26.69407.44ON5705527752e-95
TBLA0A07060na 1ON6255157783e-95
KLTH0B01166gna 1ON5775077743e-95
NDAI0I02660na 1ON5945277608e-93
TPHA0M00130singletonON6115217582e-92
TPHA0H028507.44ON6015487476e-91
KNAG0L02460singletonON5885477406e-90
KLTH0D01474g7.44ON6245197341e-88
AFR156W7.44ON5585427272e-88
SAKL0F09790gsingletonON5585247212e-87
CAGL0B01012g1.50ON6235507252e-87
TDEL0H040707.44ON5775217195e-87
SAKL0C01232gsingletonON6135487207e-87
NDAI0B052201.244ON6115437209e-87
ACL135Wna 1ON5885087181e-86
SAKL0B10956g7.44ON5725437161e-86
Suva_2.6881.50ON6615417221e-86
ZYRO0D17908gna 1ON5185017121e-86
Kwal_33.132041.50ON6075287154e-86
CAGL0E05632g7.44ON5985267144e-86
ZYRO0D03762g1.244ON6005237128e-86
Kwal_33.154075.158ON5874767101e-85
CAGL0K05753g1.50ON6605687142e-85
Ecym_80357.44ON5635517072e-85
NDAI0E038007.44ON6215187112e-85
Kpol_543.791.244ON6055277085e-85
Skud_11.2751.244ON6025267042e-84
TDEL0F02830na 2ON5615426993e-84
KNAG0E003907.44ON5995607005e-84
AFR698C1.50ON6095277015e-84
Ecym_60211.244ON6005087006e-84
AGR039Cna 3ON5865376979e-84
Kwal_27.126811.244ON5935216962e-83
KLLA0A11770g5.158ON5814766926e-83
Smik_4.7901.50ON6635346976e-83
TPHA0B010901.244ON6065336936e-83
YKR039W (GAP1)1.244ON6025266928e-83
KLTH0B02046g5.158ON5894766911e-82
SAKL0G14014g5.158ON6055546892e-82
Kpol_367.77.44ON5845446873e-82
YDR508C (GNP1)1.50ON6635336914e-82
NCAS0E022607.44ON5935576865e-82
TDEL0C065101.50ON6425296896e-82
NDAI0D021605.158ON5874666848e-82
YOR348C (PUT4)7.44ON6275366879e-82
TBLA0C01240singletonON6295356879e-82
SAKL0D02970g3.284ON6015546841e-81
Smik_3.531.50ON6335456861e-81
Skud_4.7841.50ON6635336872e-81
KAFR0D00510na 4ON6175566842e-81
SAKL0D00836gna 5ON6015656823e-81
SAKL0D02948gna 3ON5945536813e-81
YCL025C (AGP1)1.50ON6335476834e-81
NDAI0A01340singletonON5545436774e-81
Kpol_2000.921.50ON6375246825e-81
NCAS0J00140na 6ON5585416775e-81
SAKL0C01650g1.50ON6135486806e-81
KLTH0E15642g1.244ON5965226797e-81
Smik_13.1singletonON5235206737e-81
TDEL0C00930singletonON5955246787e-81
Suva_3.1891.50ON6335476801e-80
KAFR0D00520na 7ON5985356771e-80
Skud_3.381.50ON6335446782e-80
KNAG0C02140singletonON5985486752e-80
TPHA0E036601.50ON6475256765e-80
TBLA0G031203.284ON6735476769e-80
CAGL0B03773g5.158ON6055246711e-79
Suva_11.2731.244ON6015236701e-79
TBLA0A051801.50ON6765606742e-79
Kwal_33.14276na 5ON5965486692e-79
Skud_15.5157.44ON6265356702e-79
TDEL0A08030singletonON5144476622e-79
Suva_13.517singletonON5475386633e-79
NCAS0B085801.50ON6275436694e-79
Ecym_10561.50ON6065346674e-79
CAGL0L03267g1.244ON5975276656e-79
Kpol_543.78singletonON6055276666e-79
KLTH0C05170g3.284ON5985416658e-79
Smik_15.5327.44ON6315346661e-78
Smik_6.482na 8ON5585436611e-78
NDAI0A006401.50ON6415376652e-78
KAFR0D005001.50ON6175296632e-78
KAFR0E018505.158ON5604806592e-78
Skud_7.5255.158ON6035336605e-78
YBR068C (BAP2)3.284ON6095246605e-78
Suva_8.4027.44ON6835366646e-78
NCAS0D018705.158ON5955656586e-78
NDAI0G060301.368ON5995616587e-78
CAGL0M00154gsingletonON5505616557e-78
SAKL0C13992gsingletonON5525276549e-78
Suva_4.3073.284ON6095376581e-77
Suva_2.716singletonON6035336571e-77
KNAG0C005901.50ON6345636591e-77
NDAI0F043901.50ON6675366602e-77
Skud_6.2na 6ON5585336532e-77
CAGL0H08393g3.284ON6125306562e-77
Kpol_2002.441.50ON6275336572e-77
AFR230C1.244ON6045136562e-77
NCAS0A089201.368ON5995616552e-77
Kwal_23.4026singletonON5345016502e-77
Ecym_26643.285ON5755396532e-77
TDEL0E05750singletonON5485416503e-77
KLLA0C01606g1.50ON6205276553e-77
KAFR0C004003.284ON5825446533e-77
KAFR0D04120na 7ON6485636556e-77
Kwal_8.590na 9ON6295446537e-77
KLLA0A10813g1.368ON5845376508e-77
AGR319W5.158ON6264756529e-77
TBLA0C012101.368ON6005646501e-76
Smik_2.2013.284ON6095376501e-76
Suva_7.4855.158ON6035376492e-76
Ecym_47895.158ON5885036482e-76
KLTH0F01584g1.50ON5965386473e-76
Suva_2.2033.284ON6045446474e-76
Ecym_2663na 3ON5894986464e-76
KAFR0A011203.284ON5925496454e-76
AGR038C3.284ON5805506445e-76
Kwal_26.9612singletonON5435306416e-76
Skud_2.1913.284ON6095306456e-76
KLLA0F23419g7.44ON5735436437e-76
YGR191W (HIP1)5.158ON6035426457e-76
NCAS0I015303.284ON5955526431e-75
KNAG0F002701.50ON6345436451e-75
NDAI0C029505.158ON6094786422e-75
SAKL0D04664g1.244ON5935216412e-75
KNAG0G009005.158ON6135386422e-75
KNAG0H011503.284ON6175346422e-75
NCAS0A071105.158ON5924556402e-75
Skud_15.1381.368ON5925556403e-75
KNAG0J022003.284ON6075436413e-75
NCAS0A004201.50ON6795506453e-75
Smik_16.1155.158ON6034706404e-75
YFL055W (AGP3)na 6ON5585126364e-75
Smik_11.3021.244ON5534736357e-75
NDAI0A074903.284ON5965436351e-74
KAFR0F02250singletonON5545296322e-74
KNAG0L00110na 6ON5715296332e-74
NCAS0B079001.244ON6194746352e-74
KLTH0D07128gna 10ON5435506303e-74
KLTH0A00308gsingletonON5415196293e-74
YDR046C (BAP3)3.284ON6045396333e-74
YOL020W (TAT2)1.368ON5925446324e-74
TBLA0B077605.158ON6585306364e-74
Smik_15.1461.368ON5935306307e-74
Skud_4.3003.284ON6045396301e-73
KLTH0B00154gna 9ON5565336261e-73
TPHA0A047005.158ON5695296271e-73
Smik_4.2843.284ON6045576291e-73
AEL030W1.368ON5825346272e-73
ZYRO0G07172gna 2ON5675226252e-73
KLLA0A06886gsingletonON5875346263e-73
KLLA0A06930g1.244ON5875056263e-73
Kwal_26.8097na 10ON5445506233e-73
Ecym_27161.368ON5925346246e-73
KNAG0J022103.285ON5815136237e-73
KAFR0C051607.44ON5845436237e-73
KLTH0F01606gna 7ON6045166239e-73
KLTH0H13398g1.368ON5875226221e-72
NDAI0A056203.284ON5715556211e-72
TBLA0A05190na 7ON6675306261e-72
Suva_15.1481.368ON5925376202e-72
Kpol_1010.325.158ON5995246203e-72
SAKL0A09724gna 10ON5515116155e-72
Ecym_8297na 11ON5695136156e-72
Kpol_534.221.368ON5925586151e-71
KAFR0D041401.50ON6375676172e-71
KLLA0F27093gsingletonON5634746122e-71
Kwal_27.105383.284ON6025576142e-71
KLTH0F04048gsingletonON5835516123e-71
Ecym_26623.284ON5895546123e-71
ZYRO0A00308gsingletonON5645156103e-71
NCAS0A106803.284ON5935546123e-71
KLLA0B14685gna 12ON5715426103e-71
Kpol_1065.133.284ON5965476124e-71
TPHA0A002405.158ON6034566124e-71
Kwal_33.13215na 7ON5985296124e-71
Skud_16.2na 8ON4964696044e-71
TPHA0A025001.368ON5905286115e-71
CAGL0D02178g1.368ON5775526062e-70
SAKL0F16544gsingletonON5675486052e-70
Smik_2.2023.285ON6175326073e-70
SAKL0D02926g3.285ON5835326028e-70
Kwal_23.2817na 12ON5805365992e-69
ADL272Wna 11ON5645215982e-69
ZYRO0F17446g1.50ON6335085996e-69
AGR040C3.285ON5735295949e-69
Skud_2.1923.285ON6195085952e-68
YLL061W (MMP1)na 13ON5835505904e-68
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0A00600
         (544 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   997   0.0  
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            729   0.0  
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   723   0.0  
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   723   0.0  
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   721   0.0  
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   718   0.0  
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   719   0.0  
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   717   0.0  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              688   0.0  
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   679   0.0  
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   679   0.0  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   679   0.0  
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            677   0.0  
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            675   0.0  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   676   0.0  
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   670   0.0  
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   668   0.0  
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   657   0.0  
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   655   0.0  
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   649   0.0  
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   646   0.0  
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   643   0.0  
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   640   0.0  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   636   0.0  
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   633   0.0  
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   627   0.0  
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   626   0.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   624   0.0  
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   623   0.0  
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   619   0.0  
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              615   0.0  
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   613   0.0  
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   611   0.0  
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   611   0.0  
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   610   0.0  
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   609   0.0  
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   605   0.0  
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   605   0.0  
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   605   0.0  
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   603   0.0  
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   602   0.0  
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   599   0.0  
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   597   0.0  
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   597   0.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   595   0.0  
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                588   0.0  
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   576   0.0  
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   555   0.0  
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   551   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   322   e-102
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   321   e-102
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   321   e-102
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   320   e-101
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   319   e-101
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   318   e-101
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   314   e-100
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   315   1e-99
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   315   2e-99
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   311   2e-98
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   306   1e-96
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             306   4e-96
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              305   4e-96
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   303   2e-95
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   304   3e-95
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   302   3e-95
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   297   8e-93
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     296   2e-92
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   292   6e-91
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             289   6e-90
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   287   1e-88
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   284   2e-88
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   282   2e-87
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   283   2e-87
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   281   5e-87
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   281   7e-87
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   281   9e-87
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   281   1e-86
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   280   1e-86
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   282   1e-86
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   278   1e-86
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   280   4e-86
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   279   4e-86
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   278   8e-86
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   278   1e-85
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   279   2e-85
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   276   2e-85
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     278   2e-85
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   277   5e-85
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   275   2e-84
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   273   3e-84
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   274   5e-84
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   274   5e-84
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   274   6e-84
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   273   9e-84
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   272   2e-83
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   271   6e-83
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   273   6e-83
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   271   6e-83
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   271   8e-83
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   270   1e-82
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   270   2e-82
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   269   3e-82
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   270   4e-82
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     268   5e-82
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   270   6e-82
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    268   8e-82
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   269   9e-82
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   269   9e-82
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   268   1e-81
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   268   1e-81
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   269   2e-81
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      268   2e-81
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   267   3e-81
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   266   3e-81
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   267   4e-81
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              265   4e-81
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   267   5e-81
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      265   5e-81
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   266   6e-81
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   266   7e-81
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    263   7e-81
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   265   7e-81
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   266   1e-80
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   265   1e-80
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   265   2e-80
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   264   2e-80
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   265   5e-80
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              265   9e-80
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   263   1e-79
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   262   1e-79
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   264   2e-79
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   262   2e-79
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   262   2e-79
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            259   2e-79
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   259   3e-79
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   262   4e-79
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   261   4e-79
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   260   6e-79
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   261   6e-79
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   260   8e-79
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   261   1e-78
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   259   1e-78
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   260   2e-78
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      259   2e-78
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   258   2e-78
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   258   5e-78
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   258   5e-78
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   260   6e-78
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   258   6e-78
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   258   7e-78
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   256   7e-78
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   256   9e-78
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   258   1e-77
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   257   1e-77
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   258   1e-77
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   258   2e-77
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      256   2e-77
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   257   2e-77
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   257   2e-77
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   257   2e-77
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   256   2e-77
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   254   2e-77
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   256   2e-77
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            254   3e-77
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   256   3e-77
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                256   3e-77
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   256   6e-77
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   256   7e-77
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   254   8e-77
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   255   9e-77
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   254   1e-76
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   254   1e-76
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   254   2e-76
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   254   2e-76
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   253   3e-76
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   253   4e-76
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   253   4e-76
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   253   4e-76
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   252   5e-76
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   251   6e-76
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   253   6e-76
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   252   7e-76
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   253   7e-76
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              252   1e-75
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   253   1e-75
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    251   2e-75
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   251   2e-75
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   251   2e-75
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              251   2e-75
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   251   2e-75
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   251   3e-75
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   251   3e-75
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   253   3e-75
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   251   4e-75
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   249   4e-75
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   249   7e-75
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   249   1e-74
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              248   2e-74
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   248   2e-74
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   249   2e-74
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   247   3e-74
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   246   3e-74
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   248   3e-74
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   248   4e-74
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   249   4e-74
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   247   7e-74
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   247   1e-73
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   245   1e-73
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   246   1e-73
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   246   1e-73
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   246   2e-73
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   245   2e-73
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   245   3e-73
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   245   3e-73
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   244   3e-73
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   244   6e-73
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   244   7e-73
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   244   7e-73
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   244   9e-73
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   244   1e-72
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            243   1e-72
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   245   1e-72
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   243   2e-72
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   243   3e-72
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   241   5e-72
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   241   6e-72
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   241   1e-71
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              242   2e-71
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   240   2e-71
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   241   2e-71
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   240   3e-71
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   240   3e-71
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   239   3e-71
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   240   3e-71
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   239   3e-71
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   240   4e-71
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   240   4e-71
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   240   4e-71
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   237   4e-71
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   239   5e-71
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   238   2e-70
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   237   2e-70
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   238   3e-70
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   236   8e-70
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   235   2e-69
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   234   2e-69
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   235   6e-69
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   233   9e-69
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   233   2e-68
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   231   4e-68
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   231   7e-68
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   230   2e-67
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   230   2e-67
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   229   4e-67
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   226   5e-67
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   227   1e-66
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              226   5e-66
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   226   9e-66
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              225   3e-65
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   224   5e-65
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   221   8e-65
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    223   8e-65
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   223   9e-65
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   222   4e-64
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   221   6e-64
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   220   1e-63
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   220   2e-63
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   219   3e-63
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              218   6e-63
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   217   6e-63
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   217   1e-62
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   219   5e-62
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      215   6e-62
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   215   8e-62
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   214   9e-62
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   214   1e-61
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   214   2e-61
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   213   2e-61
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   213   3e-61
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                213   3e-61
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   214   5e-61
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   212   7e-61
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   209   4e-60
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   207   7e-60
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   207   8e-60
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                209   1e-59
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   209   1e-59
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   207   3e-59
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   212   3e-59
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   212   3e-59
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   207   6e-59
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   207   6e-59
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   207   7e-59
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   206   7e-59
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   211   7e-59
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   209   3e-58
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   209   4e-58
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   205   4e-58
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              204   9e-58
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   203   1e-57
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   203   1e-57
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   203   2e-57
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   202   3e-57
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   202   4e-57
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   200   9e-57
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   204   1e-56
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   200   1e-56
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   204   2e-56
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   200   2e-56
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   200   3e-56
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   199   3e-56
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   198   7e-56
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   198   8e-56
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   197   2e-55
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   197   2e-55
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   200   4e-55
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   197   7e-54
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   192   8e-54
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   192   9e-54
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   196   1e-53
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   192   1e-53
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   194   6e-53
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   194   7e-53
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   193   1e-52
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   193   2e-52
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   191   4e-52
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                186   3e-51
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   188   8e-51
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   187   2e-50
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   187   2e-50
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   183   2e-50
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   182   4e-50
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   181   2e-49
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   176   5e-48
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   162   6e-42
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         149   7e-40
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     140   2e-36
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     140   2e-36
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   131   2e-34
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    80   8e-17
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      77   4e-16
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          76   2e-15
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      72   8e-15
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    74   2e-14
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          72   9e-14
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      72   4e-13
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     72   6e-13
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              50   2e-06
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    50   1e-05
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    47   9e-05
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    44   0.001
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    43   0.001
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    42   0.004
Ecym_2212 Chr2 (417948..419585) [1638 bp, 545 aa] {ON} similar t...    41   0.005
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    41   0.007
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    40   0.014
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    40   0.016
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    39   0.031
KAFR0K00360 Chr11 (79233..80849) [1617 bp, 538 aa] {ON} Anc_6.20...    39   0.037
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    39   0.042
NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {O...    39   0.045
TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa] ...    38   0.057
KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {...    37   0.100
KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {O...    37   0.12 
Kpol_1042.14 s1042 (34979..36739) [1761 bp, 586 aa] {ON} (34979....    35   0.37 
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    35   0.38 
AFL081W Chr6 (286339..287967) [1629 bp, 542 aa] {ON} Syntenic ho...    35   0.42 
KLLA0C15521g Chr3 complement(1347098..1348741) [1644 bp, 547 aa]...    35   0.44 
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    35   0.47 
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    35   0.55 
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    34   0.84 
CAGL0B02838g Chr2 complement(274984..276693) [1710 bp, 569 aa] {...    34   1.3  
CAGL0K04367g Chr11 (413033..414781) [1749 bp, 582 aa] {ON} highl...    34   1.3  
Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {O...    33   1.5  
KLTH0A03278g Chr1 (283065..284783) [1719 bp, 572 aa] {ON} highly...    33   2.3  
ZYRO0B08030g Chr2 complement(626820..628556) [1737 bp, 578 aa] {...    33   2.5  
TPHA0B01060 Chr2 complement(241062..242822) [1761 bp, 586 aa] {O...    32   3.4  
KLTH0H04444g Chr8 (397467..399065) [1599 bp, 532 aa] {ON} simila...    32   3.9  
TDEL0G01410 Chr7 (285255..286916) [1662 bp, 553 aa] {ON} Anc_6.2...    32   4.5  
TDEL0E01790 Chr5 (343205..344911) [1707 bp, 568 aa] {ON} Anc_4.1...    32   4.7  
KNAG0D04070 Chr4 (733476..735290) [1815 bp, 604 aa] {ON} Anc_4.1...    32   5.2  
KNAG0C00980 Chr3 complement(191133..193277) [2145 bp, 714 aa] {O...    32   5.3  
Kwal_47.18050 s47 (662599..664119) [1521 bp, 506 aa] {ON} YGR055...    32   6.4  
ZYRO0G08602g Chr7 complement(697178..698887) [1710 bp, 569 aa] {...    32   6.4  
Suva_7.193 Chr7 complement(355063..356754) [1692 bp, 563 aa] {ON...    32   6.6  
CAGL0H03399g Chr8 complement(316110..317780) [1671 bp, 556 aa] {...    31   7.9  
NDAI0J01930 Chr10 (480261..482033) [1773 bp, 590 aa] {ON} Anc_4....    31   9.0  

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  997 bits (2578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/544 (91%), Positives = 498/544 (91%)

Query: 1   MKLNQPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXX 60
           MKLNQPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISM              
Sbjct: 1   MKLNQPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMIALGGTIGTGLFLG 60

Query: 61  XXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAAN 120
             R             YLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAAN
Sbjct: 61  IARPLIIAGPIGALIAYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAAN 120

Query: 121 GYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFW 180
           GYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFW
Sbjct: 121 GYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFW 180

Query: 181 IASVKVLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSS 240
           IASVKVL                 VTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSS
Sbjct: 181 IASVKVLAILGFIIYGICIICGAGVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSS 240

Query: 241 LINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPK 300
           LINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPK
Sbjct: 241 LINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPK 300

Query: 301 LQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKA 360
           LQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKA
Sbjct: 301 LQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKA 360

Query: 361 APKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISC 420
           APKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISC
Sbjct: 361 APKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISC 420

Query: 421 SHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFA 480
           SHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFA
Sbjct: 421 SHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFA 480

Query: 481 AYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFW 540
           AYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFW
Sbjct: 481 AYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFW 540

Query: 541 NYVA 544
           NYVA
Sbjct: 541 NYVA 544

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/543 (66%), Positives = 418/543 (76%), Gaps = 8/543 (1%)

Query: 7   QVHSFQVDSN-DTPTTISTLDDDQEKQQD----VKRELKKRHISMXXXXXXXXXXXXXXX 61
           + H  Q + + +TPTT  + ++  E ++D    VKR+L KRHI+M               
Sbjct: 27  EQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHIAMIALGGTIGTGLFLGI 86

Query: 62  XRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANG 121
                          YLF+GTVV+SVTQSLGEM TFIPVTASFT+F+ RFLSPA GAANG
Sbjct: 87  ANPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANG 146

Query: 122 YMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWI 181
           YMYWFSWAMTFALELSVVGQIIQFWT AVPL AWISI WV+LTISNLFPVRIYGEIEFWI
Sbjct: 147 YMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWI 206

Query: 182 ASVKVLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSL 241
           A +KV                   TGPVGFRYW+NPGPWG GIISSN+ EARF GW SSL
Sbjct: 207 AFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSL 266

Query: 242 INAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL 301
           INAAFTFQGTELVGITAGE   PR+TVPKAI+KVVFRILVFYI SL  IGLLVPY+D KL
Sbjct: 267 INAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL 326

Query: 302 QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAA 361
           +S +SYVSSSPFII I+N+GTKILPHIFN VIL+TIISAGNSNVYIGSR+L+GLAKN   
Sbjct: 327 KSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTG 386

Query: 362 PKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCS 421
           PK F  T+K+GVP   V+FTS+FG+LA+MET+TGGD+AF WLLN+VGVAGFF+WLLIS +
Sbjct: 387 PKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFA 446

Query: 422 HIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAA 481
           HIRFM+ L+ RGISRNDLP+KA  MP+LAYYA   M+III  QGFT+FAPKF V NFFA+
Sbjct: 447 HIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFAS 506

Query: 482 YISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWN 541
           YISVFLF IFW +FQ+WFKCR VWKL D+D+D DRR+IE+ VW D       N W +FW+
Sbjct: 507 YISVFLFFIFWGSFQLWFKCRYVWKLVDIDIDKDRREIEDRVWQDTTP---ANLWGKFWD 563

Query: 542 YVA 544
           +VA
Sbjct: 564 FVA 566

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/523 (67%), Positives = 403/523 (77%), Gaps = 3/523 (0%)

Query: 22  ISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMG 81
           ++T  D+  +  DVKR LK+RHI M                              YLFMG
Sbjct: 53  LATEKDELLEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMG 112

Query: 82  TVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQ 141
           TVVFSVTQSLGEM TFIPVT+SF+VFAQRFLSPA GAANGYMY+ SW  TFALELSVVGQ
Sbjct: 113 TVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQ 172

Query: 142 IIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXX 201
           IIQFWT  VPLAAWISI WVLLT  N+FPV+ YGE EFWIAS+KVL              
Sbjct: 173 IIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVC 232

Query: 202 XXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEV 261
               TGP+GFRYW+NPG  G GIISSN  EARF GWVSSLINAAFT+QGTELVGITAGE 
Sbjct: 233 GAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEA 292

Query: 262 QEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAG 321
             PRK VP+AI+KV+ RIL+FYIGSL  IGL VPYNDPKL S DSYVSSSPFIITIQNAG
Sbjct: 293 ANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAG 352

Query: 322 TKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFT 381
           T++LPHIFNAVIL TIISAGNSNVY+GSRIL+ +AKN  APKF   T+  GVPY++VL  
Sbjct: 353 TRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAI 412

Query: 382 SMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPY 441
           S FGSL+YME +TGG KAF WLLNI GVAGFFAWLLISCSH+RFM+ALK RGISR+DLPY
Sbjct: 413 SAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPY 472

Query: 442 KAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKC 501
           KA+ MPWLAYYA+FFMV+II+IQGFTSFAP F   +F AAYISV LF++FW  FQI+F+C
Sbjct: 473 KALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRC 532

Query: 502 RLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           R++WKL+DVD+DTDRR+IE  VW DD     K  WD+FW++VA
Sbjct: 533 RIIWKLEDVDIDTDRREIESVVWEDDAP---KTLWDKFWDFVA 572

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/542 (65%), Positives = 418/542 (77%), Gaps = 8/542 (1%)

Query: 8   VHSF--QVDSNDTPTTISTLDDDQE---KQQDVKRELKKRHISMXXXXXXXXXXXXXXXX 62
           +HSF  +VD  DT +    + D+ +   +  +VKRELK+RHI M                
Sbjct: 52  LHSFSTRVDGEDTFSMGDVIRDEDQGEVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLS 111

Query: 63  RXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGY 122
           +             YLFMG++ +SVTQSLGEM TFIPVT+SFTVF+QRFLSPAFGAANGY
Sbjct: 112 KPLANAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGY 171

Query: 123 MYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIA 182
           MYWFSWA+TFALELSVVGQ+I+FWT  VPLAAWISI WV++TI NLFPV+ YGE EFW+A
Sbjct: 172 MYWFSWAITFALELSVVGQVIEFWTNKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVA 231

Query: 183 SVKVLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLI 242
           S+KVL                 VTGPVGFRYW+NPG WG GIIS + NE RF GWVSSLI
Sbjct: 232 SIKVLAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLI 291

Query: 243 NAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ 302
           NAAFTFQGTELVGITAGE   PRKTVP+AIKKVVFRIL FYIGSLL IGLLVPYNDPKL 
Sbjct: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351

Query: 303 SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAP 362
           +  SYVS SPFII I+N+GTK+LPHIFNAVIL TIISA NSN+Y+GSRIL+GL+KNK AP
Sbjct: 352 TATSYVSVSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAP 411

Query: 363 KFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSH 422
           KF + T+K GVPY+ V  T++FG+LAYMET+TGGDK F WLLNI GVAGFFAWLLIS SH
Sbjct: 412 KFLSRTTKGGVPYIAVFITAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISH 471

Query: 423 IRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAY 482
           IRFM+ALK RGISR++LP+KA LMP LAY+A  FM+III+IQGFT+FAPKF   +F AAY
Sbjct: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYFAATFMIIIILIQGFTAFAPKFDGIDFLAAY 531

Query: 483 ISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNY 542
           IS+FLF+  W+ F+I F+CR +WK++DVD+D+DRRDIE  VW D    + K +WD+FWN 
Sbjct: 532 ISIFLFLAIWILFEIIFRCRFIWKIEDVDIDSDRRDIEAIVWED---HEPKTFWDKFWNV 588

Query: 543 VA 544
           VA
Sbjct: 589 VA 590

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/535 (66%), Positives = 410/535 (76%), Gaps = 6/535 (1%)

Query: 13  VDSNDTPTTISTLDDDQE---KQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXX 69
           V+  DT +    + D+ E   +  +VKRELK+RHI M                       
Sbjct: 59  VNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAG 118

Query: 70  XXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWA 129
                  YLFMG++ +SVTQSLGEM TFIPVT+SFTVF+QRFLSPAFGAANGYMYWFSWA
Sbjct: 119 PVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178

Query: 130 MTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXX 189
           +TFALELSVVGQ+IQFWT AVPLAAWISI WV++T  N+FPV+ YGE EFW+AS+KV+  
Sbjct: 179 VTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAI 238

Query: 190 XXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQ 249
                          VTGPVGFRYW+NPG WG GIIS N NEARF GWVSSLINAAFTFQ
Sbjct: 239 IGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQ 298

Query: 250 GTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVS 309
           GTELVGITAGE   PRKTVP+AIKKVVFRIL FYIGSLL IGLLVPYNDPKL S  SYVS
Sbjct: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVS 358

Query: 310 SSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTS 369
           +SPFII I+N+GTK+LPHIFNAVIL TIISA NSN+Y+GSR+L+GL+K+K APKFF+ T+
Sbjct: 359 TSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTT 418

Query: 370 KAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKAL 429
           K GVPY+ V  TS+FG+LAYMET+TGG K F WLLNI GVAGFFAWL IS SHIRFM+AL
Sbjct: 419 KGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQAL 478

Query: 430 KQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFI 489
           K RGISR++LP+KA LMP LAYYA FFMV+II+IQGFTSF P F   NF AAYISVFLF+
Sbjct: 479 KYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFL 538

Query: 490 IFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
             W+ F++ F+CR VWK++DVD+D+DRRDIE  VW    E + K  WD+FWN V 
Sbjct: 539 AIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWE---EPEPKTLWDKFWNVVG 590

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/549 (63%), Positives = 418/549 (76%), Gaps = 9/549 (1%)

Query: 2   KLNQPQVHSFQVDSNDTPTTISTLDDDQE------KQQDVKRELKKRHISMXXXXXXXXX 55
           +L+   +H      +  P+ I+    ++E      ++ +VKRELK+RHI M         
Sbjct: 20  ELDDYPLHRRTNSVHSIPSQITIESQEEEIANGQIREAEVKRELKQRHIGMIALGGTIGT 79

Query: 56  XXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPA 115
                                YLFMGT+V+SVTQSLGEM TFIPVT+SFTVF+QRFLSP+
Sbjct: 80  GLFIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPS 139

Query: 116 FGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYG 175
           FGAANGYMYWFSWA+TFALELSVVGQIIQFWT AVP+ AWISI WVLL   N+FPVR YG
Sbjct: 140 FGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYG 199

Query: 176 EIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFF 235
           E EFW+AS+KVL                 VTGPVGFRYW+NPGP G GII+ N+NEA+F 
Sbjct: 200 EFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFL 259

Query: 236 GWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVP 295
           GWVSSLINAAFT+QGTELVGITAGE   PRK+VP+AIKKVVFRIL FYIGSL  IGLLVP
Sbjct: 260 GWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVP 319

Query: 296 YNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGL 355
           YNDPKL S+DSYV++SPFII+IQN+GT ILPHIFNAVIL TIISA NSNVY+GSRI++GL
Sbjct: 320 YNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGL 379

Query: 356 AKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAW 415
           +K+K AP+  + T+K GVP+V+V+FT +FG+LAYMET+TGG+ AF WLLNI GVAGFF+W
Sbjct: 380 SKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSW 439

Query: 416 LLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKV 475
           L IS SH+RFM+AL+ RGISR+DLP+KA  MP LAYYA+FFM +II+IQGFTSF P F  
Sbjct: 440 LFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDG 499

Query: 476 ANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNW 535
            +F AAYIS FLFI  W+ FQ+WF+CRL+WK++DVD+DTDRRDIEE VW D        +
Sbjct: 500 IDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRRDIEEVVWED---PPPVTF 556

Query: 536 WDRFWNYVA 544
           WD+FWN VA
Sbjct: 557 WDKFWNVVA 565

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/535 (66%), Positives = 412/535 (77%), Gaps = 6/535 (1%)

Query: 13  VDSNDTPTTISTLDDDQE---KQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXX 69
           V+  DT +    L D+ E   +  +VKRELK+RHI M                       
Sbjct: 59  VNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAG 118

Query: 70  XXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWA 129
                  YLFMG++ FSVTQSLGEM TFIPVT+SFTVF+QRFLSPAFGAANGYMYWFSWA
Sbjct: 119 PVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178

Query: 130 MTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXX 189
           +TFALELSVVGQ+IQFWT  VPLAAWISI WVL+TI NLFPV+ YGE EFW+AS+KV+  
Sbjct: 179 ITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAI 238

Query: 190 XXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQ 249
                          VTGPVGFRYW+NPG WG GIIS N NE RF GWVSSLINAAFTFQ
Sbjct: 239 IGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQ 298

Query: 250 GTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVS 309
           GTELVGITAGE   PRKTVP+AIKKVVFRIL FYIGSLL IGLLVPYNDPKL    SYVS
Sbjct: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVS 358

Query: 310 SSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTS 369
           +SPFI+ IQN+GTK+LPHIFNAVIL TIISA NSN+Y+GSRIL+GL+KNK APKF + TS
Sbjct: 359 TSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTS 418

Query: 370 KAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKAL 429
           K GVPY+ V  T++FG+LAYMET+TGGDK F WLLNI GVAGFFAWL IS SHIRFM+AL
Sbjct: 419 KGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQAL 478

Query: 430 KQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFI 489
           K RGISR++LP+KA LMP LAYY+ FFM+III+IQGFT+FAPKF  ++F AAYIS+FLFI
Sbjct: 479 KYRGISRDELPFKAKLMPGLAYYSSFFMIIIIIIQGFTAFAPKFNGSSFLAAYISIFLFI 538

Query: 490 IFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
             W+ F+  F+CR +WK++DVD+D+DRRDIE  VW D    + K +WD+FWN VA
Sbjct: 539 AVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWED---HEPKTFWDKFWNVVA 590

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/536 (65%), Positives = 409/536 (76%), Gaps = 6/536 (1%)

Query: 12  QVDSNDTPTTISTLDDDQE---KQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXX 68
           +V+  DT +    + D+ E   +  +VKRELK+RHI M                      
Sbjct: 58  RVNGEDTFSMEDGIGDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNA 117

Query: 69  XXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSW 128
                   YLFMG++ +SVTQSLGEM TFIPVT+SFTVF+QRFLSPAFGAANGYMYWFSW
Sbjct: 118 GPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSW 177

Query: 129 AMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLX 188
           A+TFALELSVVGQ+IQFWT  VPLAAWISI WV++TI NLFPV+ YGE EFW+AS+KVL 
Sbjct: 178 AITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLA 237

Query: 189 XXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTF 248
                           VTGPVGFRYW+NPG WG GIIS + NE RF GWVSSLINAAFTF
Sbjct: 238 IIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF 297

Query: 249 QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV 308
           QGTELVGITAGE   PRK+VP+AIKKVVFRIL FYIGSLL IGLLVPYNDPKL  + SYV
Sbjct: 298 QGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV 357

Query: 309 SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNT 368
           S+SPFII I+N+GTK+LPHIFNAVIL TIISA NSN+Y+GSRIL+GL+KNK APKF + T
Sbjct: 358 STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRT 417

Query: 369 SKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKA 428
           +K GVPY+ V  T+ FG+LAYMET+TGGDK F WLLNI GVAGFFAWL IS SHIRFM+A
Sbjct: 418 TKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQA 477

Query: 429 LKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLF 488
           LK RGISR++LP+KA LMP LAYYA  FM III+IQGFT+FAPKF   +F AAYIS+FLF
Sbjct: 478 LKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLF 537

Query: 489 IIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           +  W+ FQ  F+CR +WK+ DVD+D+DRRDIE  VW D    + K +WD+FWN VA
Sbjct: 538 LAVWILFQCIFRCRFIWKIGDVDIDSDRRDIEAIVWED---HEPKTFWDKFWNVVA 590

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/514 (65%), Positives = 391/514 (76%), Gaps = 3/514 (0%)

Query: 31  KQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQS 90
              +VKRELK+RHI M                              Y+FMGT+V+SVTQS
Sbjct: 69  HDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQS 128

Query: 91  LGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAV 150
           LGEM TFIPVT+SFTVFAQRFLSP+ GAA GYMYWFSWA+TFALELSV+GQ+IQ+WT AV
Sbjct: 129 LGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYAV 188

Query: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGPVG 210
           PLAAWISI WV++T  N+FPV+ YGE+EFWIA +KV+                 VTGPVG
Sbjct: 189 PLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTGPVG 248

Query: 211 FRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPK 270
           FRYW+NPGPWG GIIS + NEARF GWVSSLIN AFT+QGTELVGI+AGE   PRK VP+
Sbjct: 249 FRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVPR 308

Query: 271 AIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFN 330
           AIKKVVFRIL FYIGSL  IGLLVPYND  L + DSYV+SSPFII I+N+GT +LPHIFN
Sbjct: 309 AIKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSYVASSPFIIAIKNSGTPVLPHIFN 368

Query: 331 AVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYM 390
           AVI  TI+SAGNSNVY+GSRIL+GL+KNK APK  + T+K GVP++ VL TS+ G+LAYM
Sbjct: 369 AVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGALAYM 428

Query: 391 ETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLA 450
           ET+TGG  AF WLLNI  VAGFF WL IS SHIRFM+ALK RGISR+DLP+KA LMP LA
Sbjct: 429 ETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMPGLA 488

Query: 451 YYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDV 510
           YYA F M +II+IQGFT+FAPKF  ++F AAYIS+FLFI  W  FQI F+CR + K++DV
Sbjct: 489 YYASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHKVEDV 548

Query: 511 DLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           D+DTDRRDIE  VW D    + K  WD+FWN +A
Sbjct: 549 DIDTDRRDIEAVVWED---AEPKTVWDKFWNIIA 579

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/514 (64%), Positives = 391/514 (76%), Gaps = 3/514 (0%)

Query: 31  KQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQS 90
           K+  VKR LK RHISM                              Y+F+GT+ +SVTQS
Sbjct: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97

Query: 91  LGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAV 150
           LGEM TFIPVT+SFTVF QRFLSPA G+ANGY+YW SWA+TFALELSVVGQIIQFWT AV
Sbjct: 98  LGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAV 157

Query: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGPVG 210
           PL AWI+I WV+LTISNLFPV+ YGE+EFWIA +KVL                  TGPVG
Sbjct: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217

Query: 211 FRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPK 270
           FRYW+NPGPWG GIIS +VNE RF GWVSSLI+AAFT+QGTELVGITAGE   PRKTVP+
Sbjct: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277

Query: 271 AIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFN 330
           AI KV FRIL FYI SLL IGLLVP+NDPKL+S DSY+SSSPF+I I+N+GTK+LPHIFN
Sbjct: 278 AINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337

Query: 331 AVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYM 390
           AVIL TIISAGNSNVY+GSRI Y +A N  APK+ T T+K+G+PY  VL TS+ G LAY+
Sbjct: 338 AVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYL 397

Query: 391 ETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLA 450
           E+++G    F WLLNI  VAGFF W+LIS SHIRFM+ALK +GISR+DLP+KA  MPW A
Sbjct: 398 ESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGA 457

Query: 451 YYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDV 510
           YYA FF+ +II+IQGFT+FAPKFKV++FF AYISV LF +FW+ FQIWF+  L  K +D+
Sbjct: 458 YYAAFFIGVIIIIQGFTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDI 517

Query: 511 DLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           DLDTDRR+I++ VW    E K +N W++FW  +A
Sbjct: 518 DLDTDRREIDDVVWE---EQKPRNLWEKFWAAIA 548

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/520 (65%), Positives = 396/520 (76%), Gaps = 3/520 (0%)

Query: 25  LDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVV 84
           + + Q  + +VKR LK+RHI M                              YLFM T+V
Sbjct: 67  VKEGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLV 126

Query: 85  FSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQ 144
           +SV QSLGEM TFIPVT++FTVF+ RFLSPAFGAA+GYMYWFSWA+TFALELSVVGQII+
Sbjct: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186

Query: 145 FWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXX 204
           FWT AVP+AAWI+I WVLLT+SNLFPV+ YGE EFWIA +KV+                 
Sbjct: 187 FWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246

Query: 205 VTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEP 264
           +TGPVGFRYW+NPG WG GIIS + NE RF GWVSSLINAAFT+QGTELVGITAGE   P
Sbjct: 247 ITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 306

Query: 265 RKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKI 324
           RK+VP+AIKKVVFRILVFY    + IGLLVPYNDPKL S+DSYVSSSPFII I+N+GTK+
Sbjct: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKV 366

Query: 325 LPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMF 384
           LPHIFNAV+L TIISAGNSNVY+GSRI+YGLAK K AP FF  T+ AGVPY  V FTS F
Sbjct: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426

Query: 385 GSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAM 444
           G+LAYME +TGG  AF WLLNI GVAGFF W+LIS  HIRFM+ALK RGISR+DLP+KA 
Sbjct: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486

Query: 445 LMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLV 504
            MPWLAYYA+FFMV+II+IQGFT+FAP F   +F AAY+SVFLFI  W+  QIWF+CR+ 
Sbjct: 487 FMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIF 546

Query: 505 WKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
            +L +VD+DTDRRDIE  VW D   +  K  WD+FWN VA
Sbjct: 547 HRLDEVDIDTDRRDIEAVVWDD---EPPKTLWDKFWNIVA 583

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/554 (60%), Positives = 411/554 (74%), Gaps = 15/554 (2%)

Query: 3   LNQPQVHSFQVDSNDTPTTI---STLDDDQEK--------QQDVKRELKKRHISMXXXXX 51
           + + ++   Q +  DT   I   S++++D  K        + +V+R+LK+RHI M     
Sbjct: 23  IKEKELVDAQYEEQDTSAAIAANSSIENDGAKGTETSPRSRGEVQRKLKERHIGMIALGG 82

Query: 52  XXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRF 111
                                    YLFMGTV++SVTQSLGEM TFIPVT+SF+VFAQRF
Sbjct: 83  TIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRF 142

Query: 112 LSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPV 171
           LSPA GA NGYMYW SW  TFALELSV+GQIIQ+WT AVPLAAWI I W LLT+ N+FPV
Sbjct: 143 LSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHAVPLAAWIVIFWCLLTLMNMFPV 202

Query: 172 RIYGEIEFWIASVKVLXXXXXXXXX-XXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVN 230
           + YGE EF IAS+KV+                    GP+GFRYW+NPG WG GIISSN N
Sbjct: 203 KYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIGFRYWRNPGAWGPGIISSNKN 262

Query: 231 EARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVI 290
           E RF GWVSSLINAAFT+QGTELVGITAGE   PRK VP+AIKKVV RILVFYI SL  I
Sbjct: 263 EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVIRILVFYILSLFFI 322

Query: 291 GLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSR 350
           GLLVPYNDPKL S+ ++VS+SPF+I+I+N+GTK+LP IFNAV+LITI SAGNSNVYIGSR
Sbjct: 323 GLLVPYNDPKLDSDGTFVSASPFMISIENSGTKVLPDIFNAVVLITIFSAGNSNVYIGSR 382

Query: 351 ILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVA 410
           +LY L+KN  APK  +N ++ GVPY+ VL TS+FG LA++ET+ G  KAF WLLNI GVA
Sbjct: 383 VLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLETSAGSGKAFNWLLNITGVA 442

Query: 411 GFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFA 470
           GFFAWLLIS SHIRFM+A+K+RGISR+DLPYKA +MP+LAYYA FF+ +I++IQGFT+FA
Sbjct: 443 GFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAYYASFFIALIVLIQGFTAFA 502

Query: 471 PKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVED 530
           P F+  +F AAYISVFLF I W++FQ+WFKCRL+ KLQD+D+D+DRR+IEE+VW   +E 
Sbjct: 503 PTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDIDIDSDRREIEEQVW---IEP 559

Query: 531 KNKNWWDRFWNYVA 544
           + K  W R W+ ++
Sbjct: 560 ECKTRWQRVWDILS 573

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/532 (62%), Positives = 399/532 (75%), Gaps = 4/532 (0%)

Query: 14  DSNDTPTTISTLDDDQE-KQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXX 72
           D   + T   TL  ++  K + VKR LK RHI+M                +         
Sbjct: 71  DCLQSATNTGTLCTEEHVKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVG 130

Query: 73  XXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTF 132
               Y+F+GT++FSVTQSLGEM TFIPVT+SFTVF+ RFLSPAFGAANGYMYWFSWAMTF
Sbjct: 131 ALIAYIFVGTIIFSVTQSLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTF 190

Query: 133 ALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXX 192
           A+ELSV+G++IQFWT AVPLAAWI I W LLT+SN+FPV+ YGEIEFWIA +KVL     
Sbjct: 191 AVELSVLGKVIQFWTTAVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGF 250

Query: 193 XXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTE 252
                         GP GFRYW++PG WG GII+ + +EARF GWVSSLINAAFT+QGTE
Sbjct: 251 LIFCLCITSGAGPHGPFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTE 310

Query: 253 LVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSP 312
           LVGITAGE   PRK VPKAIKKV+ RIL FY+GSL  IG+LVP+NDPKL S  S+VSSSP
Sbjct: 311 LVGITAGEAANPRKAVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTSATSFVSSSP 370

Query: 313 FIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAG 372
           FII IQN+G  +LP IFN VILITIISAGNSNVY+GSRIL+GLA +  AP+FFT T+K G
Sbjct: 371 FIIAIQNSGVSLLPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTG 430

Query: 373 VPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQR 432
           VP+V VLFTS+FGSLA++E TT GDK F WLL+IV +AGFFAWLLIS SHIRFMKAL+ R
Sbjct: 431 VPFVAVLFTSLFGSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYR 490

Query: 433 GISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFW 492
           GISRN LP+KA+ MPWLAYYA  F+++II+IQGFT+FAP+F V++F A+YIS+ LF+I W
Sbjct: 491 GISRNSLPFKAIFMPWLAYYATAFIILIILIQGFTAFAPRFNVSDFVASYISLLLFVIIW 550

Query: 493 VAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
             FQ   KCR+ WK++D+DLD+DR+DIE+  W D   D  K +W + W  +A
Sbjct: 551 GVFQAMKKCRIFWKVEDIDLDSDRKDIEDIRWED---DSPKTFWTKVWQTLA 599

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/516 (64%), Positives = 396/516 (76%), Gaps = 4/516 (0%)

Query: 29  QEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVT 88
           + + + V+RELK+RH+ M                              YLFM T+ +SVT
Sbjct: 21  EVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVT 80

Query: 89  QSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTM 148
           QSLGEM TFIPVT+SFTVF+QRF+SPAFGAANGYMYWFSW +TFALELSVVGQ+IQFWT 
Sbjct: 81  QSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF 140

Query: 149 AVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGP 208
           AVPLAAWISI WVLLT  N+FPV+ YGE EFW+A VKV+                 VTGP
Sbjct: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200

Query: 209 VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTV 268
           VGFRYW++PG +G GII+ + N+ARF GWVSSLINAAFTFQGTELVGITAGE   PRKTV
Sbjct: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260

Query: 269 PKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHI 328
           P+AIKKVVFRIL FYI SL  IGLLVPY+D KL S DSYVS+SPFII I+N+GT +LPHI
Sbjct: 261 PRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHI 320

Query: 329 FNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLA 388
           FNAVI+ TIISAGNSN+Y+GSRI+YGL+ ++ AP   + T++ GVP+V VL TS+FG+LA
Sbjct: 321 FNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALA 380

Query: 389 YMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPW 448
           YMET+TGG KAF WLLNI GVAGFF WL IS SHIRFM+AL+ RGISR+DLP+KA  MP 
Sbjct: 381 YMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPG 440

Query: 449 LAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQ 508
           LAYY VFFM +II+IQGFTSF P +   +F  AYISVF+FI  W+AFQ WF+CRL+W+++
Sbjct: 441 LAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVE 499

Query: 509 DVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           DVD+DTDRR +EE VW   +E + + +WD+FWN VA
Sbjct: 500 DVDIDTDRRAVEEAVW---IEQEPRGFWDKFWNVVA 532

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/554 (60%), Positives = 406/554 (73%), Gaps = 15/554 (2%)

Query: 3   LNQPQVHSFQVDSNDTPTTI---STLDDDQEKQQD--------VKRELKKRHISMXXXXX 51
           + + ++   + D  DT   +   S++++D  K+ +        VKR+LK+RHI M     
Sbjct: 23  IKEEELICARYDGQDTEEAVAGKSSINNDSAKETETSPRKGGEVKRKLKQRHIGMIALGG 82

Query: 52  XXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRF 111
                                    YLFMGTV++SVTQSLGEM TFIPVT+SF+VFAQRF
Sbjct: 83  TIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRF 142

Query: 112 LSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPV 171
           LSPA GA NGYMYW SW  TFALELSV+GQIIQ+WT AVPL AWI I W LLT+ N+FPV
Sbjct: 143 LSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTDAVPLVAWIVIFWCLLTLMNMFPV 202

Query: 172 RIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTG-PVGFRYWKNPGPWGMGIISSNVN 230
           + YGE EF IAS+KV+                  +G P+GFRYW+NPG WG GIIS N N
Sbjct: 203 KYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPIGFRYWRNPGAWGPGIISKNKN 262

Query: 231 EARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVI 290
           E RF GWVSSLINAAFT+QGTELVGITAGE   PR+ VP+AIKKVV RILVFYI SL  I
Sbjct: 263 EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVPRAIKKVVVRILVFYILSLFFI 322

Query: 291 GLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSR 350
           GLLVPYNDPKL S  ++VSSSPF+I+I+N+GTK+LP IFNAV+LITI+SAGNSNVYIGSR
Sbjct: 323 GLLVPYNDPKLDSEGTFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSR 382

Query: 351 ILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVA 410
           +LY L+KN  AP+F +N +K GVPY  VL TS FG LA++ET+ G  K F WLLNI GVA
Sbjct: 383 VLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLAFLETSAGSGKVFNWLLNITGVA 442

Query: 411 GFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFA 470
           GFFAWLLIS SHIRFM+A+K+RGISR+DLPY+A +MP+LAYYA FF+ +I++IQGFT+FA
Sbjct: 443 GFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPFLAYYASFFIALIVLIQGFTAFA 502

Query: 471 PKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVED 530
           P F+  +F AAYISVFLFI  W+ FQ+WFKCR VWKLQDVD+D+DRRDIEE+VW   +E 
Sbjct: 503 PTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWKLQDVDIDSDRRDIEEQVW---IEP 559

Query: 531 KNKNWWDRFWNYVA 544
           + K  W   W+ ++
Sbjct: 560 ECKTRWQHVWDILS 573

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/534 (61%), Positives = 402/534 (75%), Gaps = 12/534 (2%)

Query: 20  TTISTLDDDQEKQ--------QDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXX 71
           TT   ++DD  K+        ++VKR+LK+RHI M                         
Sbjct: 43  TTERKVEDDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPV 102

Query: 72  XXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMT 131
                YLFMGTV++SVTQSLGEM TFIPVT+SF+VFAQRFLSPA GA NGYMYW SW  T
Sbjct: 103 GALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFT 162

Query: 132 FALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX 191
           FALELSV+G++IQ+WT AVPLAAWI I W LLT  N+FPV+ YGE EF IAS+KV+    
Sbjct: 163 FALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLG 222

Query: 192 XXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQG 250
                         + GP+GFRYW+NPG WG GIISS+ NE RF GWVSSLINAAFT+QG
Sbjct: 223 FIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQG 282

Query: 251 TELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSS 310
           TELVGITAGE   PRK +P+AIKKVV RILVFYI SL  IGLLVPYNDPKL S+  +VSS
Sbjct: 283 TELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSS 342

Query: 311 SPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSK 370
           SPF+I+I+N+GTK+LP IFNAV+LITI+SAGNSNVYIGSR+LY L+KN  AP+F +N ++
Sbjct: 343 SPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTR 402

Query: 371 AGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALK 430
            GVPY +VL TS+FG LA++E + G  KAF WLLNI GVAGFFAWLLIS SHIRFM+A++
Sbjct: 403 GGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIR 462

Query: 431 QRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFII 490
           +RGISR+DLPYKA +MP+LAYYA FF+ +I++IQGFT+FAP F+  +F AAYIS+FLF+ 
Sbjct: 463 KRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLA 522

Query: 491 FWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
            W++FQ+WFKCRL+WKLQD+D+D+DRR IEE VW   +E + K  W R W+ ++
Sbjct: 523 IWLSFQVWFKCRLLWKLQDIDIDSDRRQIEELVW---IEPECKTRWQRVWDVLS 573

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/514 (65%), Positives = 400/514 (77%), Gaps = 3/514 (0%)

Query: 31  KQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQS 90
           K+ +VKR+LK+RHI M                              YLFM T+VFSVTQS
Sbjct: 93  KEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQS 152

Query: 91  LGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAV 150
           LGEM TFIPVT+SFTVF+ RFLSPA GAANGYMYWFSWA+TFALELSVVGQIIQFWT AV
Sbjct: 153 LGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTHAV 212

Query: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGPVG 210
           PL+AWI I WV+LTI NLFPV+ YGE EFW+AS+KVL                 VTGPVG
Sbjct: 213 PLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVTGPVG 272

Query: 211 FRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPK 270
           FRYW+NPGPWG GIIS +VNE RF GWVSSLINAAFT+QGTELVGITAGE   PRKTVP+
Sbjct: 273 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 332

Query: 271 AIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFN 330
           AIKKV FRIL+FYI SL  IGLLVPY+D KL S DSY+S+SPFII I+N+GTKILPHIFN
Sbjct: 333 AIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSYISASPFIIAIENSGTKILPHIFN 392

Query: 331 AVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYM 390
           AVIL TIISAGNSNVY+GSRIL+GLAK K APK+F  TS+ GVPY +V FTS FG+LA++
Sbjct: 393 AVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGALAFL 452

Query: 391 ETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLA 450
           E ++GG KAF WLLNI+ VAGFFAWLLIS +H+RFM+ALK RGISR+DLP+KA  MP LA
Sbjct: 453 EVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFMPHLA 512

Query: 451 YYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDV 510
           YY++FFM III+IQGFT+FAP F  ++F AAYIS+FLF   W+ FQ++F+ +L+W +++V
Sbjct: 513 YYSIFFMTIIIIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWTVEEV 572

Query: 511 DLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           D+DTDRRD++  +W D      K +WD+FW+ VA
Sbjct: 573 DIDTDRRDVDAIIWED---SGPKTFWDKFWDVVA 603

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/538 (62%), Positives = 395/538 (73%), Gaps = 5/538 (0%)

Query: 7   QVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXX 66
           QV   +  S +   +I  +D+   +  +VKR LK RHISM                    
Sbjct: 56  QVSPMRTGSPNV--SIDYMDEGNVQDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLA 113

Query: 67  XXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWF 126
                     Y+FMGT+ + VTQSLGEM TFIPVT+SFTVF QRFLSPAFG ANGY+YWF
Sbjct: 114 DAGPVGALIAYMFMGTIAYFVTQSLGEMATFIPVTSSFTVFTQRFLSPAFGVANGYLYWF 173

Query: 127 SWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKV 186
           SW +TFALELSVVGQIIQFWT AVPL AWI+I WV+LT SNLFPV+ YGE+EFWIA +KV
Sbjct: 174 SWCITFALELSVVGQIIQFWTFAVPLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKV 233

Query: 187 LXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAF 246
           L                  TGPVGFRYW+NPGPWG GIIS +VNE RF GWVSSLINAAF
Sbjct: 234 LAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAF 293

Query: 247 TFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDS 306
           T+QGTELVGITAGE + PR+TVP+AI KV FRIL FYI SLL IGLLVP+NDPKL+S DS
Sbjct: 294 TYQGTELVGITAGESKNPRRTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDS 353

Query: 307 YVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFT 366
           Y+SSSPF+I I+N+GTK+LPHIFNAVIL TIISAGNSN+Y+GSR+LYGLAKNK APK F 
Sbjct: 354 YISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFA 413

Query: 367 NTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFM 426
             +K GVPY++VL T+ FG LAY+  +    K F WLLNI  +AGFFAWL IS +HIRFM
Sbjct: 414 RATKDGVPYISVLGTAAFGFLAYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFM 473

Query: 427 KALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVF 486
           + LK R +SRNDLP+KA  MPW AYY+ FF+ +II+IQGFT+FAPKF V+NFFAAYISVF
Sbjct: 474 QVLKDRNMSRNDLPFKAKFMPWGAYYSAFFISLIIIIQGFTAFAPKFNVSNFFAAYISVF 533

Query: 487 LFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           LF+  WV FQI F+ R +    DVD+DTDRRDI+  VW    E+  KN WD+FW  +A
Sbjct: 534 LFLAIWVVFQIRFRTRFILTKNDVDIDTDRRDIDCIVWE---EETPKNAWDKFWAAMA 588

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/551 (58%), Positives = 395/551 (71%), Gaps = 12/551 (2%)

Query: 3   LNQPQVHSFQVDSND---------TPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXX 53
           ++  Q HS + + N          +   +S       K+  VKR LK RHISM       
Sbjct: 1   MSAQQHHSSEKEKNSEELVSEFSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTI 60

Query: 54  XXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLS 113
                                  Y+F+GT+ + V+QSLGEM TFIPVT+SF VF QRFLS
Sbjct: 61  GTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLS 120

Query: 114 PAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRI 173
           PA GAANGYMY+ SW++TFALELSVVGQ+IQFWT AVPL AWI I+WV+L  +NL PV+ 
Sbjct: 121 PALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKF 180

Query: 174 YGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEAR 233
           YGE+EFWIA +KVL                  TGPVGFRYW+NPGPWG GIIS +VNE R
Sbjct: 181 YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR 240

Query: 234 FFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLL 293
           F GWVSSLI+AAFT+QGTELVGITAGE   PRKTVP+AI KV FRIL FYI SLL IGLL
Sbjct: 241 FLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLL 300

Query: 294 VPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILY 353
           VP+NDPKL+S DSY+SSSPF+I I+N+GTK+LPHIFNAVIL TIISAGNS+VYI SR+LY
Sbjct: 301 VPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLY 360

Query: 354 GLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFF 413
            +  N  APK+ T T+K+G+PY  VL TS+ G LAY+E++ G    F WLLNI  VAGFF
Sbjct: 361 SMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFF 420

Query: 414 AWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKF 473
           AW+LIS +HIRFM+ALK +GISR+DLP+KA  MPW AYYA FF+ +II+IQGFT+FAPKF
Sbjct: 421 AWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKF 480

Query: 474 KVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNK 533
            V++FF AY+SV LF   W+ FQIWF+  L  K +D+DLDTDRR+I+ +VW    ED+ K
Sbjct: 481 NVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREIDNDVWE---EDEPK 537

Query: 534 NWWDRFWNYVA 544
           N W++FW+ VA
Sbjct: 538 NLWEKFWSAVA 548

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/469 (67%), Positives = 377/469 (80%), Gaps = 4/469 (0%)

Query: 77  YLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALEL 136
           Y+FMGTV++SVTQSLGEM TFIPVT+SF+VFAQRFLSPA GA NGYMYW SW  TFALEL
Sbjct: 32  YIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALEL 91

Query: 137 SVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXX 196
           SV+GQIIQ+WT AVPL+AWI I W LLT+ N+FPV+ YGE EF IAS+KV+         
Sbjct: 92  SVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIIYS 151

Query: 197 -XXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVG 255
                      GP+GFRYW+NPG WG GIISS+ NE RF GWVSSLINAAFT+QGTELVG
Sbjct: 152 FCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVG 211

Query: 256 ITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFII 315
           ITAGE   PRK VP+AIKKVV RILVFYI SL  IGLLVPYNDPKL S+ S+VS+SPF+I
Sbjct: 212 ITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLDSDGSFVSASPFMI 271

Query: 316 TIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPY 375
           +I+N+GTK+LP IFNAV+LITI+SAGNSNVYIGSR+LY L+KN  AP+F +  +K GVPY
Sbjct: 272 SIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAPRFLSIVTKGGVPY 331

Query: 376 VTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGIS 435
             VL TS+FG LA++ET+ G  KAF WLLNI GVAGFFAWLLIS SHIRFM+A+ +RGIS
Sbjct: 332 FAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAISKRGIS 391

Query: 436 RNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAF 495
           RNDLPYKA +MP+LAYYA FF+ +I++IQGFT+FAP F+  +F AAYISVFLF+  W +F
Sbjct: 392 RNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVAAYISVFLFVAIWFSF 451

Query: 496 QIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           Q+WFKC ++ KLQDVD+D+DRR+IEE+VW   +E   K  W   W+ +A
Sbjct: 452 QLWFKCPIILKLQDVDIDSDRREIEEQVW---IEPLRKTKWQCVWDVLA 497

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/539 (62%), Positives = 401/539 (74%), Gaps = 9/539 (1%)

Query: 12  QVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXX 71
           Q D++ T      L+       +VKRELK+RHI M                         
Sbjct: 39  QTDASSTTEDEEMLNSGSVHDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPV 98

Query: 72  XXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMT 131
                Y+F+GT+ ++VTQSLGEM TFIPVT+SFTVFA RFLSP+ GAA GYMYWFSWA+T
Sbjct: 99  GSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVT 158

Query: 132 FALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX 191
           FALELSVVGQI+ +WT AVP+AAWISI WV+LT  N+FPV+ YGEIEFW+A+VKV+    
Sbjct: 159 FALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVG 218

Query: 192 XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGI------ISSNVNEARFFGWVSSLINAA 245
                        VTGPVGFRYW+NPGPWG G+      IS N N  RF GW +SLINAA
Sbjct: 219 FLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAA 278

Query: 246 FTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSND 305
           FT+QGTELVGITAGE   PRKTVP+AIKKVVFRIL+FYIGSL  IGLLVP++DPKL S+D
Sbjct: 279 FTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSDD 338

Query: 306 SYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFF 365
           SYVSSSPFII I+N+GTKILP IFNA+ILITIISAGNSN+Y+GSRIL+ LAK   APK  
Sbjct: 339 SYVSSSPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKIL 398

Query: 366 TNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRF 425
           + T+K GVP+V+VL T++FG LAYMETT GG   F WL+NI  +AGF+AWL I  SHIRF
Sbjct: 399 SRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRF 458

Query: 426 MKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISV 485
           M+ LK RGISR+DLP+KA LMP LAYYAVF MVIII+ QGFT+F P F V++FFAAYISV
Sbjct: 459 MQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISV 518

Query: 486 FLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
            LF + W AFQ+WFKCR +WKL+DVD+D++RRD+E+ +W D    + K +WD+FWN VA
Sbjct: 519 ILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWED---PEPKTFWDKFWNVVA 574

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/536 (64%), Positives = 410/536 (76%), Gaps = 8/536 (1%)

Query: 9   HSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXX 68
           HS   D  D P     +D    +  +VKRELK+RHI M                      
Sbjct: 68  HSVSGD-EDEPY----VDQGVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNA 122

Query: 69  XXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSW 128
                   YLFM T+VFSVTQSLGEM TFIPVT+SFTVF+ RF+SP+ GAANGYMYWFSW
Sbjct: 123 GPVGSLIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRFISPSIGAANGYMYWFSW 182

Query: 129 AMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLX 188
           A+TFALELSVVGQIIQFWT AVPL+AWI I W +LTI N+FPV+ YGE EFW+AS+KV+ 
Sbjct: 183 AITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIA 242

Query: 189 XXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTF 248
                           VTGPVGFRYW+NPGPWG GIISS V E RF GWVSSLINAAFT+
Sbjct: 243 IMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY 302

Query: 249 QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV 308
           QGTELVGITAGE   PRKTVP+AIKKV FRIL+FYI SL  IGLLVP++DPKL S+DSYV
Sbjct: 303 QGTELVGITAGEAANPRKTVPRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDDSYV 362

Query: 309 SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNT 368
           SSSPFII IQN+GTK+LPHIFNAVIL TIISAGNSN+Y+GSR+++GLAK K AP++F  T
Sbjct: 363 SSSPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGIT 422

Query: 369 SKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKA 428
           +K GVPY+ VLFTS FG+LA++E ++GG KAF WLLNIVGVAGFFAWLLIS +H+RF++ 
Sbjct: 423 TKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQT 482

Query: 429 LKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLF 488
           L+ RGISR+DLP+KA LMPWLAYYA+FFM+III+IQGFT+FAP F  ++F AAYISVFLF
Sbjct: 483 LEHRGISRDDLPFKAALMPWLAYYAIFFMIIIIIIQGFTAFAPTFNGSDFVAAYISVFLF 542

Query: 489 IIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
              WV+FQ++F+C+L W L +VD+DTDRRDI+  +W D      K +WDRFW+ VA
Sbjct: 543 FFLWVSFQLYFRCKLYWSLDEVDIDTDRRDIDAIIWEDSAP---KTFWDRFWDVVA 595

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/514 (64%), Positives = 383/514 (74%), Gaps = 5/514 (0%)

Query: 31  KQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQS 90
           ++  VKRELK RHI M                              Y+FMGT+VFSVTQS
Sbjct: 98  EEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQS 157

Query: 91  LGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAV 150
           LGEM TFIPVT+SFTVFA RF+S  FGAA GYMYWFSWA+TFALELSVVGQ+I+FWT  V
Sbjct: 158 LGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217

Query: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGPVG 210
           PLAAWISI WVL+ I N FPV++YGE EFW+AS+KV+                 +TGPVG
Sbjct: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVG 277

Query: 211 FRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPK 270
           FRYW++PGPWG GIIS + NEARF GWVSSLINAAFT+QGTELVGITAGE   PRK+VP+
Sbjct: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337

Query: 271 AIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFN 330
           AIKKV  RIL+FYI SL  IGLLVPYNDPKL S DSYVS+SPFII IQN+GTK+LPHIFN
Sbjct: 338 AIKKVSVRILLFYILSLFFIGLLVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFN 397

Query: 331 AVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYM 390
           AVIL TIISA NSNVY+GSRILYGL+  K APKFF  T + GVP++ VLFT+ FG+LAYM
Sbjct: 398 AVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYM 456

Query: 391 ETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLA 450
           ET+ GG  AF WLLNI GVAGFFAWL IS SHIRFM+ LK RG+SR+DLPYKA LMP LA
Sbjct: 457 ETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLA 516

Query: 451 YYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDV 510
           YY  FF+ +II+IQGFT+FAPKF    F  AYIS FLF+  ++  Q +F+ RL   L DV
Sbjct: 517 YYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLDDV 576

Query: 511 DLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           D+DTDRRDI+  +W    E+  + +WD+FW  +A
Sbjct: 577 DIDTDRRDIDTVIW----EEGPQTFWDKFWAVIA 606

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/509 (60%), Positives = 373/509 (73%), Gaps = 3/509 (0%)

Query: 34  DVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGE 93
           DVKR+LK RH+SM                              YLFMGT+ F VTQSLGE
Sbjct: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120

Query: 94  MCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLA 153
           M TFIPVT+SFT++ QRFLSPA GAANGY+YWFSW +TFALELS++GQ+IQ+WT AVPL+
Sbjct: 121 MATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS 180

Query: 154 AWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGPVGFRY 213
            WI + W+LLT SN+ PVR YGEIEFWIA++KVL                   G +GFRY
Sbjct: 181 VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRY 240

Query: 214 WKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIK 273
           WKNPGPWGMG+ISSN  EARF GWVSSLI AAFT+QGTELVGITAGE + PRKTVPKAI 
Sbjct: 241 WKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAIN 300

Query: 274 KVVFRILVFYIGSLLVIGLLVPYNDPKLQS-NDSYVSSSPFIITIQNAGTKILPHIFNAV 332
           KV FRIL FYI SL  +GLLVPY DP+L + +DS +++SPF++ IQN+GTK+LP +FN V
Sbjct: 301 KVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGV 360

Query: 333 ILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMET 392
           IL+TI+SAGNSN+YIGSR+LYGL+K+  AP  F  T+K GVP+  VL +S+FG LAY+  
Sbjct: 361 ILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNI 420

Query: 393 TTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYY 452
           +    K F WLL I  VAGFFAWLLIS SHIRFM+ LK RGISRNDLP+KA  MPW AYY
Sbjct: 421 SQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYY 480

Query: 453 AVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDL 512
           A FF+ +II+IQGF SFAP+F  + F A YISVFLFI+ W+ FQ+ FK RL+ + +DVD+
Sbjct: 481 AAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDI 540

Query: 513 DTDRRDIEEEVWSDDVEDKN--KNWWDRF 539
           DTDRR+I+  VWSDD E K   +  W  F
Sbjct: 541 DTDRREIDALVWSDDDEPKTLLQKLWQSF 569

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/546 (56%), Positives = 388/546 (71%), Gaps = 6/546 (1%)

Query: 2   KLNQPQVHSFQ---VDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXX 58
           +L   ++ SF    +D     +  S L      +  V+R+LK RH+SM            
Sbjct: 17  RLEDYEMGSFAEEALDQEAQSSQDSQLGSSGHGRNAVQRQLKPRHVSMIALGGTIGTGLF 76

Query: 59  XXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGA 118
                             YLFMG++ + VTQSLGEM TFIPVT+SFTVF +RFLS   GA
Sbjct: 77  IGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIPVTSSFTVFTRRFLSLPLGA 136

Query: 119 ANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIE 178
           ANGYMY FSW++T+ALELS+VGQII++WT AVP AAWI+I WV +T+SNL PV+ YGE +
Sbjct: 137 ANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAAWIAIFWVPITLSNLVPVKFYGEFQ 196

Query: 179 FWIASVKVLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWV 238
           FWIA +KV+                  TGPVGFRYW+NPGPWG GIIS +++E RF GWV
Sbjct: 197 FWIALIKVVAIIGFLVYCLCMVCGAGKTGPVGFRYWRNPGPWGDGIISHDIHEGRFLGWV 256

Query: 239 SSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYND 298
           SSL+NAAFT+QGTELVGI+AGE   PRKTVPKAI KV FRIL+FY+GSL  IGLLVP+ND
Sbjct: 257 SSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRILLFYVGSLFFIGLLVPFND 316

Query: 299 PKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKN 358
            KL S+DSY + SPFII IQN+GTKILP IFNAVIL TIISA NSNVY+GSR+LYGLAK 
Sbjct: 317 EKLTSSDSYSAGSPFIIAIQNSGTKILPDIFNAVILATIISAANSNVYVGSRVLYGLAKE 376

Query: 359 KAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLI 418
           + AP+FF  T++ GVP V VLF + FG L Y+  + G  KAF WLLNI  +AGFF+WL I
Sbjct: 377 RLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFDWLLNITAIAGFFSWLFI 436

Query: 419 SCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANF 478
           S  H+RFM+ALK +GISR+DLP+KA LMPW AYY+ FF+ +II+IQGFTS AP F V+NF
Sbjct: 437 SLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIIIIQGFTSLAPTFNVSNF 496

Query: 479 FAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDR 538
           FAAYISVF+F++ W  FQ W++ R++ +++ VD+D+DRR+++ + W D+ E      W +
Sbjct: 497 FAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVDAQQW-DNTEP--TTLWGK 553

Query: 539 FWNYVA 544
           FW  +A
Sbjct: 554 FWAAMA 559

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/551 (57%), Positives = 389/551 (70%), Gaps = 13/551 (2%)

Query: 4   NQPQVHSFQVDSNDTPTTISTLDDDQEKQ----------QDVKRELKKRHISMXXXXXXX 53
            QPQ+H  ++   +   + S  D   E+Q          + ++R LK RH+SM       
Sbjct: 8   KQPQLHKNEIKVMEEGESSSLADGVLEQQSQIDTASSQERGIQRALKPRHVSMIALGGTI 67

Query: 54  XXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLS 113
                                  YLFMG++ F VTQSLGEM TFIPV +SFTVF +RFLS
Sbjct: 68  GTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMATFIPVASSFTVFTRRFLS 127

Query: 114 PAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRI 173
           PA GAANGYMY FSW +TFALELS+VG+IIQ+WT+ VP AAWI I WV +++SNL  V+ 
Sbjct: 128 PALGAANGYMYCFSWCITFALELSIVGEIIQYWTLGVPNAAWIIIFWVPISLSNLVSVKF 187

Query: 174 YGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEAR 233
           YGE +FWIA +KV+                  TGPVGFRYW+NPGPWG GIIS + +E R
Sbjct: 188 YGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKTGPVGFRYWRNPGPWGDGIISKSKSEGR 247

Query: 234 FFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLL 293
           F GWVSSL+NAAFT+QGTELVG++AGE   PRKTVPKAI+KV  RIL+FY+GSL  IGLL
Sbjct: 248 FLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIRKVFLRILLFYVGSLFFIGLL 307

Query: 294 VPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILY 353
           VP+NDPKL S  +Y +SSPFII IQN+GT+ LP IFNAVIL TIISA NSNVY+GSR+LY
Sbjct: 308 VPFNDPKLDSTANYSASSPFIIAIQNSGTRALPDIFNAVILTTIISAANSNVYVGSRVLY 367

Query: 354 GLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFF 413
           GLAK   APK     ++ GVPY+ V   S+FG L Y+  ++G  KAF WLLNI  +AGFF
Sbjct: 368 GLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYLSVSSGSAKAFDWLLNITAIAGFF 427

Query: 414 AWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKF 473
           AWL IS  HIRFM+ALK +GISR+DLP+KA LMPW AYYA FF+++II+IQGFT+FAPKF
Sbjct: 428 AWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAAFFILLIIIIQGFTAFAPKF 487

Query: 474 KVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNK 533
            V+NFFAAY+SVFLFI  WV FQ+ FK RL+ K++DVD+D+DRR+IE EVW D   D+  
Sbjct: 488 NVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIHKVEDVDIDSDRREIEAEVWED---DEPT 544

Query: 534 NWWDRFWNYVA 544
           N W +FW  +A
Sbjct: 545 NLWGKFWAAMA 555

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/536 (56%), Positives = 381/536 (71%), Gaps = 3/536 (0%)

Query: 9   HSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXX 68
           + ++VD+          +  + +  +VKR LK RHI M                      
Sbjct: 48  YGYRVDNEYDVDDSVDGEKGEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNA 107

Query: 69  XXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSW 128
                   YLFM T+ FSV QSLGEM T+IPVT++F+VF+QRFLSPAFGAANGYMYWFSW
Sbjct: 108 GPVGMLIAYLFMATIAFSVMQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSW 167

Query: 129 AMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLX 188
           ++TFALELSV+GQI+Q+WT  VP+AAWISI WVL+   N  PV+ YGE EFWIA +KV+ 
Sbjct: 168 SITFALELSVIGQIVQYWTFKVPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVA 227

Query: 189 XXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTF 248
                            TGPVGFRYW++   +G GIIS N NEARF GWVSSLINAAFT+
Sbjct: 228 IVGFIIYCFIMVCGAGKTGPVGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTY 287

Query: 249 QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV 308
           QGTELVGITAGE   PRKTVPK+IK+ ++RIL+FYI SLL +GLLVP+ND  LQ + SY 
Sbjct: 288 QGTELVGITAGEAANPRKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYA 347

Query: 309 SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNT 368
           +SSPFI+ I+N+GTK LP IFNAVIL T+ISA NS+VY+GSR++Y +A+N+ AP      
Sbjct: 348 ASSPFILAIKNSGTKALPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKA 407

Query: 369 SKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKA 428
           SK GVPY  VLFTS  G+LAY+ET++ G   F WL+NI GVAGFF+W LIS SH+RFMKA
Sbjct: 408 SKGGVPYAAVLFTSAIGALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKA 467

Query: 429 LKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLF 488
           LKQRGISRNDLP+KA  MPW+A Y+ FFM +II++QGFT F P F+ ++F A+YISV LF
Sbjct: 468 LKQRGISRNDLPFKASFMPWIAIYSFFFMTLIILVQGFTCFTPHFQASDFVASYISVGLF 527

Query: 489 IIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
            + W  FQIWF+C L+  + ++D+DTDRRD++ EVW D   +  K  WD+FWN VA
Sbjct: 528 FVIWAVFQIWFRCPLLVPIAEIDIDTDRRDVDAEVWED---EPPKTLWDKFWNIVA 580

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/546 (55%), Positives = 385/546 (70%), Gaps = 11/546 (2%)

Query: 7   QVHSFQVDSNDTPTTISTLDDDQEKQQD--------VKRELKKRHISMXXXXXXXXXXXX 58
           ++ S    SN      ++L DD+E   +        VKR LK+RHI M            
Sbjct: 68  EIGSLHSGSNLHQHGTTSLHDDEESDTEEAQYQDTRVKRALKQRHIGMIALGGTIGTGLF 127

Query: 59  XXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGA 118
                             Y+FMG+VV+ VTQSLGEM TFIPVT+S TVF++RFLSPAFG 
Sbjct: 128 VGIATPLSNAGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGV 187

Query: 119 ANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIE 178
           ANGYMYWF+WA+T+A+E+SV+GQ+IQ+WT AVPLAAWI I WV++T+ N FPV++YGE E
Sbjct: 188 ANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIGIFWVIVTLMNFFPVKVYGEFE 247

Query: 179 FWIASVKVLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWV 238
           FWIAS+KVL                   GP+GFRYW+NPGPWG GIIS    EARF GWV
Sbjct: 248 FWIASIKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGPWGPGIISDKTGEARFLGWV 307

Query: 239 SSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYND 298
           SSLINAAFT+QGTELVGITAGE   PRK+VP+AI KVVFRI +FYI SL  IGLLVP+ND
Sbjct: 308 SSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFND 367

Query: 299 PKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKN 358
            +L ++ + ++SSPF+I+IQNAGT+ LP IFNAV+L+TIISA NSNVY+GSR+LY LA  
Sbjct: 368 DRLANDSAVIASSPFVISIQNAGTRALPDIFNAVVLLTIISAANSNVYVGSRVLYALALT 427

Query: 359 KAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLI 418
             APK F+  +K GVPY+ V+ T+  G LA++      + AF WL+NI  +AG  AWL I
Sbjct: 428 GNAPKIFSYVTKYGVPYMGVICTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFI 487

Query: 419 SCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANF 478
           S SHIRFM+ALK RGISR+DLP+KA LMPW AYYA FF+ +II IQGF +F PKF V+ F
Sbjct: 488 SLSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYASFFVTVIIFIQGFQAFTPKFDVSTF 547

Query: 479 FAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDR 538
           F +YIS+ L  + +   Q++++CR +WK++D+D+D+DRR+IE  +W    ED+ KN W++
Sbjct: 548 FTSYISLILLAVLFSGCQLYYRCRFIWKVEDIDIDSDRREIEAIIWE---EDEPKNLWEK 604

Query: 539 FWNYVA 544
           FW +VA
Sbjct: 605 FWAWVA 610

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/541 (58%), Positives = 388/541 (71%), Gaps = 14/541 (2%)

Query: 15  SNDTPTTISTLDDDQEK---------QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXX 65
           S D   T+  +DDD  +         Q +VKR LK RH+SM                   
Sbjct: 44  SKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPL 103

Query: 66  XXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYW 125
                      ++ +GT+ +SVTQSLGEM TFIPVT+SFTVF+QRF+SPA GAANGYMYW
Sbjct: 104 WNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYW 163

Query: 126 FSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVK 185
           FSWA+TFALELS+VGQIIQ+WT AVPL AWI+I WVLL   N+FPV+ YGE EFW+AS+K
Sbjct: 164 FSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIK 223

Query: 186 VLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAA 245
           V+                   GP+GFRYW+ PGPWG GII+ NVN+ARF GWVSSLI+AA
Sbjct: 224 VIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAA 283

Query: 246 FTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSND 305
           FT+QGTELVGITAGE + PRK VP+AI KV FRIL+FYIGSL  IGLLVPYNDPKL+ +D
Sbjct: 284 FTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSD 343

Query: 306 --SYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPK 363
             SY++ SPF+I I N  T +LPHIFNAVIL TIISAGNSNVY+GSRIL+GL+KN  APK
Sbjct: 344 NGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPK 403

Query: 364 FFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHI 423
           FF+ T+K GVP++ VL T++FG LAY+  +    + F WLLNI  +AGF  WLLIS SHI
Sbjct: 404 FFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHI 463

Query: 424 RFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYI 483
           RFM+ LK RGISR+DLPYKA  MP+ AYYA FF+ +II+IQGFT+FAP F V++FFAAYI
Sbjct: 464 RFMQTLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIIIIQGFTAFAPHFNVSDFFAAYI 523

Query: 484 SVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYV 543
           SVFLF I W  FQ  ++ +L   L +VD+D+DRRDI+  +W    E++ KN W++FW   
Sbjct: 524 SVFLFFIVWAIFQTIYRTKLFRTLDEVDIDSDRRDIDVIIWE---EEEPKNLWEKFWAVA 580

Query: 544 A 544
           A
Sbjct: 581 A 581

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/533 (56%), Positives = 383/533 (71%), Gaps = 9/533 (1%)

Query: 18  TPTTISTLDDDQEKQQD-----VKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXX 72
           TP +     ++ E++ D     VKR LK RHISM                          
Sbjct: 38  TPDSGDEFPEEHEQEGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVG 97

Query: 73  XXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTF 132
               Y+FMGTVV+S+TQSLGEM TFIPVT+S TVF++RFLSPAFG ANGYMYWF+WA+TF
Sbjct: 98  SLIAYIFMGTVVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITF 157

Query: 133 ALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXX 192
           A+ELSVVGQII +WT  VPL AWI+I W+++T+ N FPVR YGEIEFWIASVKV+     
Sbjct: 158 AVELSVVGQIINYWTSVVPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGY 217

Query: 193 XXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTE 252
                         GP+GFR W+NPGPWG G+ISSN  EARF GWVSSLI AAFT+QGTE
Sbjct: 218 LIYAFIVVCGGSSQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTE 277

Query: 253 LVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL-QSNDSYVSSS 311
           LVGITAGE + PRKTVPKAI KV FRIL FYI SL  +GLLVPYNDP++  ++D+ V++S
Sbjct: 278 LVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNAS 337

Query: 312 PFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKA 371
           PF+I+I+NAGTKILP IFNAV+L+T++SA NSNVYIGSR++Y LA++  APK F   ++ 
Sbjct: 338 PFVISIRNAGTKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRH 397

Query: 372 GVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQ 431
           GVP + V+ T++ G +A++        AF WL+NI  +AG  AWL IS +HIRFM+ LKQ
Sbjct: 398 GVPVLGVMVTALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQ 457

Query: 432 RGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIF 491
           RGISR+ LP+KA  MPW AYYA  F+ +II IQG+T+F+PKF V  FF AYIS+ L ++ 
Sbjct: 458 RGISRDALPFKAKFMPWAAYYAASFVFVIIFIQGYTAFSPKFDVTQFFTAYISLMLMLVV 517

Query: 492 WVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           ++  QI++KCR +WKL+D+D+DT+RR+I+  VW D   D+ KN WD+FW+ +A
Sbjct: 518 FIGCQIYYKCRFLWKLEDIDIDTNRREIDAIVWED---DEPKNLWDKFWSTIA 567

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/516 (57%), Positives = 375/516 (72%), Gaps = 3/516 (0%)

Query: 29  QEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVT 88
           Q    +VKR LK+RHI M                              YLFMG++++S+T
Sbjct: 95  QYHDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSIT 154

Query: 89  QSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTM 148
           QSLGEM TFIPVT+S TVF++RFLSPAFG ANGYMYWF+WA+T+A+E+SVVGQ+I++WT 
Sbjct: 155 QSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTK 214

Query: 149 AVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGP 208
            VPLAAWI+I WV +T+ N FPV++YGEIEFWIA +KVL                   GP
Sbjct: 215 KVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGSSQGP 274

Query: 209 VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTV 268
           +GFRYW+NPGPWG GIIS + N +RF GWVSSLINAAFT+QGTELVGITAGE   PRK+V
Sbjct: 275 IGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 334

Query: 269 PKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHI 328
           P+AI KVVFRI +FYI SL  IGLLVPY+DP+L S+ + V+SSPF+I+IQNAGTKILP I
Sbjct: 335 PRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASSPFVISIQNAGTKILPDI 394

Query: 329 FNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLA 388
           FNA+++IT+ISA NSNVY+GSR+LY LA+   APK F   ++ GVPY+ VL T+  G LA
Sbjct: 395 FNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLA 454

Query: 389 YMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPW 448
           ++      + AF WL+NI  +AG  AWL IS SHIRFM+ALK RGISR+DLP+KA  MPW
Sbjct: 455 FLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPW 514

Query: 449 LAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQ 508
            AYYA FF+ +II IQGF +F+P F V  FF AYIS+ +  + ++  QI+++CR  WKL+
Sbjct: 515 AAYYATFFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWKLE 574

Query: 509 DVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           D+D+DTDRR+IEE +W D   D+ K +WD+FW  VA
Sbjct: 575 DIDIDTDRREIEEVIWED---DEPKTYWDKFWAAVA 607

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/534 (55%), Positives = 381/534 (71%), Gaps = 7/534 (1%)

Query: 15  SNDTPTTISTLDDDQE----KQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXX 70
           S+ +   IS+ + D +    K   VKR LK RHI M                        
Sbjct: 78  SHPSEARISSDEYDHQEAEFKDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGP 137

Query: 71  XXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAM 130
                 Y+FMGTVV+ VTQ+LGEM TFIPVT+S TVF+ RFLSPAFG +NGY+YWF+WA+
Sbjct: 138 VGSLIAYIFMGTVVYFVTQALGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAI 197

Query: 131 TFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXX 190
           T+A+E+SVVGQ+I+FWT  VPLAAWISI WVL+T  N FPV +YGEIEFW+ASVKVL   
Sbjct: 198 TYAVEISVVGQVIEFWTTKVPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIV 257

Query: 191 XXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQG 250
                           GP+GFRYW++    G G+IS + NEARF GWV+SLINAAFT+QG
Sbjct: 258 GYLIYALVIVCGGSKQGPIGFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQG 317

Query: 251 TELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSS 310
           TELVGITAGE   PRK+VP+AI KVVFRI++FYI SL  IGLLVPYNDPKL S  SY++S
Sbjct: 318 TELVGITAGEAANPRKSVPRAINKVVFRIVIFYILSLFFIGLLVPYNDPKLNSATSYIAS 377

Query: 311 SPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSK 370
           SPF+I+I+NAGT+ LPHIFNA+I+ITIISA NSNVY+ SR+LY LA +  APK F   + 
Sbjct: 378 SPFVISIENAGTRALPHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTP 437

Query: 371 AGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALK 430
            GVP++ V+ T++ G LA++      ++AF WL+NI  +AG  AWL IS SH+RFM+ALK
Sbjct: 438 QGVPFLGVIVTALMGLLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALK 497

Query: 431 QRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFII 490
            RGISR+DLP+KA  MP+ +YYA FF+ +II IQGFT+F+PKF VA+FF AYIS+ L  +
Sbjct: 498 YRGISRDDLPFKARFMPYGSYYACFFITVIIFIQGFTAFSPKFDVASFFTAYISLILLAV 557

Query: 491 FWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
            ++  Q++++CR  WK++D+D+DTDRR+I+E VW D   D+ K  WD+FW  VA
Sbjct: 558 LFIGCQLYYRCRFFWKVEDIDIDTDRREIDEIVWED---DEPKTAWDKFWAAVA 608

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/521 (56%), Positives = 384/521 (73%), Gaps = 5/521 (0%)

Query: 26  DDDQEKQQD--VKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTV 83
           D ++    D  VKR LK+RHI M                              YLFMG++
Sbjct: 56  DAEEAGYHDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSI 115

Query: 84  VFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQII 143
           V+ +TQSLGEM TFIPVT+S TVF++RFLSPAFG ANGYMYWF+WA+T+A+E+SV+GQ+I
Sbjct: 116 VYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVI 175

Query: 144 QFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXX 203
           QFWT AVPLAAWI+I WV +++ N FPV++YGEIEFW+AS+KV+                
Sbjct: 176 QFWTSAVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGG 235

Query: 204 XVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQE 263
              GP+GFRYW+NPGPWG GIIS + NE RF GWVSSLINAAFT+QGTELVGITAGE   
Sbjct: 236 SSQGPIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 295

Query: 264 PRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTK 323
           PRK+VP+AI KVVFRI++FYI SL  +G+LVP+NDP+L SN + ++SSPF+I+IQNAGT+
Sbjct: 296 PRKSVPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRLASNVAVIASSPFVISIQNAGTR 355

Query: 324 ILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSM 383
           +LPHIFNAV+++TIISA NSNVY+GSR+LY L++   APK F   ++ GVPY+ V+ TS+
Sbjct: 356 VLPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATSL 415

Query: 384 FGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKA 443
            G LA++      + AF WL+NI  +AG  AWL IS SHIRFM+ALK RGISR+DLP+KA
Sbjct: 416 LGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKA 475

Query: 444 MLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRL 503
            LMPW AYYA FF+ +II IQGF +F+PKF V+ FF AYIS+ + ++  +  Q++++CR 
Sbjct: 476 KLMPWGAYYAAFFVTVIIFIQGFEAFSPKFDVSGFFTAYISLIILVVLLIGCQLYYRCRF 535

Query: 504 VWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           +WKL+D+D+DTDRR+IE  +W ++     +N W++FW+ +A
Sbjct: 536 LWKLEDIDIDTDRREIECIIWEEEEP---QNLWEKFWSIMA 573

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/512 (57%), Positives = 375/512 (73%), Gaps = 4/512 (0%)

Query: 33  QDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLG 92
           + VKR LK+RHI M                              Y+FMGTV++ +TQSLG
Sbjct: 104 KHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLG 163

Query: 93  EMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPL 152
           EM TFIPVT+S TVF++RFLSPAFG +NGYMYWF+WA+T+A+E+SV+GQ+IQ+WT  VPL
Sbjct: 164 EMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPL 223

Query: 153 AAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGPVGFR 212
           AAWI+I WVL+T+ N FPV++YGE EFW+ASVKVL                   GP+GFR
Sbjct: 224 AAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGSHQGPIGFR 283

Query: 213 YWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAI 272
           YW+NPG WG GIIS N +E RF GWVSSLINAAFT+QGTELVGITAGE   PRKTVP+AI
Sbjct: 284 YWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 343

Query: 273 KKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAV 332
            KVVFRI++FYI SL  IGLLVPYN+P+L  + + ++SSPF+I+IQNAGT  LP IFNAV
Sbjct: 344 NKVVFRIVIFYIMSLFFIGLLVPYNEPRLSPSSAVIASSPFVISIQNAGTYALPDIFNAV 403

Query: 333 ILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMET 392
           +LIT+ISA NSNVY+GSR+LY LA++  APK F   +K GVPY+ VL T+  G LA++  
Sbjct: 404 VLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFLVV 463

Query: 393 TTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYY 452
               + AF WL++I  +AG  AWL IS +HIRFM+ALKQRGISR+DLP+KA LMP+ AYY
Sbjct: 464 NNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAYY 523

Query: 453 AVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDL 512
           A FF+ III IQGF +F P F V+ FF +YIS+ L  + +++ Q+++KCR +WKL+D+D+
Sbjct: 524 ASFFVTIIIFIQGFQAFCP-FSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKLEDIDI 582

Query: 513 DTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           D+DRR+IE  +W D   D+ KN W++FW  VA
Sbjct: 583 DSDRREIEAIIWED---DEPKNLWEKFWAAVA 611

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/510 (57%), Positives = 377/510 (73%), Gaps = 3/510 (0%)

Query: 35  VKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEM 94
           VKR LK+RHI M                              Y+FMGT+++ VTQSLGEM
Sbjct: 91  VKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSLGEM 150

Query: 95  CTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAA 154
            TFIPVT+S TVF++RFLSPAFG ANGYMYWF+WA+T+A+E+SV+GQ+IQ+WT  VPLAA
Sbjct: 151 ATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFKVPLAA 210

Query: 155 WISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGPVGFRYW 214
           WI I WVL+T+ N FPV+IYGE EFW+AS+KV+                   GP+GFRYW
Sbjct: 211 WIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPIGFRYW 270

Query: 215 KNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKK 274
           +NPG  G GIISS++ EARF GWVSSLINAAFT+QGTELVGITAGE   PRK+VP+AI K
Sbjct: 271 RNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINK 330

Query: 275 VVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVIL 334
           VVFRI++FYI SL  +GLLVPYNDP+L ++ + ++SSPF+I+IQNAGTK+LP IFNAV+L
Sbjct: 331 VVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASSPFVISIQNAGTKVLPDIFNAVVL 390

Query: 335 ITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTT 394
           +T+ISA NSNVY+GSR+LY LA++  APK F   ++ GVPY+ V+ T++ G LA++    
Sbjct: 391 VTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAFLVVNH 450

Query: 395 GGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAV 454
             + AF WL+NI  +AG  AWL IS +HIRFM+ALK RGISR+DLP+KA  MPW AYYA 
Sbjct: 451 NANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWGAYYAS 510

Query: 455 FFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDT 514
           FF+ +II IQGF +FAPKF V+ FF AYIS+ L ++ +   Q++++CR +WKL+D+D+D+
Sbjct: 511 FFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKLEDIDIDS 570

Query: 515 DRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           DRR+I+  VW D   D+ +N W++FW  VA
Sbjct: 571 DRREIDAIVWED---DEPQNLWEKFWAAVA 597

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/514 (57%), Positives = 376/514 (73%), Gaps = 4/514 (0%)

Query: 31  KQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQS 90
           + + VKR LK+RHI M                              Y+FMGTVV+ +TQS
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 91  LGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAV 150
           LGEM TFIPVT+S TVF++RFLSPAFG ANGYMYWF+WA+T+A+E+SV+GQ+IQ+WT  V
Sbjct: 163 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKV 222

Query: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGPVG 210
           PLA WI+I WVL+T+ N FPV++YGE EFW+ASVKVL                   GP+G
Sbjct: 223 PLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSHQGPIG 282

Query: 211 FRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPK 270
           FRYW+NPG WG GIISS+ NE RF GWVSSLINAAFT+QGTELVGITAGE   PRKTVP+
Sbjct: 283 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 342

Query: 271 AIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFN 330
           AI KVVFRI++FYI SL  IGLLVPYN+P+L ++ + ++SSPF+I+IQNAGT  LP IFN
Sbjct: 343 AINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASSPFVISIQNAGTYALPDIFN 402

Query: 331 AVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYM 390
           AV+LIT+ISA NSNVY+GSR+LY LA+   APK F   +K GVPY+ VL T+  G LA++
Sbjct: 403 AVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFL 462

Query: 391 ETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLA 450
                 + AF WL+NI  +AG  AWL IS +HIRFM+AL+QRGISR+DLP+KA LMP+ A
Sbjct: 463 VVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPYGA 522

Query: 451 YYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDV 510
           YYA FF+ +II IQGF +F P FKV++FF +YIS+ L  + +   Q+++KCR +WKL+D+
Sbjct: 523 YYAAFFVTVIIFIQGFQAFCP-FKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDI 581

Query: 511 DLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           D+DTDRR+IE  +W D   D+ KN W++FW  VA
Sbjct: 582 DIDTDRREIEAIIWED---DEPKNLWEKFWAAVA 612

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/524 (55%), Positives = 375/524 (71%), Gaps = 8/524 (1%)

Query: 25  LDDDQE----KQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFM 80
           L D +E    +   VKR LK+RHI M                              Y+FM
Sbjct: 80  LSDTEEAGHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFM 139

Query: 81  GTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVG 140
           G++++ +TQSLGEM TFIPVT+S TVF++RFLSPAFG  NGYMYWF+WA+T+A+E+SVVG
Sbjct: 140 GSIIYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVG 199

Query: 141 QIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXX 200
           Q+IQ+WT AVPLAAWI+I WV +T+ N FPV++YGE+EFW+AS+KVL             
Sbjct: 200 QVIQYWTDAVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIV 259

Query: 201 XXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGE 260
                 GP+GFRYW+NPGPWG GIIS +VNE RF GWVSSLINAAFT+QGTELVGITAGE
Sbjct: 260 CGGSSQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGE 319

Query: 261 VQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNA 320
              PRK+VP+AI KVVFRI +FYI SL  IGLLVPYND  L S DSY++SSPF+I+IQNA
Sbjct: 320 AANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTLSSGDSYIASSPFVISIQNA 379

Query: 321 GTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLF 380
           GT  LP IFNAV+++TIISA NSNVY+GSR+LY LA+   APK F   +K GVP++ V+ 
Sbjct: 380 GTYALPDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIV 439

Query: 381 TSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLP 440
           T+  G LA++      + AF WL+NI  +AG  AW  I+ SHIRFM+ALK RGISR+DLP
Sbjct: 440 TASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLP 499

Query: 441 YKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFK 500
           +KA LMPW AYY+ FF+ +II IQGF +F P +    FF +YIS+ L ++ ++  Q++++
Sbjct: 500 FKAKLMPWGAYYSAFFVFVIIFIQGFEAFTP-WDTTTFFTSYISLILLVVVFIGCQLYYR 558

Query: 501 CRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           CR + K++D+D+DTDRR+IE  +W D   D+ KN W++FW +VA
Sbjct: 559 CRFLLKVEDIDIDTDRREIEAIIWED---DEPKNLWEKFWAWVA 599

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/514 (56%), Positives = 369/514 (71%), Gaps = 3/514 (0%)

Query: 31  KQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQS 90
               VKR LK+RH+ M                              YLFMG++++ +TQS
Sbjct: 89  HDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQS 148

Query: 91  LGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAV 150
           LGEM TFIPVT+S TVF++RFLSPAFG ANGYMYWF+WA+TFA+E+SVVGQ+I++WT  V
Sbjct: 149 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDKV 208

Query: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGPVG 210
           PLAAWI+I WVL+T+ N FPV++YGEIEFWIA +KVL                   GP+G
Sbjct: 209 PLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGSSQGPIG 268

Query: 211 FRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPK 270
           FRYW+NPGPWG GIIS +VN  RF GWVSSLINAAFT+QGTELVGITAGE   PRKTVP+
Sbjct: 269 FRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 328

Query: 271 AIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFN 330
           AI KVVFRI +FYI SL  IG+LVPYND +L S  + ++SSPF+I+IQNAGTK+LP IFN
Sbjct: 329 AINKVVFRIALFYIMSLFFIGMLVPYNDERLASTSAVIASSPFVISIQNAGTKVLPDIFN 388

Query: 331 AVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYM 390
           A+++ITIISA NSNVY+GSR+LY LA +  APK F   ++ GVPY+ V+ TS  G LA++
Sbjct: 389 AIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLLAFL 448

Query: 391 ETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLA 450
                 + AF WL+NI  +AG  AWL IS SHIRFM+ALK RGISR+DLP+KA LMP+ A
Sbjct: 449 VVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMPFGA 508

Query: 451 YYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDV 510
           YYA FF+ +II IQGF +F+P +    FF +YIS+ +  + ++  QI+++CR  W+++D+
Sbjct: 509 YYATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGCQIFYRCRFFWRVEDI 568

Query: 511 DLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           D+D+DRR+IE  +W D   D+ K  WD+FW  VA
Sbjct: 569 DIDSDRREIEAVIWED---DEPKTLWDKFWAAVA 599

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/544 (54%), Positives = 388/544 (71%), Gaps = 14/544 (2%)

Query: 3   LNQPQVHSFQVDSNDTPTTISTLDDDQEKQQD--VKRELKKRHISMXXXXXXXXXXXXXX 60
           L + QV S + D N+        D+++   +D  VKR LK+RHI M              
Sbjct: 80  LTRLQVVSHETDINE--------DEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVG 131

Query: 61  XXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAAN 120
                           Y+FMGT+V+ VTQSLGEM TFIPVT+S TVF++RFLSPAFG +N
Sbjct: 132 ISTPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSN 191

Query: 121 GYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFW 180
           GYMYWF+WA+T+A+E+SV+GQ+I++WT  VPLAAWI+I WV++T+ N FPV++YGE EFW
Sbjct: 192 GYMYWFNWAITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFW 251

Query: 181 IASVKVLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSS 240
           +ASVKVL                   GP+GFRYW+NPG WG GIISS+ +E RF GWVSS
Sbjct: 252 VASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSS 311

Query: 241 LINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPK 300
           LINAAFT+QGTELVGITAGE   PRKTVP+AI KVVFRI++FYI SL  IGLLVPYND +
Sbjct: 312 LINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSR 371

Query: 301 LQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKA 360
           L ++ + ++SSPF+I+IQNAGT  LP IFNAV+LIT++SA NSNVY+GSR+LY LA+   
Sbjct: 372 LSASSAVIASSPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGN 431

Query: 361 APKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISC 420
           APK F   ++ GVPY+ V+ T+  G LA++      + AF WL+NI  +AG  AWL IS 
Sbjct: 432 APKQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISL 491

Query: 421 SHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFA 480
           +HIRFM+ALK RGISR+DLP+KA LMP+ AYYA FF+ +II IQGF +F P FKV+ FF 
Sbjct: 492 AHIRFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP-FKVSEFFT 550

Query: 481 AYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFW 540
           +YIS+ L  + ++  QI++KCR +WKL+D+D+D+DRR+IE  +W D   D+ KN W++FW
Sbjct: 551 SYISLILLAVVFIGCQIYYKCRFIWKLEDIDIDSDRREIEAIIWED---DEPKNLWEKFW 607

Query: 541 NYVA 544
             VA
Sbjct: 608 AAVA 611

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/534 (55%), Positives = 385/534 (72%), Gaps = 3/534 (0%)

Query: 7   QVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXX 66
           ++   QV S       S   +    + +VKR LK RH+SM                +   
Sbjct: 45  ELSDVQVSSELYDHAESEEGEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLS 104

Query: 67  XXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWF 126
                     Y+FMG+VV+ VTQSLGEM TFIPVT+S TVF++RFLSPAFG ANGYMYWF
Sbjct: 105 LSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWF 164

Query: 127 SWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKV 186
           +WA+T+A+ELSV+GQII +WT AVPLAAWI+I WVLLT +N FPV+ YGE EF +AS+KV
Sbjct: 165 NWAITYAVELSVLGQIINYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKV 224

Query: 187 LXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAF 246
           +                   GP+GFRYW+NPGPWG G I+ NVN+ARF GWV SL+NA+F
Sbjct: 225 IAIVGYLLYALIIVCGGSSQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASF 284

Query: 247 TFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDS 306
           T+QGTELVGITAGE   PRKTVPKAI KV FRILVFYIGSL  +GLLVPYN P+L+SN +
Sbjct: 285 TYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQLESNSA 344

Query: 307 YVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFT 366
            ++SSPF+I+IQNAGTK+LP IFNAV+L+TI+SAGNSNVY+GSR+LY LA +  APK F+
Sbjct: 345 VIASSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFS 404

Query: 367 NTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFM 426
             +K GVPY+ V+ T++ G LA++ T    + AF WL+NI  +AG  AW  IS +HIRFM
Sbjct: 405 YVTKQGVPYLGVICTALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFM 464

Query: 427 KALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVF 486
           + LK RGISR+ LP+KA LMPW AYYA FF+ +I+ IQGFT+FAP+F V+ FF AYIS+ 
Sbjct: 465 QCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFAPRFDVSEFFTAYISLI 524

Query: 487 LFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFW 540
           L ++ ++  Q++++CR + K++D+D+D+DRR+I+  +W D   D+ KN W++FW
Sbjct: 525 LLVVLFILCQLYYRCRFLTKIEDIDIDSDRREIDAIIWED---DEPKNLWEKFW 575

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/514 (57%), Positives = 372/514 (72%), Gaps = 4/514 (0%)

Query: 31  KQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQS 90
           + + V+R LK+RHI M                              Y+FMGTVV+ VTQS
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 91  LGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAV 150
           LGEM TFIPVT+S TVF++RFLSPAFG +NGYMYWF+WA+T+A+E+SV+GQ+I++WT  V
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTKV 221

Query: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGPVG 210
           PL  WI+I WVL+T+ N FPV++YGE EFW+ASVKVL                   GP+G
Sbjct: 222 PLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSKQGPIG 281

Query: 211 FRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPK 270
           FRYW+NPG WG GIISS+ NE RF GWVSSLINAAFT+QGTELVGITAGE   PRKTVP+
Sbjct: 282 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 271 AIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFN 330
           AI KVVFRI++FYI SL  IGLLVPY DP+L ++ + ++SSPF+I+IQNAGT  LP IFN
Sbjct: 342 AINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASSPFVISIQNAGTYALPDIFN 401

Query: 331 AVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYM 390
           A++LIT+ISA NSNVY+GSR+LY LA+   APK F   +K GVPY+ VL T+  G LA++
Sbjct: 402 AIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFL 461

Query: 391 ETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLA 450
                 + AF WL+NI  +AG  AWL IS SHIRFM+AL QRGISR+DLP+KA  MP+ A
Sbjct: 462 VVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPYGA 521

Query: 451 YYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDV 510
           YYA FF+ +II IQGF SF P F+VA+FF +YIS+ L  + +   Q+++KCR +WKL+D+
Sbjct: 522 YYASFFVTVIIFIQGFQSFCP-FRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDI 580

Query: 511 DLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           D+D+DRR+IE  +W D   D+ KN W++FW  VA
Sbjct: 581 DIDSDRREIEAIIWED---DEPKNLWEKFWAAVA 611

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/518 (56%), Positives = 381/518 (73%), Gaps = 3/518 (0%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           +   ++ +VKR LK RHISM                              Y+F+G++V+ 
Sbjct: 48  EGDCRETEVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYF 107

Query: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146
           VTQSLGEM TFIPVT+S TVF++RFLSPAFG ANGYMYWF+WA+T+A+E++VVGQ+IQ+W
Sbjct: 108 VTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYW 167

Query: 147 TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVT 206
           T AVPLAAWI+I WVL+T++N FPV+ YGE+EFW+ASVKV+                   
Sbjct: 168 TDAVPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGSHQ 227

Query: 207 GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRK 266
           GP+GFRYW+NPGPWG GIIS +VNE RF GWVSSLINAAFT+QGTELVGITAGE   PRK
Sbjct: 228 GPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 287

Query: 267 TVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILP 326
           TVP+AI KV FRIL FYI SL  IGLLVPY+D +L +  + ++SSPF+I+IQNAGTK+LP
Sbjct: 288 TVPRAINKVFFRILFFYILSLFFIGLLVPYDDLRLSNTTAVIASSPFVISIQNAGTKVLP 347

Query: 327 HIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGS 386
           HIFNA+++ITIISA NSNVY+GSR+LY LA +  APK F   +K GVPY+ V+ T++ G 
Sbjct: 348 HIFNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGL 407

Query: 387 LAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLM 446
           LA++      ++AF WL+NI  +AG  AWL IS SH+RFM+ LK RGISR DLP+KA LM
Sbjct: 408 LAFLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLM 467

Query: 447 PWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWK 506
           PW AYYA FF+ +II+IQGF +F PKF+V++FF +YIS+ L  + ++  Q++++CR +W 
Sbjct: 468 PWGAYYAAFFIGVIIIIQGFKAFTPKFRVSDFFTSYISLILLAVLFLGCQLFYRCRFIWS 527

Query: 507 LQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           L D+D+D+DRR+I+  VW D   D+ KN W++FW  VA
Sbjct: 528 LDDIDIDSDRREIDAIVWED---DEPKNLWEKFWVAVA 562

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/541 (53%), Positives = 378/541 (69%), Gaps = 4/541 (0%)

Query: 5   QPQVHSFQVDSNDTPTTISTLDDDQEKQQ-DVKRELKKRHISMXXXXXXXXXXXXXXXXR 63
           Q  V+S +  +  +    S  DD+ + Q+  VKR LK RH+SM                 
Sbjct: 23  QMYVYSNETQNGGSGHNSSFEDDEGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIAS 82

Query: 64  XXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYM 123
                        Y+FMG++V+ VTQS+GEM TFIPVT+S TVF+ RFLSPAFG ANGYM
Sbjct: 83  PLSSAGPVGALIAYIFMGSIVYFVTQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYM 142

Query: 124 YWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIAS 183
           YWF+WA+T+A+E+SV+GQ+IQ+WT AVPLAAWI I WV +T++N FPVR YGE+EFW+AS
Sbjct: 143 YWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVAS 202

Query: 184 VKVLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLIN 243
           +KV+                   GP+GFRYW+NPGPWG GIIS + ++ RF GWV+SLIN
Sbjct: 203 IKVIAIVGYLLYALIIVCGGSKQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLIN 262

Query: 244 AAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQS 303
           A+FT+QGTELVGITAGE   PRKTVPKAI KV FRIL FYI SL  +GLLVPYN P L  
Sbjct: 263 ASFTYQGTELVGITAGEAANPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGLDK 322

Query: 304 NDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPK 363
           + S ++SSPF+I+IQ+AGT+ILP IFNAV+L+TIISA NSNVY+GSRIL+ LA    APK
Sbjct: 323 HTSVIASSPFVISIQSAGTRILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPK 382

Query: 364 FFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHI 423
            F+  +  GVPY+ V+ T++ G LA++      ++ F WL+NI  +AG  AWL IS SHI
Sbjct: 383 QFSYVTNQGVPYLGVICTALLGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHI 442

Query: 424 RFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYI 483
           RFM+ LKQRGISR+DLP+K+ LMP+ AYYA F++ +II +QGF +F PKFKVA FF  YI
Sbjct: 443 RFMQCLKQRGISRDDLPFKSKLMPYGAYYAAFWVAVIIFVQGFQAFCPKFKVAEFFTGYI 502

Query: 484 SVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYV 543
           S+ L  + +   Q++++CR   +L+D+D+D+DRR+I+  +W    E++    W +FW  V
Sbjct: 503 SLILLAVVFCLAQLYYRCRFFNRLEDIDIDSDRREIDALIWE---EEEPTTLWGKFWVAV 559

Query: 544 A 544
           A
Sbjct: 560 A 560

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/537 (53%), Positives = 373/537 (69%), Gaps = 8/537 (1%)

Query: 13  VDSNDTPTTISTLDDDQEKQQD-----VKRELKKRHISMXXXXXXXXXXXXXXXXRXXXX 67
           V S D P+T     D +  + D     VKR LK RH+SM                     
Sbjct: 88  VYSQDEPSTDPLGSDTESGEGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSY 147

Query: 68  XXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFS 127
                    Y+FMGTVV+ VTQS+GEM TFIPVT+S TVF+ RFLSPAFG ANGYMYWF+
Sbjct: 148 SGPVGALIAYIFMGTVVYFVTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFN 207

Query: 128 WAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVL 187
           WA+TFA+ELSV GQ+I++WT AVP AAWI+I WVL+T++N FPV+ YGE+EFW+AS+KVL
Sbjct: 208 WAITFAVELSVTGQVIEYWTEAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVL 267

Query: 188 XXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFT 247
                              GP+GFRYW+NPGPWG GIIS + +E RF GWV+SLINA+FT
Sbjct: 268 AIVGYLIYALVIVCGGSKQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFT 327

Query: 248 FQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY 307
           +QGTELVGITAGE   PR+TVP+AI KV FRIL FYI SL  +GLLVPYN   L    + 
Sbjct: 328 YQGTELVGITAGEAANPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKTTTV 387

Query: 308 VSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTN 367
           ++SSPF+I+IQNAGT+ LP IFNAV+L+TIISA NSNVY+GSR+L+ LA    APK F++
Sbjct: 388 IASSPFVISIQNAGTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSS 447

Query: 368 TSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMK 427
            +  GVP++ V+ TS+ G LA++      ++AF WL+NI  +AG  AWL IS SHIRFM+
Sbjct: 448 VTPQGVPFMGVIVTSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQ 507

Query: 428 ALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFL 487
            LKQRGISR+DLP+K+ LMP+ AYYA F++ +II +QGF +F+P FKV  FF +YIS+ L
Sbjct: 508 CLKQRGISRDDLPFKSKLMPYGAYYAAFWVTVIIFVQGFQAFSPHFKVTEFFTSYISLML 567

Query: 488 FIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
            ++ +   Q++++CR   +L+D+D+D+DRR+ +  +W D   D+    W +FW  VA
Sbjct: 568 LVVVFCGAQLFYRCRFFNRLEDIDIDSDRREADALIWED---DEPTTLWGKFWTAVA 621

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/530 (53%), Positives = 377/530 (71%), Gaps = 14/530 (2%)

Query: 26  DDDQEK----QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMG 81
           D+D E+     + VKRELK+RHI M                              Y+FMG
Sbjct: 71  DEDAEEADYEDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVGALIAYIFMG 130

Query: 82  TVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQ 141
           ++V+ VTQ+LGEM TFIPVT+S TVF+QRFLSPAFG ANGYMYWF+WA+TFA+E+SVVGQ
Sbjct: 131 SIVYFVTQALGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVEISVVGQ 190

Query: 142 IIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXX 201
           +IQ+WT AVPLAAWI+I WVL+T+ N FPV++YGE+EFW+A +KV+              
Sbjct: 191 VIQYWTDAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALIIVC 250

Query: 202 X-XXVTGPVGFRYWKNPGPWGMGIIS------SNVNEARFFGWVSSLINAAFTFQGTELV 254
                 GP+GFRYW+NPG WG G+ S      S+  E RF GWV+SLINAAFT+QGTELV
Sbjct: 251 GGSKKQGPIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAAFTYQGTELV 310

Query: 255 GITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFI 314
           GITAGE   PRKTVP+AI KVVFRI++FYI SL  IGLLVP+ D +L  + + ++SSPF+
Sbjct: 311 GITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRLSDDTTVIASSPFV 370

Query: 315 ITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVP 374
           I+I+NAGTKILP IFNA++++T++SA NSNVY+GSR+LY LA  K APK F   ++ GVP
Sbjct: 371 ISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVTRQGVP 430

Query: 375 YVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGI 434
           ++ V+ TS+ G LA++      + AF WL++I  +AG  AWL IS +H+RFM+ LKQRGI
Sbjct: 431 FMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVLKQRGI 490

Query: 435 SRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVA 494
           SR+DLP+KA  MPW +YYA F++ +II +QGF +F+P F V  FF  YIS+ L  + ++ 
Sbjct: 491 SRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSPHFDVTTFFTDYISLILLAVVFIG 550

Query: 495 FQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
            Q++++CR +WKL+DVD+D+DRR+IE+ +W D   D+ K  WD+FW  +A
Sbjct: 551 AQLYYRCRFLWKLEDVDIDSDRREIEDAIWED---DEPKTIWDKFWAAIA 597

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/553 (52%), Positives = 383/553 (69%), Gaps = 18/553 (3%)

Query: 4   NQPQVHSFQVDSNDTPTTI-STLDDDQE-----------KQQDVKRELKKRHISMXXXXX 51
            Q  VHS  V  + T + + S +DD  E            +  VKR LK+RHI M     
Sbjct: 51  TQADVHS--VTGSLTRSRLNSRVDDGAESDGSDELEAEVHETKVKRALKQRHIGMIALGG 108

Query: 52  XXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRF 111
                                    Y+FMGT+++ VTQSLGEM TFIPVT+S TVF++RF
Sbjct: 109 TIGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIYFVTQSLGEMATFIPVTSSITVFSKRF 168

Query: 112 LSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPV 171
           LSPAFG ANGYMYWF+WA+T+A+E+SV+GQ+IQ+WT AVPLAAWI+I WVL+T+ N FPV
Sbjct: 169 LSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIAIFWVLVTLMNFFPV 228

Query: 172 RIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNE 231
           ++YGE+EFWIA VKVL                   GP+GFRYW++PG +G GIIS N N 
Sbjct: 229 KVYGEVEFWIAFVKVLAIVGYLIYALVIVCGGSHQGPIGFRYWRHPGAFGPGIISKNKNT 288

Query: 232 ARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIG 291
            +F GWV+SLINAAFT+QGTELVGITAGE   PRKTVP+AI KVVFRI++FYI SL  IG
Sbjct: 289 GKFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIG 348

Query: 292 LLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRI 351
           +L+PYND +L + D+ ++SSPF+I+I+NA TK+LP IFNAV+++T++SA NSNVY+GSR+
Sbjct: 349 MLLPYNDKRLSAQDAVIASSPFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGSRV 408

Query: 352 LYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAG 411
           LY LA    APK F+  ++ GVPY+ V+ T+  G LA++      + AF WL+NI  +AG
Sbjct: 409 LYALALTGNAPKQFSYVTRYGVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINISTLAG 468

Query: 412 FFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP 471
             AWL IS +HIRFM+ALK RGISR+DLP+KA LMPW AYYA FF+ +II IQG+ +F P
Sbjct: 469 LCAWLFISLAHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAFCP 528

Query: 472 KFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDK 531
            + V+ FF +YIS+ L  +  V  Q++++ R + KL+D+D+DTDRR+IE  VW D   D+
Sbjct: 529 -WDVSTFFTSYISLILLAVLVVGCQLYYRGRFLLKLEDIDIDTDRREIESIVWED---DE 584

Query: 532 NKNWWDRFWNYVA 544
            K  WD+FW + A
Sbjct: 585 PKTLWDKFWAWAA 597

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/538 (55%), Positives = 365/538 (67%), Gaps = 19/538 (3%)

Query: 18  TPTTISTLDDDQE----KQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXX 73
           TP T    +D  E    ++ +VKR LK RHISM                           
Sbjct: 34  TPATGEFPEDHTEEGDYQETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGS 93

Query: 74  XXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFA 133
              Y+F+GTVV+S+TQSLGEM TFIPVT+S TVF++RFLSPAFG ANGYMYWF+WA+TFA
Sbjct: 94  LLAYIFIGTVVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFA 153

Query: 134 LELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXX 193
           +ELSVVGQIIQ+WT  VP+AAWI I WVL+T+ N FPVR YGEIEFWIASVKVL      
Sbjct: 154 VELSVVGQIIQYWTDRVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYL 213

Query: 194 XXXXXXXXXXXVTGPVGFRYWKNPGPWGM----GIISSNVNEAR--FFGWVSSLINAAFT 247
                        GP+G      P   G+       SS     R  F GWVSSLI AAFT
Sbjct: 214 IYAFIIVCGGSKQGPIGL-----PATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFT 268

Query: 248 FQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY 307
           +QGTELVGITAGE   PRK VPKAI KV FRIL FYIGSLL +GLLVPY+DP+L S  S 
Sbjct: 269 YQGTELVGITAGESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESST 328

Query: 308 -VSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFT 366
            V++SPF+I+I+NAGTKILP IFNAV+LIT+ISA NSNVYIGSR+ Y LA    APK   
Sbjct: 329 DVNASPFVISIKNAGTKILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLA 388

Query: 367 NTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFM 426
             +K GVPY  VL TS+ G ++++        AF WL+NI  +AG  AWL IS +HIRFM
Sbjct: 389 FVTKQGVPYFGVLITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFM 448

Query: 427 KALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVF 486
           + LK RGISR+DLP+KA  MPW AYYA FF+ +II IQG+T+F PKF V  FF +YIS+F
Sbjct: 449 QCLKHRGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGYTAFTPKFDVTTFFTSYISLF 508

Query: 487 LFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           L ++ ++  QI++KCR +W ++D+D+D+DRR+I+  VW    ED+ KN WD+FW+ VA
Sbjct: 509 LMLLVFIGCQIYYKCRFLWAVEDIDIDSDRREIDAIVWE---EDEPKNIWDKFWSAVA 563

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/514 (53%), Positives = 353/514 (68%), Gaps = 4/514 (0%)

Query: 31  KQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQS 90
               VKR LK RH+ M                              Y+FMG+VV+ VTQS
Sbjct: 98  HDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYFVTQS 157

Query: 91  LGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAV 150
           LGEM TFIPVT+S TVF +RFLSPA G +NGYMYWF+WA+TFA ELSV GQIIQ+WT  V
Sbjct: 158 LGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYWTYKV 217

Query: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGPVG 210
           PLAAWI I WV++ + N FPV+IYGEIEFW++SVKVL                   GP+G
Sbjct: 218 PLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGSRQGPIG 277

Query: 211 FRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPK 270
           FRYW++   +G G IS N +EARF GWVSSLINAAFT+QGTELVGI+AGE   PRKTVP+
Sbjct: 278 FRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANPRKTVPR 337

Query: 271 AIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFN 330
           AI KV+FRI +FYI SL  IGLLVPYND +L    + ++SSPF+I++ NAGT  LP IFN
Sbjct: 338 AINKVIFRIALFYILSLFFIGLLVPYNDKRLSDGSAIIASSPFVISMLNAGTSALPDIFN 397

Query: 331 AVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYM 390
           AVILIT++SA NS+VYI SR+LY LA    APK FT  ++ GVPY+ V  T + G LA++
Sbjct: 398 AVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVTCLVGWLAFL 457

Query: 391 ETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLA 450
             +   + AF WL+NI  +AG  AW  I  +HIRFM+ALK +GISR+DLP+KA  MPW A
Sbjct: 458 VVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPFKARFMPWGA 517

Query: 451 YYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDV 510
           YYA FF+ +II IQG+ +F P +   +FF +YIS+ LF + ++   I+++ RL+ K++D+
Sbjct: 518 YYAAFFVGLIIFIQGYDAFTP-WDTKSFFTSYISLILFGVLYLGCLIYYRGRLLIKIEDI 576

Query: 511 DLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
           D+DTDR+++E  VW    ED  +NWW++FW  VA
Sbjct: 577 DIDTDRKEVEAYVWE---EDAPRNWWEKFWAAVA 607

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/477 (55%), Positives = 341/477 (71%), Gaps = 3/477 (0%)

Query: 28  DQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSV 87
           ++  Q DVKRELK RH++M                              Y+F+ T+ + V
Sbjct: 42  EKPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCV 101

Query: 88  TQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWT 147
           TQSLGEM TFIPVT+SFTVFA RF+SPA GAANGY+YW SW +TFALE+SV+G++I +W+
Sbjct: 102 TQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWS 161

Query: 148 MAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTG 207
            AVP+ AW++I WVLLT  NL PV+ YGE EFWIAS+KV+                   G
Sbjct: 162 DAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLG 221

Query: 208 PVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKT 267
            +GFRYWK+PGPWG+GI+S  ++ A+F GWVSSLI AAFTFQGTELVG+TAGE + PR+T
Sbjct: 222 RIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRT 281

Query: 268 VPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSS--SPFIITIQNAGTKIL 325
           VPKAI  V FRIL+FYIGSLLVIGLLV Y+DP+L  + S  ++  SPF++ I  AGTK+L
Sbjct: 282 VPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVL 341

Query: 326 PHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFG 385
           P I N VI++TIISAGNSN+Y+GSR+LYGL ++  AP F + T+  GVPYV VL TSMFG
Sbjct: 342 PDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFG 401

Query: 386 SLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAML 445
           +L Y+  ++     F WLL+I  V+GFF WLLIS SHIRFM+ LK+RGISR+DLP+KA  
Sbjct: 402 ALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKF 461

Query: 446 MPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCR 502
           MP+ AYYA FF+++II++QGFT+F P F   +F A YIS F+F++ W+ FQ  FK R
Sbjct: 462 MPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGR 517

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  322 bits (825), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 187/566 (33%), Positives = 302/566 (53%), Gaps = 37/566 (6%)

Query: 2   KLNQPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXX 61
           K     ++SF+ + +      + + D +E    +K+ELK RHISM               
Sbjct: 22  KNTTSSLNSFEQEDDS-----NKISDGKEDGVRLKKELKARHISMIAIGGSLGTGLLIGT 76

Query: 62  XRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANG 121
                          Y F+G +VF V   LGEM T+IP+   FT +A R+  PA G A G
Sbjct: 77  GTALRTGGPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALGFAVG 135

Query: 122 YMYWFSWAMTFALELSVVGQIIQFW--TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEF 179
           Y Y F + +    +L+    +IQ+W     V    WI+I  V++ I N   VR +GE EF
Sbjct: 136 YCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEF 195

Query: 180 WIASVKVLXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPG---PWGMGIISSNVNEA 232
           W++S K++                   GP    +GFRYWKNPG   P+   I  S   + 
Sbjct: 196 WLSSFKIMVMFGVILFLFIIMLG---GGPNHDRLGFRYWKNPGAFKPYSESITGS---KG 249

Query: 233 RFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGL 292
           +F  +V+  + A F + G EL GI A E + PR+ +P+AIK  ++RI++FYI ++ ++G+
Sbjct: 250 KFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGM 309

Query: 293 LVPYNDPKL---QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGS 349
            V YNDP+L       +  ++SPF++ IQN+G + LPHIFN  +LI + SA NS++Y+G+
Sbjct: 310 CVAYNDPRLLAAAHASTSAAASPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGT 369

Query: 350 RILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGV 409
           R LY LA +  APK F  T++ GVPY  +    +F  LAYM  ++G  + F + +N+V +
Sbjct: 370 RSLYSLAIDGKAPKLFAKTNRWGVPYNALFGCFLFCLLAYMNVSSGSAQIFNYFVNVVSI 429

Query: 410 AGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF 469
            G  +W+ I  ++I F +A   + + RN   Y+A   P+ AY  +FF V+I  I+ FT F
Sbjct: 430 FGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVF 489

Query: 470 APKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDT-----DRRDIEEEVW 524
             +F   +F   YI + L++IF+  ++I +K +LV K ++ DL +     DR + E ++ 
Sbjct: 490 IGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKEAIDREEAEGKIK 548

Query: 525 SDDVEDKNKN-------WWDRFWNYV 543
             + +++ KN       +++++  Y+
Sbjct: 549 EAEAKERLKNSKKSLKWFYEKYLGYI 574

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  321 bits (822), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 185/539 (34%), Positives = 292/539 (54%), Gaps = 30/539 (5%)

Query: 26  DDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVF 85
           DD + +   +K+ LK RH+SM                              Y F+G +VF
Sbjct: 55  DDGKTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVF 114

Query: 86  SVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQF 145
                LGEM  FIP+   FT +A R++ PA G A GY Y   + +  A +L+    ++Q+
Sbjct: 115 FTMSCLGEMAAFIPLDG-FTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQY 173

Query: 146 WTMAVPL--AAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXX 203
           W     L    +I+I  +L+   N+F V+I+GE EFW++S KVL                
Sbjct: 174 WVDRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLG- 232

Query: 204 XVTGP----VGFRYWKNPG---PWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGI 256
              GP    +GFRYW++PG   P+   IIS + +  +F  + S  + A F + G EL GI
Sbjct: 233 --GGPNHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGI 290

Query: 257 TAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDP---KLQSNDSYVSSSPF 313
            A E Q PRK +PKAIK  ++RI++FY+ ++L++ + V YNDP   K     +  ++SPF
Sbjct: 291 VAAEAQNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPF 350

Query: 314 IITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGV 373
           ++ I+N+G  ILPHIFN  +L  ++SA NS++Y+ SR LY LA +  APKFF  T+K G+
Sbjct: 351 VVAIENSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGI 410

Query: 374 PYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRG 433
           PY ++ F++ F  LAYM  ++     F + +N V + G  +W+ I  ++I F KA K +G
Sbjct: 411 PYWSLAFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQG 470

Query: 434 ISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAYISVFLFIIFW 492
           + +++  Y A   P+ AY+A+FF  ++ +++ FT F   +F   NF   YI + +F I +
Sbjct: 471 MDKSNFTYVAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICF 530

Query: 493 VAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDK---------NKNW---WDRF 539
           V ++I +K +   + ++VDL T +  I++E     +ED          NK+W   +DRF
Sbjct: 531 VGYKIVYKTK-THRPEEVDLVTLKALIDQEEEDGKIEDAEREERLKNGNKDWAWFYDRF 588

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  321 bits (822), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/534 (34%), Positives = 291/534 (54%), Gaps = 20/534 (3%)

Query: 4   NQPQVHSFQVDSNDTPTTISTLDDDQEKQQD---VKRELKKRHISMXXXXXXXXXXXXXX 60
           +  +VH            + T   + + + D   +K+ L+ RH+SM              
Sbjct: 45  SDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIG 104

Query: 61  XXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAAN 120
                           Y F+G +VF V   LGEM  +IP+   FT ++ R+  PA G A 
Sbjct: 105 TGSSLALAGPAAILIAYAFVGLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAV 163

Query: 121 GYMYWFSWAMTFALELSVVGQIIQFWTM--AVPLAAWISIVWVLLTISNLFPVRIYGEIE 178
           GY Y F + +    +L+    +IQ+W     V    WI+I+ V +   N   VR +GEIE
Sbjct: 164 GYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIE 223

Query: 179 FWIASVKVLXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARF 234
           ++I++VK+                    GP    +GF+YWKNPG +     +    + RF
Sbjct: 224 YYISAVKITVMLGLIILLLVLACG---GGPNHEVLGFKYWKNPGAFKEYSTAITGAKGRF 280

Query: 235 FGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLV 294
             + S  + A F + GTEL GI   E + PRK VPKAIK  ++RI+VFY+ S+ ++G+ V
Sbjct: 281 VSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCV 340

Query: 295 PYNDPKL---QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRI 351
           P+NDP L   +S  +  S+SPF++ I NAG  +LPHI NA ILI + SA NS++Y+ SR 
Sbjct: 341 PFNDPLLISAKSAKTSASASPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRS 400

Query: 352 LYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAG 411
           LYGLA +  AP+ F  T+K GVPY ++L   +F  LAYM  ++G  + FT+ +N V + G
Sbjct: 401 LYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFG 460

Query: 412 FFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-A 470
             +W+ I  ++IRF KA + +GI ++ L Y++ L P+ A++++FF ++I +I+ F +F  
Sbjct: 461 LLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLG 520

Query: 471 PKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRR--DIEEE 522
             F   +F   YI +  +II ++ +++W+K +++   ++VDL + +   D+EEE
Sbjct: 521 DTFDYKSFITGYIGIPTYIISYIGYKLWYKTKIIPS-EEVDLVSFKEAVDLEEE 573

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  320 bits (819), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/554 (32%), Positives = 297/554 (53%), Gaps = 27/554 (4%)

Query: 3   LNQPQVHSFQVDSNDTPTTIST------------LDDDQEKQQDVKRELKKRHISMXXXX 50
           + + ++++  ++ N+  +  ST            + D +++   ++++LK RHISM    
Sbjct: 37  VKEQEIYNIDLEENNVSSRSSTFTSPSARDDSFAVPDGKDETTRLRKDLKARHISMIAIG 96

Query: 51  XXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQR 110
                                     Y F+G +VF     LGEM ++IP+   FT +A R
Sbjct: 97  GSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFFTMACLGEMASYIPLDG-FTSYASR 155

Query: 111 FLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMA--VPLAAWISIVWVLLTISNL 168
           ++ PA G A GY Y F + +    +L+    +IQ+W     V    WI+I  V++   N+
Sbjct: 156 YVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVNPGVWITIFMVVIVAINV 215

Query: 169 FPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGI 224
             V+ +GE EFW++S KVL                   GP    +GFRYW++PG +    
Sbjct: 216 IGVKFFGEFEFWLSSFKVLVMLGLILLLFIIML---GGGPDHDRLGFRYWRDPGAFKEYS 272

Query: 225 ISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYI 284
            +    + +F  +++  + + F++ G EL GI   E Q PRK+VPKAIK  V+RI+VFY+
Sbjct: 273 AAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQNPRKSVPKAIKLTVYRIIVFYL 332

Query: 285 GSLLVIGLLVPYNDPKLQSNDSYV---SSSPFIITIQNAGTKILPHIFNAVILITIISAG 341
            ++ ++G+ V YNDP+L S        ++SPF++ IQN+G K+LPHIFNA +L+ + SA 
Sbjct: 333 CTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSAC 392

Query: 342 NSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFT 401
           NS++Y+ SR LY LA +  APK F+ T+K GVPY  ++F+ +F  LAYM  + G  K F 
Sbjct: 393 NSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALIFSVLFCCLAYMNVSAGSAKIFN 452

Query: 402 WLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIII 461
           + +N+V + G  +W+ I   +I F KA + +GI ++   Y A    + AY+A+ F + I 
Sbjct: 453 YFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALVFCIFIA 512

Query: 462 VIQGFTSF-APKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIE 520
           +I+ FT F   KF    F   YI + +++  WV +++ +K +++ K  DVDL T +   +
Sbjct: 513 LIKNFTVFLGHKFDYKTFITGYIGLPVYVFSWVGYKLIYKTKVI-KSTDVDLYTFKEIYD 571

Query: 521 EEVWSDDVEDKNKN 534
            E     +ED+ K 
Sbjct: 572 REEEQGKIEDQEKE 585

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  319 bits (817), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 182/532 (34%), Positives = 289/532 (54%), Gaps = 21/532 (3%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           D +++   +K+ELK RHISM                              Y F+G +VF 
Sbjct: 72  DGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFF 131

Query: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146
               LGEM ++IP+   FT +A R++ PA G A GY Y F + +    +L+    +IQ+W
Sbjct: 132 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190

Query: 147 TMA--VPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXX 204
                V    WI+I  V++   N+  V+ +GE EFW++S KV+                 
Sbjct: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIML--- 247

Query: 205 VTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGE 260
             GP    +GFRYW++PG +     +   +  +F  +V+  + + F++ G EL GI   E
Sbjct: 248 GGGPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSE 307

Query: 261 VQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY---VSSSPFIITI 317
            + PRK+VPKAIK  V+RI+VFY+ ++ ++G+ V YNDP+L S        ++SPF++ I
Sbjct: 308 AENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAI 367

Query: 318 QNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVT 377
           QN+G K+LPHIFNA +L+ + SA NS++Y+ SR LY LA +  APK F  TSK GVPY  
Sbjct: 368 QNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNA 427

Query: 378 VLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRN 437
           ++ + +F  LAYM  ++G  K F + +N+V + G  +W+ I   +I F KA + +GI ++
Sbjct: 428 LILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKS 487

Query: 438 DLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAYISVFLFIIFWVAFQ 496
              Y A    + AY+A+ F ++I +I+ FT F   KF    F   YI + ++I+ W  ++
Sbjct: 488 KFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYK 547

Query: 497 IWFKCRLVWKLQDVDLDT-----DRRDIEEEVWSDDVEDK-NKNWWDRFWNY 542
           + +K +++ K  DVDL T     DR + E  +   + E++  +N  +  W Y
Sbjct: 548 LIYKTKVI-KSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFY 598

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  318 bits (816), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 178/523 (34%), Positives = 287/523 (54%), Gaps = 20/523 (3%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           D +++   ++++LK RHISM                              Y F+G +VF 
Sbjct: 74  DGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFY 133

Query: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146
               LGEM ++IP+   FT +A R++ PA G A GY Y F + +    +L+    +IQ+W
Sbjct: 134 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192

Query: 147 TMA--VPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXX 204
                V    WI+I  V++   N+  V+ +GE EFW++S KV+                 
Sbjct: 193 ISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIML--- 249

Query: 205 VTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGE 260
             GP    +GFRYW++PG +     +    + +F  +V+  + + F++ G EL GI   E
Sbjct: 250 GGGPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSE 309

Query: 261 VQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY---VSSSPFIITI 317
            + PRK+VPKAIK  V+RI+VFY+ ++ ++G+ V YNDP+L S        ++SPF++ I
Sbjct: 310 AENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAI 369

Query: 318 QNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVT 377
           QN+G ++LPHIFNA +L+ + SA NS++Y+ SR LY LA +  APK F  TS+ GVPY  
Sbjct: 370 QNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNA 429

Query: 378 VLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRN 437
           ++ + +F  LAYM  ++G  K F + +N+V + G  +W+ I   +I F KA + +GI ++
Sbjct: 430 LILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKS 489

Query: 438 DLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAYISVFLFIIFWVAFQ 496
              Y A    + AY+A+FF ++I +I+ FT F   KF    F   YI + ++II W  ++
Sbjct: 490 KFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYK 549

Query: 497 IWFKCRLVWKLQDVDLDT-----DRRDIEEEVWSDDVEDKNKN 534
           + +K +++ K  DVDL T     DR + E  +   + E++ K+
Sbjct: 550 LIYKTKVI-KSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  314 bits (805), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 179/521 (34%), Positives = 286/521 (54%), Gaps = 21/521 (4%)

Query: 13  VDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXX 72
           ++S     ++S   D + +   +K+EL+ RH+SM                          
Sbjct: 28  LESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVS 87

Query: 73  XXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTF 132
               Y F+G +V++V   LGEM  FIP+   FT +A R++ PA G A GY Y F + +  
Sbjct: 88  ILISYSFVGLLVYTVMSCLGEMAAFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVT 146

Query: 133 ALELSVVGQIIQFWTMA--VPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXX 190
             +L+    ++QFW     V    WI+I   L+ + N   VR +GE EFW++SVKVL   
Sbjct: 147 PNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLVML 206

Query: 191 XXXXXXXXXXXXXXVTGP----VGFRYWKNPG---PWGMGIISSNVNEARFFGWVSSLIN 243
                           GP     GFR+W++PG   P+   I  S   + +F  + S    
Sbjct: 207 GLILLLFIIML---GGGPNHDRTGFRFWRDPGAFKPYSEAISGS---KGKFVSFASVFAL 260

Query: 244 AAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQS 303
           A F + GTEL GI A E + PR++VP+AIK  ++RI+VFY+ ++L++G+ V YNDP+L  
Sbjct: 261 ALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLK 320

Query: 304 NDSYVSS---SPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKA 360
                +S   SPF++ I+NA   +LPHIFN  +L+ + SA NS++Y+ SR LYGLA +  
Sbjct: 321 AKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGK 380

Query: 361 APKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISC 420
           AP+ F  T+K GVPY ++  + +F  LAYM  ++G  + F + +N+V + G  +W+ I  
Sbjct: 381 APRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILI 440

Query: 421 SHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFF 479
           ++IRF KA++ +   ++ L Y A   PW  Y A+FF  +I +I+ +T F   KF    F 
Sbjct: 441 TYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFI 500

Query: 480 AAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIE 520
           + YI + +++I +V +++ ++ +L+ K +DVDL T +  I+
Sbjct: 501 SGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDAID 540

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  315 bits (806), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 174/518 (33%), Positives = 280/518 (54%), Gaps = 15/518 (2%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           D +++   ++++LK RHISM                              Y F+G +VF 
Sbjct: 72  DGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFF 131

Query: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146
               LGEM ++IP+   FT +A R++ PA G A GY Y F + +    +L+    +IQ+W
Sbjct: 132 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190

Query: 147 TMA--VPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXX 204
                V    WI+I  V++   N+  VR +GE EFW++S KV+                 
Sbjct: 191 VSRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIML--- 247

Query: 205 VTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGE 260
             GP    +GFRYW++PG +     +   ++ +F  + S  + + F++ G EL GI   E
Sbjct: 248 GGGPDHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSE 307

Query: 261 VQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV---SSSPFIITI 317
            + PRK+VPKAIK  V+RI+VFY+ ++ ++G+ V YNDP+L S        ++SPF++ I
Sbjct: 308 AKNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAI 367

Query: 318 QNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVT 377
           QN+G K+LPHIFN  +L+ + SA NS++Y+ SR LY LA +  APK F  TSK GVPY  
Sbjct: 368 QNSGIKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYA 427

Query: 378 VLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRN 437
           ++ + +F  LAYM  + G  K F + +N+V + G  +W+ I   +I F +A + +G+ ++
Sbjct: 428 LMVSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKS 487

Query: 438 DLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAYISVFLFIIFWVAFQ 496
              Y A    + AY+A+FF ++I +I+ FT F    F    F   YI + +++  WV ++
Sbjct: 488 KFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYK 547

Query: 497 IWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKN 534
           + +K ++V K  D DL T +   + E     ++D+ K 
Sbjct: 548 LIYKTKVV-KPADADLYTLKEIYDREEEQGKLQDQEKE 584

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  315 bits (806), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 175/541 (32%), Positives = 293/541 (54%), Gaps = 20/541 (3%)

Query: 12  QVDSNDTPTTISTLDDDQEKQQD-----------VKRELKKRHISMXXXXXXXXXXXXXX 60
            ++  D  +T+S+  +D EKQ D           ++++LK RHISM              
Sbjct: 52  DINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIG 111

Query: 61  XXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAAN 120
                           Y F+G +VF    +LGEM ++IP+   FT +A R+  PA G A 
Sbjct: 112 TGNSLYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPALGFAV 170

Query: 121 GYMYWFSWAMTFALELSVVGQIIQFW--TMAVPLAAWISIVWVLLTISNLFPVRIYGEIE 178
           GY Y   + +    +L+    +IQ+W     V    WI+I  V++   N   V+ +GE E
Sbjct: 171 GYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFE 230

Query: 179 FWIASVKVLXXXXXXXXXXXXXXXXXVTGP-VGFRYWKNPGPWGMGIISSNVNEARFFGW 237
           FW+++ KV+                  T   +GFR++ +PG +     S + ++ +F  +
Sbjct: 231 FWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAF 290

Query: 238 VSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN 297
           V+ L+ A F + G EL GI A E   PRK++PKAIK  ++RI+VFY+ ++ ++G+ V Y+
Sbjct: 291 VAVLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYD 350

Query: 298 DP---KLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYG 354
           DP   K +++ +  ++SP+++ I N+G K LPHIFNA +L+ + SA NS++Y+ SR LYG
Sbjct: 351 DPLLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYG 410

Query: 355 LAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFA 414
           LA +  APK F  T++ GVPY ++L +S F  LAYM  ++G  K F + +N+V + G  +
Sbjct: 411 LAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLS 470

Query: 415 WLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKF 473
           W+ I  +++ F +A+K + + R+   Y+A   P+ +Y+ + F ++I  I+ FT F    F
Sbjct: 471 WISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHF 530

Query: 474 KVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNK 533
              NF   YI + +F+I +  ++   K + +WK ++VDL T +  I+EE     + D  +
Sbjct: 531 DYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAIDEEEEQGKIADAER 589

Query: 534 N 534
            
Sbjct: 590 R 590

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  311 bits (797), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 179/535 (33%), Positives = 290/535 (54%), Gaps = 21/535 (3%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           D + K   +K++L+ RH+SM                              Y  MG VVF+
Sbjct: 50  DGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFT 109

Query: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146
           V   LGEM  +IP+   FT +A R+  PA G A GY Y F + +    +L+    ++Q+W
Sbjct: 110 VMSCLGEMAAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168

Query: 147 TM--AVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXX 204
                V    WI++   ++   N+  V+ +GE EFW++S KVL                 
Sbjct: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGG 228

Query: 205 VT-GPVGFRYWKNPG---PWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGE 260
            +   +GFRYWK+PG   P+  G +S    + +F  + S  + A F + GTEL GI A E
Sbjct: 229 PSHNRLGFRYWKDPGGFKPYS-GAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAE 287

Query: 261 VQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL---QSNDSYVSSSPFIITI 317
            + PR+ VP+AIK  ++RI+VFY+ ++ ++GL V YNDP L   +   +  ++SP+++ I
Sbjct: 288 CKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAI 347

Query: 318 QNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVT 377
           +NAG  +LPHIFNA +L  + SA NS++Y+GSR LYGLA +K APK F  T+  GVPY +
Sbjct: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407

Query: 378 VLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRN 437
           +   ++F  LAYM  ++  +  F++ +N+  + G  +W+ I  ++I F +A + +GI +N
Sbjct: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467

Query: 438 DLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAYISVFLFIIFWVAFQ 496
            L Y+A   P  A+ A+ F +++ +++ FT F    F    F   YI + ++I+ +V ++
Sbjct: 468 TLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYK 527

Query: 497 IWFKCRLVWKLQDVDLDTDRR--DIEEEVWSDDV-----EDKNKNW-WDRFWNYV 543
           I  K + + K  +VDL T +   D+EEE    ++     E K   W W +F++Y+
Sbjct: 528 IVHKTKWI-KSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYI 581

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  306 bits (784), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 187/553 (33%), Positives = 293/553 (52%), Gaps = 44/553 (7%)

Query: 14  DSNDTPTTISTLD----DDQEKQQD------------VKRELKKRHISMXXXXXXXXXXX 57
           +SN T   +  LD    DD   Q+             +K+EL+ RH+SM           
Sbjct: 18  NSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMIAIGGSLGTGL 77

Query: 58  XXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFG 117
                              Y F+G +V+ V   LGEM T+IP+   FT +A R+  PA G
Sbjct: 78  LIGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDG-FTSYASRYCDPALG 136

Query: 118 AANGYMYWFSWAMTFALELSVVGQIIQFWTM--AVPLAAWISIVWVLLTISNLFPVRIYG 175
            A GY Y F + +    +L+    ++Q+W     V    WI+I  V++   N+  V+ +G
Sbjct: 137 FAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINVVGVKFFG 196

Query: 176 EIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPG---PWGMGIISSN 228
           E EFW++S KVL                   GP    +GFR++K+PG   P+   I  S 
Sbjct: 197 EFEFWLSSFKVLVMLCLIVLLFVIMLG---GGPSHDRLGFRFYKDPGAFRPYSEAISGS- 252

Query: 229 VNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLL 288
             + +F  +V+  + A F + GTEL GI A E + PR+ VP+AIK  ++RI+VFY+ ++ 
Sbjct: 253 --KGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIF 310

Query: 289 VIGLLVPYNDPKL---QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNV 345
           ++G+ V YNDP L   +   +  ++SPF++ I+NAG  +LPHIFNA +L+ + SA NS++
Sbjct: 311 LLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDL 370

Query: 346 YIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLN 405
           Y+ SR LYGLA +  APK F  T+K GVPY +++   +F  LAYM  ++G  + F + +N
Sbjct: 371 YVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVN 430

Query: 406 IVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQG 465
           +V + G  +W+ I  ++I F +AL+ +G+ ++ L Y A L    AY+A+FF  +I +I+ 
Sbjct: 431 VVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKN 490

Query: 466 FTSF-APKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVW 524
           FT F   KF   NF   YI + +FII +  ++     + V K ++ DL T +  I     
Sbjct: 491 FTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV-KPEEADLYTFKELI----- 544

Query: 525 SDDVEDKNKNWWD 537
             D+E++    WD
Sbjct: 545 --DLEEEEGKLWD 555

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  306 bits (785), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 172/510 (33%), Positives = 277/510 (54%), Gaps = 11/510 (2%)

Query: 23  STLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGT 82
           S + D + +   +K++LK RHISM                              Y F+G 
Sbjct: 53  SEIGDGKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGI 112

Query: 83  VVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQI 142
           +VF     LGEM TFIP+   FT +A R+  PA G A GY Y   + +    +L+    +
Sbjct: 113 MVFFTMACLGEMATFIPLDG-FTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMV 171

Query: 143 IQFWTM--AVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXX 200
           +Q+W     V    W+++V+ ++T+ N+F VR +GE EFW++S+KVL             
Sbjct: 172 MQYWVPRDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIM 231

Query: 201 XXXXVTGP-VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAG 259
                +   +GFRYWK+PG +       + +  +F  +V+ L+   F + G EL GI A 
Sbjct: 232 LGGAGSHDRLGFRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAA 291

Query: 260 EVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL-QSNDSYVSSSPFIITIQ 318
           E   PR++VPKAIK   +RILVFY+ S+ ++G+ VPYND KL  +N++ +++SPF I I 
Sbjct: 292 EASNPRRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTASPFSIAIL 351

Query: 319 NAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTV 378
           NAG  +LP IFN  +LI + SA NS++Y+ SR LY LA +  APK F +T++ G+PY ++
Sbjct: 352 NAGITVLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSL 411

Query: 379 LFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRND 438
             + +F  LAYM  ++   + F + +N+V +AG   W+ I  ++I F +A++ + + ++ 
Sbjct: 412 FVSCLFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKST 471

Query: 439 LPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIW 498
             Y A   P+ AY ++FF  +I +I+ FT F   F    F   YI + +F++ +  ++I 
Sbjct: 472 FAYVAPFQPYGAYVSLFFCCLIAIIKNFTVFLGHFDYKTFITGYIGLPIFVLCYFGYKIT 531

Query: 499 FKCRLVWKLQDVDLDT-----DRRDIEEEV 523
            K   +   + VDL +     DR  +E E+
Sbjct: 532 CKSE-IRSARYVDLVSQKSLVDREQVEYEL 560

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  305 bits (782), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 179/543 (32%), Positives = 291/543 (53%), Gaps = 24/543 (4%)

Query: 7   QVHSFQVDSNDTPTTISTLDDDQEKQQDV---------KRELKKRHISMXXXXXXXXXXX 57
           Q      D  +   ++ST  +DQ    +V         K+ L+ R +SM           
Sbjct: 34  QERELLHDDLENNISLSTSAEDQNDSYNVDGKTEGTRLKKVLEGRVVSMVAIGGSLGTGL 93

Query: 58  XXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFG 117
                              Y F+G +VF    SLGEM ++IP+   FT +A R+  PA G
Sbjct: 94  LIGTGNSLATAGPVSMLIAYAFVGLLVFFTMASLGEMASYIPLDG-FTSYATRYADPALG 152

Query: 118 AANGYMYWFSWAMTFALELSVVGQIIQFW--TMAVPLAAWISIVWVLLTISNLFPVRIYG 175
            A GY Y F + +    +L+    +IQ+W     V    WI+I  V++   N   V+ +G
Sbjct: 153 FAVGYCYLFKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFG 212

Query: 176 EIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNE 231
           E EFW++S KVL                   GP    +GFR+WK+PG +     +   + 
Sbjct: 213 EFEFWLSSFKVLVMFALIILLFILMLG---GGPNHDRLGFRHWKHPGAFNNYSPAITGDT 269

Query: 232 ARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIG 291
            +F  +VS  + A F + GTELVGI  GE + PRK+VPKAIK  ++RI++FY+ S+L++G
Sbjct: 270 GKFVAFVSVFVYATFAYLGTELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLLG 329

Query: 292 LLVPYNDPKL---QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIG 348
           + V Y+DP L   ++  +  ++SPF++ I N+G K+LPHIFNA +L+ + SA NS++Y+ 
Sbjct: 330 MCVGYDDPLLLEAKTKSTSAAASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVA 389

Query: 349 SRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVG 408
           SR LY LA +  APK F  T++ G+PY ++  + +F  LAYM  ++G  K F + +N+V 
Sbjct: 390 SRSLYSLAIDNKAPKIFARTNRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVS 449

Query: 409 VAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTS 468
           + G  +W+ I  +++ F +A++ +GI ++   Y A    + AY+A+FF  +I +I+ FT 
Sbjct: 450 IFGLLSWICILVTYLAFDRAVRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTV 509

Query: 469 F-APKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDD 527
           F   +F    F   YI + +F I +  +++ +K +++  L+ VDL T +  I++E     
Sbjct: 510 FLGHQFDYKTFITGYIGIPVFFISYFGYKLIYKTKIIDPLE-VDLYTFKAAIDQEEEDGK 568

Query: 528 VED 530
           +ED
Sbjct: 569 LED 571

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  303 bits (775), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 175/552 (31%), Positives = 291/552 (52%), Gaps = 25/552 (4%)

Query: 11  FQVDSNDTPTTISTLDDDQEKQ-QDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXX 69
           F++D+       +   + Q+++   +K+ L+ RHI +                       
Sbjct: 24  FELDTESLSALNTGGSESQKREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCG 83

Query: 70  XXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTA-----SFTVFAQRFLSPAFGAANGYMY 124
                  Y+ +  V++ V  +LGEM  ++P +      S +    R+  P+ G A G+ Y
Sbjct: 84  PAGLLTSYIIISLVIYPVMNALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNY 143

Query: 125 WFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASV 184
           ++ + +  A E +    ++ +WT  VP AAWI+I   ++T+ N  PV+ YGE EFW A +
Sbjct: 144 YYCYVILIAAECTAASGVVTYWTTVVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAIL 203

Query: 185 KVLXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSS 240
           K+L                   GP    +GFRYW+ PG +   I + N    RF    + 
Sbjct: 204 KILCIVGLLFVSFILFWGG---GPSHDRLGFRYWQKPGAFAYHITTGNTG--RFLDVWTG 258

Query: 241 LINAAFTF-QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDP 299
           +I   F F  G ELV +T+ E  + R+ + KA ++  +R++ FY+ S L IG++V  NDP
Sbjct: 259 VIKGGFAFILGPELVAVTSSEAMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDP 318

Query: 300 KLQ----SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGL 355
            L+    S  +  +SSPF+I IQNA  KILPHI NA IL +  S+GNS ++  SR L  +
Sbjct: 319 VLRDALASGKAGAASSPFVIAIQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSM 378

Query: 356 AKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAW 415
           A++  APK F   ++AGVPY  V  ++ F  LAY+  ++G  KAFTW  NI  ++GF  W
Sbjct: 379 AEDGVAPKMFKKINRAGVPYNAVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGW 438

Query: 416 LLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKF-K 474
           + I  +++RF KA+  RG+  + +P+K+   P+  Y+ +  + II +  G+ +F P+F K
Sbjct: 439 ICIGVAYLRFRKAIFFRGL-YDRVPFKSPFQPYGTYFFIIVVSIICLTNGYATFIPRFWK 497

Query: 475 VANFFAAYISVFLFIIFWVAFQIWFKCRLVW--KLQDVDLDTDRRDIEEEVWS-DDVEDK 531
            A+F AAYI++ +F++ WV  +I+ +    W   + +VD+ T   +IEE     D +   
Sbjct: 498 GADFVAAYITLPVFVVLWVGHKIYTRTLSTWVIPVAEVDVTTGLAEIEELTKELDALRVP 557

Query: 532 NKNWWDRFWNYV 543
             + W++F +++
Sbjct: 558 PNSAWEKFMDWL 569

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  304 bits (778), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 171/515 (33%), Positives = 281/515 (54%), Gaps = 16/515 (3%)

Query: 31  KQQD-VKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQ 89
           K  D +K+ L+ RH+SM                              Y F+G +VF    
Sbjct: 94  KHTDGLKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMA 153

Query: 90  SLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW--T 147
           ++GEM ++IP+   FT +A R++ PA G A GY Y F + +    +L+    +IQ+W   
Sbjct: 154 AIGEMASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212

Query: 148 MAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTG 207
             V    WI+I  V++ I N+  V+ +GE EFW++S KVL                   G
Sbjct: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLG---GG 269

Query: 208 P----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQE 263
           P    +GFRYW++PG +     + + +  +F  +VS  + A F + G EL GI A E   
Sbjct: 270 PDHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYN 329

Query: 264 PRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL---QSNDSYVSSSPFIITIQNA 320
           PRK+VP+A+K  V+RI++FY+ ++ ++G+ V YNDP+L   +   +  ++SPF++ IQN+
Sbjct: 330 PRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNS 389

Query: 321 GTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLF 380
           G ++LPHIFNA +LI + SA NS++Y+GSR LY LA +  AP  F  T+  G+P+ ++  
Sbjct: 390 GIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGV 449

Query: 381 TSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLP 440
             +F  LAYM  ++G  + F + +N+V + G  +W+ I  ++I FM+A+K +G+ R+   
Sbjct: 450 CVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFA 509

Query: 441 YKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAYISVFLFIIFWVAFQIWF 499
           Y A   P+  Y+++ + V I  I+ FT F    F   NF   YI + +F+IF+  ++   
Sbjct: 510 YSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIK 569

Query: 500 KCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKN 534
           K ++V K  +VDL T +   +++     + D+ K 
Sbjct: 570 KTKIV-KSHEVDLFTGKEVFDQQEIEGKILDQEKQ 603

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  302 bits (774), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 173/507 (34%), Positives = 278/507 (54%), Gaps = 21/507 (4%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           D + +   +K+ L+ RH+SM                              Y F+G +V++
Sbjct: 43  DGKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYT 102

Query: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146
           V   LGEM  FIP+   FT +A R++ PA G A GY Y F + +    +L+    ++Q+W
Sbjct: 103 VMACLGEMAAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161

Query: 147 TM--AVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXX 204
                V    WI+I  VL+ + N   VR +GE EFW++SVKVL                 
Sbjct: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIML--- 218

Query: 205 VTGP----VGFRYWKNPG---PWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGIT 257
             GP     GFRYW++PG   P+   I  S   + +F  + S    A F + GTEL GI 
Sbjct: 219 GGGPNHDRTGFRYWRDPGAFKPYSEAISGS---KGKFVSFASVFALALFAYTGTELCGIV 275

Query: 258 AGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDP---KLQSNDSYVSSSPFI 314
           A E + PR++VP+AIK  ++RI++FY+ S+L++G+ V YNDP   K +   +  ++SPF+
Sbjct: 276 AAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFV 335

Query: 315 ITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVP 374
           + I+NAG  +LPHIFNA +L+ + SA NS++Y+ SR LYGLA ++ APK F  T+  GVP
Sbjct: 336 VAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVP 395

Query: 375 YVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGI 434
           Y ++  + +F  LAYM  ++G  + F + +N+V + G  +W+ I  +++RF KA+  +  
Sbjct: 396 YYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFG 455

Query: 435 SRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAYISVFLFIIFWV 493
            ++   Y A   PW  + ++FF  +I +I+ +T F    F    F + YI + ++ I +V
Sbjct: 456 DKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYV 515

Query: 494 AFQIWFKCRLVWKLQDVDLDTDRRDIE 520
            +++  + +L+ K +DVDL T +  I+
Sbjct: 516 GYKLVHRSKLI-KPEDVDLYTFKAAID 541

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  297 bits (760), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 170/527 (32%), Positives = 280/527 (53%), Gaps = 14/527 (2%)

Query: 14  DSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXX 73
           D ND+        D + +   +K+ LK RH+SM                           
Sbjct: 52  DENDSYNI-----DGKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVST 106

Query: 74  XXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFA 133
              Y F+G +VF     LGEM T+IP+   FT +A R+  PA G A GY Y F + +   
Sbjct: 107 LIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPP 165

Query: 134 LELSVVGQIIQFWT--MAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX 191
            +L+    +IQ+W     V    W++I  V++   N+F VR +GE EFW++S KVL    
Sbjct: 166 NQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLG 225

Query: 192 XXXXXXXXXXXXXVTGP-VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQG 250
                             +GFRYW++PG +     +   +  RF  +VS  + A + + G
Sbjct: 226 LMLLLFILMLGGGPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLG 285

Query: 251 TELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDP---KLQSNDSY 307
            EL GI A E Q PRK++PKAIK  ++RI++FY+ S+ ++G+ V Y+DP   K +++ + 
Sbjct: 286 IELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTS 345

Query: 308 VSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTN 367
            ++SPF++ I N+G   LPHI NA +L+ + SA NS++Y+ SR LY LA +  APK F  
Sbjct: 346 AAASPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAK 405

Query: 368 TSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMK 427
           T++ G+PY  +  + +F  LAYM  ++   K F + +N+V + G  +W+ I  ++I F +
Sbjct: 406 TNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDR 465

Query: 428 ALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAYISVF 486
           A++ +G+ ++   Y A   P+ A++++FF  +I +I+ FT F   +F   NF   YI + 
Sbjct: 466 AVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLP 525

Query: 487 LFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNK 533
           +F   +  ++  +K +++  L+ VDL T +  I++E     + D  K
Sbjct: 526 VFFFCYFGYKFTYKTKVIDPLK-VDLYTFKAAIDQEEEDGKMADAEK 571

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  296 bits (758), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 164/521 (31%), Positives = 279/521 (53%), Gaps = 18/521 (3%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           D ++    +K++LK RHISM                              Y F+GT+VF 
Sbjct: 74  DGKDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFF 133

Query: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146
              +LGEM  +IP+   FT +A R+  PA G A GY Y F + +    +L+    +IQ+W
Sbjct: 134 TMAALGEMAAYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYW 192

Query: 147 TM--AVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXX 204
                V    WI+I  V++   N   V+ +GE EFW++S K++                 
Sbjct: 193 VDRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLG-- 250

Query: 205 VTGP----VGFRYWKNPG---PWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGIT 257
             GP    +GFRYWK PG   P+   +++   +  +F  +V+  + A F + G EL GI 
Sbjct: 251 -GGPNHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIV 309

Query: 258 AGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL---QSNDSYVSSSPFI 314
           A E + PR+ +P+AIK  V+RIL FY+ ++ ++G+ V Y+DP L    +  +  ++SPF+
Sbjct: 310 AAEAENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFV 369

Query: 315 ITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVP 374
           + IQN+G  +LPHIFN  +L+ + SA NS++Y+G+R LY LA +  APK F  T++ GVP
Sbjct: 370 VAIQNSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVP 429

Query: 375 YVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGI 434
           Y  +    +F  LAYM  ++G  + F + +N+V + G  +W  I  + I F +A++ +GI
Sbjct: 430 YNAMGGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGI 489

Query: 435 SRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAYISVFLFIIFWV 493
            R+   Y A   P+ +Y+A+FF V++ +I+ F+ F   +F    F   YI + ++   ++
Sbjct: 490 DRSTFAYVAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFI 549

Query: 494 AFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKN 534
            +++++K + V K  + DL++ +  ++ E     +++  + 
Sbjct: 550 GYKLYYKTKTV-KPHEADLNSYKAAVDREEEEGKIKEAERK 589

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  292 bits (747), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 171/548 (31%), Positives = 292/548 (53%), Gaps = 33/548 (6%)

Query: 15  SNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXX 74
           S+DT T  ++L++D      +K+ LK RH+ +                            
Sbjct: 59  SSDTST--NSLEEDYTNT--LKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLF 114

Query: 75  XXYLFMGTVVFSVTQSLGEMCTFIP-----VTASFTVFAQRFLSPAFGAANGYMYWFSWA 129
             Y  + +V++ +  ++GEM  ++P        S T   +R++  +   A G+ Y++ + 
Sbjct: 115 IAYCIISSVIYPIMNAVGEMVCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYV 174

Query: 130 MTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXX 189
           +  A E +    ++++WT+AVP AAWI+I   ++ + N+  V+ +GE EFW AS+K+L  
Sbjct: 175 ILVAAECTAAAGVVEYWTLAVPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCI 234

Query: 190 XXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAA 245
                            GP    +GFRYWKNPG +   +   ++    F    S +I  A
Sbjct: 235 MGLIILSFILFWGG---GPSHDRLGFRYWKNPGAFAHHVTDGSL--GNFLDIYSGIIKGA 289

Query: 246 FTF-QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQS- 303
           F F  G ELV +T+ E  + R+ + KA K+ ++R++ FYI   L IG++V +NDP L S 
Sbjct: 290 FAFILGPELVALTSSECSDQRRNIAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASA 349

Query: 304 ---NDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKA 360
              N     SSPF+I IQNAG ++LPHI NA IL +  S+GN+ ++  SR L+ +A+N  
Sbjct: 350 LSNNTPGAGSSPFVIGIQNAGIEVLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGT 409

Query: 361 APKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISC 420
           APK F   +K GVPY+ V+ +++   LAY+  ++   + FTWL NI  ++GF  W+    
Sbjct: 410 APKIFGRINKYGVPYMAVILSTLISCLAYLNASSSAARVFTWLSNISTISGFLGWICACI 469

Query: 421 SHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKF-KVANFF 479
           +++RF KA+    +  + +P+K    P+L  +++  + II +  G+ +F PKF  V++F 
Sbjct: 470 AYLRFRKAIFYNNL-YDRMPFKTWGQPYLILWSLTVVSIITITNGYQTFIPKFWNVSDFI 528

Query: 480 AAYISVFLFIIFWVAFQIW--FK-----CRLVWKLQDVDLDTDRRDIEEEVWS-DDVEDK 531
           AAYI++ +F+  +V  +++  FK      +L + ++D+D+ T   +IE +    D+    
Sbjct: 529 AAYITLPIFLALYVGHKVYNHFKNDYPLMKLAYSVEDIDVITGLDEIETKTCELDENRIL 588

Query: 532 NKNWWDRF 539
             N W+RF
Sbjct: 589 PTNRWERF 596

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  289 bits (740), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 183/547 (33%), Positives = 290/547 (53%), Gaps = 24/547 (4%)

Query: 11  FQVDSNDTPTTISTLDDDQEK------QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRX 64
           FQ+D     T    LDD  E+       Q +K++LK RH+SM                  
Sbjct: 32  FQIDIEKESTESVALDDTNEQFDGKCSDQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNS 91

Query: 65  XXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMY 124
                       Y F+G +VF V   +GEM  +IP+   FT +A R+  PA G A GY Y
Sbjct: 92  LAVAGPVSMLISYSFVGVLVFFVMSCIGEMAAYIPLDG-FTSYASRYCDPALGFAVGYAY 150

Query: 125 WFSWAMTFALELSVVGQIIQFW--TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIA 182
              + +    +L+    +IQ+W     V    WI+IV V++ + N F V+ +GE EFW++
Sbjct: 151 LVKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWLS 210

Query: 183 SVKVLXXXXXXXXXXXXXXXXXVTGP-VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSL 241
           S KV+                  T   +GFRYWK+PG +     S + +  RF  +VS  
Sbjct: 211 SFKVIVMLGLIILMFIIMLGGTPTHDRLGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCF 270

Query: 242 INAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL 301
           +   F + G EL GI A E + PRK +PKAIK  ++RI++FYI ++ ++G+ V  NDP L
Sbjct: 271 VYGLFCYLGIELTGIVAAEAENPRKNIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLL 330

Query: 302 ---QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKN 358
              ++  +  ++SPF++ I N+G + LPHIFNA +L+ + SA NS++Y+ SR LY LA +
Sbjct: 331 LEAKTKSTSAAASPFVVAIVNSGIEALPHIFNACVLMFVFSACNSDLYVASRNLYSLAID 390

Query: 359 KAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLI 418
             APK F  T++ G+PY ++    +F  LAYM  ++G  K F + +N+V + G   W+ I
Sbjct: 391 NKAPKIFAKTNRFGIPYNSLGVAVLFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWISI 450

Query: 419 SCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVAN 477
             ++I F +A++ +GI ++   Y A L P+ AY+++FF  ++ +I+ FT F   KF   N
Sbjct: 451 LITYICFDRAVRAQGIDKSTFAYVAPLQPYGAYFSLFFCCLLALIKNFTVFLNHKFDYRN 510

Query: 478 FFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDL-------DTDRRD--IEEEVWSDDV 528
           F   YI + LF I +  ++   K + + K ++VDL       D +  D  I++   ++ +
Sbjct: 511 FITGYIGLPLFFICYFGYKFVKKTK-IRKPEEVDLFSFKAAIDQEEEDGRIKDAATAERI 569

Query: 529 EDKNKNW 535
           +   KNW
Sbjct: 570 KKNGKNW 576

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  287 bits (734), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 167/519 (32%), Positives = 271/519 (52%), Gaps = 18/519 (3%)

Query: 35  VKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEM 94
           +K+ L+ RHI +                              Y+ +  V++ V  SLGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 95  CTFIPVT-----ASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMA 149
             F+P +      S +    R+  P+ G A G+ Y++ + +  A E +    ++ +WT A
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 150 VPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGP- 208
           VP  AWI+I   ++T+ N  PV+IYGE EFW A +K+L                  T   
Sbjct: 225 VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDR 284

Query: 209 VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTF-QGTELVGITAGEVQEPRKT 267
           +GFRYW++PG +   I + N    RF    + +I   F F  G ELV IT+ E  + R+ 
Sbjct: 285 LGFRYWQHPGAFAYHITTGNTG--RFLDIWTGVIKGGFAFILGPELVAITSSEALDARRN 342

Query: 268 VPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQS----NDSYVSSSPFIITIQNAGTK 323
           + KA ++  +R++ FY+ S L IG++V   DP L++      +   SSPF+I IQNA  K
Sbjct: 343 IEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAHIK 402

Query: 324 ILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSM 383
           +LPHI NA IL +  S+GNS ++  SR L  +A++  AP+     ++ GVPY  V  ++ 
Sbjct: 403 VLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSAA 462

Query: 384 FGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKA 443
           F  LA++  ++G  KAFTW  NI  ++GF  W+ I  ++++F KA+  RG+    +P+K+
Sbjct: 463 FSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGLYER-VPFKS 521

Query: 444 MLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRL 503
            L P+  Y+ +  + +I +  G+ SF   +  ++F AAYI++ +F++ WV  +I+ +   
Sbjct: 522 PLQPYGTYFFIVVVSLICLTNGYASFV-NWNASDFVAAYITLPIFVVLWVGHKIYTRTWS 580

Query: 504 VWKL--QDVDLDTDRRDIEEEVWSDDVED-KNKNWWDRF 539
            W L   +VD+ T   +IEEE    D +     N W +F
Sbjct: 581 TWLLPVAEVDVTTGLAEIEEETKILDAQRIPPANAWQKF 619

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  284 bits (727), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 165/542 (30%), Positives = 275/542 (50%), Gaps = 23/542 (4%)

Query: 12  QVDSNDTPTTISTLDDDQEKQQ--DVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXX 69
           +V +  + T++  L+      +   + + L+ RHI +                       
Sbjct: 21  KVKTPHSRTSLEELETQSAGSEYNTLHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCG 80

Query: 70  XXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWA 129
                  ++ + T+V+ +  SL EM  ++P   S      R++ P+ G A G+ Y +++A
Sbjct: 81  AAPLLLSFILISTIVYPIMCSLAEMICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYA 140

Query: 130 MTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXX 189
           +  A ELS    ++ +W   VP+AAWI+I  V++   N   V+ YGE EFW AS+K++  
Sbjct: 141 ILVAAELSAAASVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICI 200

Query: 190 XXXXXXXXXXXXXXXVTGP-VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTF 248
                                GFRYWKNPGP+ M +   +    RF     ++I +AF F
Sbjct: 201 LGLLVVSVVIFFGGAPNHDRTGFRYWKNPGPFAMSLAPGST--GRFLDVWRAVIKSAFAF 258

Query: 249 -QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL----QS 303
               EL+GI   E Q+ R+   KA ++ ++RI+ FY+   L+IG+++   DPKL    ++
Sbjct: 259 ILSPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALET 318

Query: 304 NDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPK 363
                +SSPF+  I NAG  +L H+ N  IL +  SAGNS +Y  +R++  LA+   APK
Sbjct: 319 GAPGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPK 378

Query: 364 FFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHI 423
           F T  ++ GVPY  V+  ++   LAY+   T     F WL NI  ++GF  W  +  + I
Sbjct: 379 FLTKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFI 438

Query: 424 RFMKALKQRGISRNDL----PYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-KFKVANF 478
           RF     +RGI  N+L    PY+  L P++AYY  F  V++ +  GF  F   ++ V +F
Sbjct: 439 RF-----RRGIVFNNLQSRIPYQGPLQPYIAYYFTFMTVVVCLTNGFHVFLKGRWNVVDF 493

Query: 479 FAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDK-NKNWWD 537
            AAY+++ ++++ ++  ++WF+ R    ++ +D+ T   + EEE  S     +  KN W+
Sbjct: 494 VAAYVTLPIYLVLYLGHKLWFRTRWYIPVEQIDVITGLVEAEEE--SKMTPPRIPKNLWE 551

Query: 538 RF 539
           +F
Sbjct: 552 KF 553

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  282 bits (721), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 166/524 (31%), Positives = 273/524 (52%), Gaps = 11/524 (2%)

Query: 23  STLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGT 82
           S L+  +  + ++++ L  RHI +                              ++ +  
Sbjct: 34  SQLEGTKCDENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFVIISF 93

Query: 83  VVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQI 142
           +V+ V  +L EM  ++P   +      R++ P+ G A G+ Y +S+++  A ELS    +
Sbjct: 94  IVYPVMNTLAEMICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELSAAAGV 153

Query: 143 IQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXX 202
           +Q+WT  V +A WI+I  V++   N  PV+ YGE EFW AS+K++               
Sbjct: 154 VQYWTDKVHVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSIVIFFG 213

Query: 203 XXVTGP-VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTF-QGTELVGITAGE 260
              +   +GFRYW NPGP+   I   N    RF    +++I + F F    EL+G+   E
Sbjct: 214 GAPSHDRLGFRYWNNPGPFAYHITGGNT--GRFLDIWTAIIKSGFAFILSPELIGLACVE 271

Query: 261 VQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL----QSNDSYVSSSPFIIT 316
            ++ R+ + KA ++ ++RI+ FYI S L IG ++  +DPKL     S+    +SSPF+  
Sbjct: 272 AKDTRRNIEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAASSPFVQG 331

Query: 317 IQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYV 376
           I NAG  +L HI NAVIL +  S+ NS +Y  SR +  LAK   APK FT  ++ GVPY 
Sbjct: 332 ISNAGIPVLNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINRLGVPYN 391

Query: 377 TVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISR 436
            V  ++    L Y+  ++   + FTWL NI  ++GF  W LI  +++RF KA+    +  
Sbjct: 392 AVALSTAVSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAIFYNNLYE 451

Query: 437 NDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKF-KVANFFAAYISVFLFIIFWVAF 495
             +P+K+ L P+  Y+ V F+V++ +  G+ +F PK+   ++F AAYI++ +F + ++  
Sbjct: 452 R-VPFKSALQPYFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVAAYITLPIFFLLYLGH 510

Query: 496 QIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRF 539
           +IWFK R     +++D+ T   D EEE          KN W++F
Sbjct: 511 KIWFKTRWYIPFREIDVITGLADAEEEAKMTQPRTP-KNMWEKF 553

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  283 bits (725), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 164/550 (29%), Positives = 275/550 (50%), Gaps = 26/550 (4%)

Query: 7   QVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXX 66
           +V   +V  N   T     +   +K +++K+ +K RH+ +                +   
Sbjct: 83  EVADLEVQENQVLT-----EKSNQKNKELKQTIKPRHVILISLGTGIGTGLLVGNAKALH 137

Query: 67  XXXXXXXXXXYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYW 125
                     Y  MGT ++ + Q+ GE+  ++  ++  F V+    + PAFG +  ++Y 
Sbjct: 138 NAGPAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYC 197

Query: 126 FSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVK 185
             W     LEL      I++WT  V    ++ I +VL+ + N F  R Y E EF+    K
Sbjct: 198 IQWLCVCPLELVTASMTIKYWTTTVNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCK 257

Query: 186 VLXXXXXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINA 244
           +L                    G +G RYW  PG +     + +     F G +++++ A
Sbjct: 258 ILMMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAF-----AGDRPIDHFKGIMATMVTA 312

Query: 245 AFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ-S 303
           AF F  TE + +TA E   PRK +P A KKV++RIL  ++GS+ ++G LVPY+  +L  S
Sbjct: 313 AFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGS 372

Query: 304 NDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPK 363
             S   +SP+++ +   G K++PH  NAVIL++++S GNS  Y  SR+LY LA+   APK
Sbjct: 373 GGSATKASPYVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPK 432

Query: 364 FFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHI 423
           FF    + G P+  ++   +F  +++   +   ++ FTWLL I G++  F W  I  SHI
Sbjct: 433 FFDYVDREGRPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHI 492

Query: 424 RFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFF 479
           RF KA+  +  S  ++ +KA    W +YY  F +V+I++ Q + + AP    K     FF
Sbjct: 493 RFRKAMFVQKRSLGEIGFKAQTGVWGSYYVCFMLVMILIAQFWVAIAPIGEGKLDAQGFF 552

Query: 480 AAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVED-----KNK 533
             Y+++ + I+F+V ++IW K   L  +  ++DLD  R+  +EE+   + E+     KN 
Sbjct: 553 ENYLAMPILILFYVGYKIWKKDWSLFIRANNIDLDKHRQIFDEELLKQEDEEYREKLKNG 612

Query: 534 NWWDR---FW 540
            +  R   FW
Sbjct: 613 GYLKRIAAFW 622

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  281 bits (719), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 166/521 (31%), Positives = 267/521 (51%), Gaps = 23/521 (4%)

Query: 26  DDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVF 85
           + D + +  +++ L  RHI +                              Y+ + TV++
Sbjct: 47  NKDAKLEGKLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLY 106

Query: 86  SVTQSLGEMCTFIP-----VTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVG 140
            +  + GEM  ++P        S +    R++ P+   A G+ Y++ + +  A E +   
Sbjct: 107 PIMNAFGEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAAS 166

Query: 141 QIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXX 200
            ++++WT AVP AAWI+I   ++ + NL  V+ YGE EFW AS+KVL             
Sbjct: 167 GVVKYWTDAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFILF 226

Query: 201 XXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTF-QGTELVG 255
                 GP    +GFRYWKNPG +   I   N+    F    S +I  AF F  G EL+ 
Sbjct: 227 WG---GGPNHDRLGFRYWKNPGGFAHHITGGNL--GNFLDVYSGIIKGAFAFILGPELIA 281

Query: 256 ITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL----QSNDSYVSSS 311
           + + E ++ R+ + KA K+ V+R++ FYI   L I ++V  NDP L     S      SS
Sbjct: 282 LASSECKDQRRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSS 341

Query: 312 PFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKA 371
           PF+I IQNAG KILPHI NA IL +  SAGN+ ++  SR L  +A N  APK F   ++ 
Sbjct: 342 PFVIGIQNAGIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRF 401

Query: 372 GVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQ 431
           GVP+V V F+++   LAY+  ++     F W  NI  ++GF  W     +++RF KA+K 
Sbjct: 402 GVPWVAVTFSALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKY 461

Query: 432 RGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKF-KVANFFAAYISVFLFII 490
            G+  N LPY      ++ ++++  + ++I   G+  F P+F  V++F AAYI++ LF++
Sbjct: 462 NGL-ENRLPYAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVV 520

Query: 491 FWVAFQIWFKCRLVW--KLQDVDLDTDRRDIEEEVWSDDVE 529
            W+  +I+ +    W   ++++D+ T   +IEE     D E
Sbjct: 521 LWIGHKIYTRDFKKWWYPVEEIDVVTGLTEIEERTRILDEE 561

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  281 bits (720), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 164/548 (29%), Positives = 276/548 (50%), Gaps = 27/548 (4%)

Query: 12  QVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXX 71
           +   ++ P      D   +    +K+ +K RH+ M                +        
Sbjct: 73  RAPGSNNPDKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPA 132

Query: 72  XXXXXYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAM 130
                Y  MG+ ++ + Q+ GE+   +  ++  F  +    + PA G +  ++Y   W  
Sbjct: 133 GLVIGYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLC 192

Query: 131 TFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXX 190
              LEL      I++WT +V    +++I +V++   N+F  R Y E EF+  + KVL   
Sbjct: 193 VMPLELVTASITIKYWTTSVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMIS 252

Query: 191 XXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQ 249
                            G +G +YW +PG +     S +     F G VS+L+ AAF F 
Sbjct: 253 GFLILGIIVNCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFG 307

Query: 250 GTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ-SNDSYV 308
            TE + +TA E   PRK++P A KK+++RILV Y+GS+++IG LVP+N  +L  S  S  
Sbjct: 308 ATEFIALTAAEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSAT 367

Query: 309 SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNT 368
            +SP++I I + G K++PH+ NAVIL+++IS GNS  Y  SR+L  LA+   AP F    
Sbjct: 368 HASPYVIAIASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYV 427

Query: 369 SKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKA 428
            + G P + ++ +S+FG ++++  +   +  FTWLL I G++  F W  I  SHIRF +A
Sbjct: 428 DREGRPTLAMVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRA 487

Query: 429 LKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYIS 484
           +K +G S  +L +K+ +  W +YYA   M++I++ Q +T+ AP    K     FF  Y++
Sbjct: 488 MKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLA 547

Query: 485 VFLFIIFWVAFQIWFKCRLVWKL----QDVDLDTDRRDIEEEVWSDDVED-----KNKNW 535
           + + I  +  +++W   +  W L      +DL ++RR  +E+V   +  +     +N  W
Sbjct: 548 MPILIALYFGYKVW---KRDWTLYIPASKIDLISNRRIFDEDVLKQEDAEYREKLRNSGW 604

Query: 536 WDR---FW 540
             R   FW
Sbjct: 605 LRRAAEFW 612

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  281 bits (720), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 173/543 (31%), Positives = 280/543 (51%), Gaps = 20/543 (3%)

Query: 12  QVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXX 71
           +VD N T      ++     +  +K  LK RH+ M                         
Sbjct: 75  EVDPNLTEAERIAINT---AKAPLKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPA 131

Query: 72  XXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMT 131
                +    T+++ +  +LGE+    PV+  FT +A RF+  +FG A+ + Y   W  T
Sbjct: 132 GIVIGWGLTSTMIYCMVMALGELAVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLAT 191

Query: 132 FALELSVVGQIIQFW-TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXX 190
             LE+      + +W T       ++++ W+++ I NLF VR +GE EF  +++KVL   
Sbjct: 192 LPLEIVSASITVNYWQTPERYRDGFVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVI 251

Query: 191 X-XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQ 249
                            G VG RYW NPG +    +  N    +F G  S  + AAF+F 
Sbjct: 252 GFIILGIVLVAGGGPEGGFVGGRYWHNPGAF----VGDNAG-TQFKGVCSVFVTAAFSFA 306

Query: 250 GTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY-V 308
           G+ELVGITA E   PRK+VP+A K+VV+RI++FY+GSL++IGLLVPY DP+L    S   
Sbjct: 307 GSELVGITAAEAANPRKSVPRAAKQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDA 366

Query: 309 SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNT 368
           S+SPF+I I   G + LP + N VILI ++S GNS ++ GSR +  L++    P+ F   
Sbjct: 367 SASPFVIAIVTHGIRGLPSVINVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYI 426

Query: 369 SKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKA 428
            + G P V ++  S FG +A++  +    + F WL+ + G++  F W  I   HIRF  A
Sbjct: 427 DRKGRPLVGIIVISTFGLIAFIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMA 486

Query: 429 LKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP---KFKVANFFAAYISV 485
           LK +G S N+LP+ +      + + +F ++++ + Q + +  P   K     FF +Y+S 
Sbjct: 487 LKAQGRSTNELPFVSPAGIIGSSWGLFMLLLMFIAQFYVALFPPGSKPSAEVFFESYLSF 546

Query: 486 FLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVEDKN-----KNWWDRF 539
            + + F+   +I+ K  +L  K +D+D+DT RR+ + E+   ++E++      K WW R 
Sbjct: 547 PIVLAFYFGHKIYKKNWKLFIKAEDMDIDTGRRETDLELLKQEIEEEKAILATKGWWYRQ 606

Query: 540 WNY 542
           + +
Sbjct: 607 YQF 609

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  281 bits (718), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 168/508 (33%), Positives = 268/508 (52%), Gaps = 14/508 (2%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           D + +   +K++L+ RH+SM                              Y  MG VVF+
Sbjct: 51  DGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFT 110

Query: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146
           V   LGEM  +IP+   FT +A R+  PA G A G+ Y F + +    +L+    +IQFW
Sbjct: 111 VMSCLGEMAAYIPLDG-FTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFW 169

Query: 147 TMA--VPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXX 204
             A  V    WI++V  ++ + N   VR +GE EFW++S KVL                 
Sbjct: 170 IPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGG 229

Query: 205 VTGP-VGFRYWKNPGP---WGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGE 260
            T   +GFRYW +PG    +            +F  ++S  + A F + GTEL GI A E
Sbjct: 230 PTHDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAE 289

Query: 261 VQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSS---PFIITI 317
            ++PR+ VP+AIK  ++RI+VFY+ ++ ++G+ V YNDP L    S   S+   P+++ I
Sbjct: 290 CKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAI 349

Query: 318 QNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVT 377
           +NA   +LP++FNA +L  + SA NS++Y+GSR LYGLA +  APK F  T+K GVPY  
Sbjct: 350 ENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNA 409

Query: 378 VLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRN 437
           +   ++F  LAYM  +     AF + +N+  + G  +W+ I  ++I F +A + +GI ++
Sbjct: 410 LACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKS 469

Query: 438 DLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPK-FKVANFFAAYISVFLFIIFWVAFQ 496
            L Y A   P+  + A+ F + + +I+ F +F  K   V  F   YI + ++I  ++ ++
Sbjct: 470 TLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITGYIGLPIYIFCFIGYK 529

Query: 497 IWFKCRLVWKLQDVDLDTDRR--DIEEE 522
           I  K + +   ++VDL T +   D+EEE
Sbjct: 530 IVHKTKWI-PSKEVDLFTFKEAIDLEEE 556

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  280 bits (716), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 163/543 (30%), Positives = 272/543 (50%), Gaps = 35/543 (6%)

Query: 7   QVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXX 66
           Q+   +V S+D P          +    +K+ LK RHI +                    
Sbjct: 33  QISGPKVSSSDAP----------QGDHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLH 82

Query: 67  XXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTV-----FAQRFLSPAFGAANG 121
                     Y  +  +++ V  +LGEM  ++P   S +         R++ P+ G A G
Sbjct: 83  ACGPAGLFTSYCIISVIIYPVMNALGEMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATG 142

Query: 122 YMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWI 181
           + Y++ + +  A E +    ++Q+WT AVP  AWI+I   ++ + N   V+ YGE EFW 
Sbjct: 143 WNYYYCYVILVAAECTAASGVVQYWTTAVPKGAWITIFLGVVVLLNFCAVKFYGESEFWF 202

Query: 182 ASVKVLXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGW 237
           AS+K+L                   GP    +GFRYW+ PG +   I S N    RF   
Sbjct: 203 ASMKILCILGLLFVSFILFWGG---GPHHDRLGFRYWQKPGAFAYHITSGNTG--RFLDI 257

Query: 238 VSSLINAAFTF-QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPY 296
            + +I   F F  G ELV +T+ E Q+ R+ + KA ++ V+R++ FY+ S L IG +V Y
Sbjct: 258 WTGVIKGGFAFILGPELVALTSAEAQDARRNIQKASRRFVYRLIFFYVSSSLAIGCIVAY 317

Query: 297 NDPKLQS----NDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRIL 352
           ND  L +          SSPF+I IQNAG K+LPHI N  IL +  S+GNS ++  SR L
Sbjct: 318 NDKTLSTALDQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMFAASRSL 377

Query: 353 YGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGF 412
             +++   APK     ++ GVPY  V  TS+   +AY+  ++     FTW  NI  ++GF
Sbjct: 378 LSMSQEGFAPKILGRVNRFGVPYAAVALTSLLSCIAYLNVSSSTADVFTWFSNISTISGF 437

Query: 413 FAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP- 471
             W+ I  +++RF KA+  + +    +P+K    P+  ++ +  + +I +  G+  F P 
Sbjct: 438 IGWICIGIAYLRFRKAIFFQNLYER-VPFKTPFQPYGTWFFIIAVSVICLTNGYAIFIPA 496

Query: 472 KFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKL--QDVDLDTDRRDIEEEVWSDDVE 529
            + V++F AAY+++ +F++ W+  ++W +    W +   ++D+ T  ++IEEE  S + +
Sbjct: 497 NWNVSDFIAAYVTLPIFLVLWIGHKLWTRTWKTWAIPVPEIDVTTGLKEIEEE--SKECD 554

Query: 530 DKN 532
           +K 
Sbjct: 555 EKR 557

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  282 bits (722), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 165/541 (30%), Positives = 277/541 (51%), Gaps = 23/541 (4%)

Query: 18  TPTTISTLDDDQEK-QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXX 76
           T + I     +Q++ Q+++K+ +K RHI M                +             
Sbjct: 125 TESGIKQPSQEQDQNQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIG 184

Query: 77  YLFMGTVVFSVTQSLGEMCT-FIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALE 135
           Y  MG+ ++ + Q+ GE+   +  +   F  +    + PA G +  ++Y   W     LE
Sbjct: 185 YAIMGSCIYCIIQACGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLE 244

Query: 136 LSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXX 195
           L      I++WT+ V    ++ I +VL+ + N+F  + Y E +F+    K+L        
Sbjct: 245 LVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFIL 304

Query: 196 XXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELV 254
                     T G +G RYW NPG +       N    RF G V++ + AAF F  +E +
Sbjct: 305 AIIIDCGGAGTDGYIGSRYWHNPGAF-----RGNTGIQRFKGVVATFVTAAFAFGMSEQL 359

Query: 255 GITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPY-NDPKLQSNDSYVSSSPF 313
            +TA E   PRK +P A KK+++RIL  ++GSL+++G LVPY +D  L ++ S   +SP+
Sbjct: 360 AMTASEQSNPRKAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSATKASPY 419

Query: 314 IITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGV 373
           +I + + G +++PH  NAVIL++++S  N   Y  SRIL  LAK   APK F    + G 
Sbjct: 420 VIAVASHGVRVVPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGR 479

Query: 374 PYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRG 433
           P V +L +S+FG +A+  ++   +  FTWLL I G++  F W+ I  SHIRF +A+K +G
Sbjct: 480 PAVAMLVSSIFGIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQG 539

Query: 434 ISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISVFLF 488
            S  ++ YK+ +  W + YA+  MV+ ++ Q + + +P     K    +FF  Y+++ + 
Sbjct: 540 RSLGEVGYKSQVGIWGSMYAIVMMVLALIAQFWVAISPIGGGGKLSAQSFFENYLAMPIL 599

Query: 489 IIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVED-----KNKNWWDR---F 539
           I  +V +++W K   L      +DL TDR+  +EE+   + E+     +N  +W R   F
Sbjct: 600 IALYVFYKVWKKDWTLFIPADKIDLVTDRQIFDEELLKQEDEEYQEKLRNGPYWKRVVDF 659

Query: 540 W 540
           W
Sbjct: 660 W 660

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  278 bits (712), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 156/501 (31%), Positives = 260/501 (51%), Gaps = 10/501 (1%)

Query: 26  DDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVF 85
           ++  EK  ++ RELK R +S+                              YLF G+++ 
Sbjct: 23  EEIDEKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLC 82

Query: 86  SVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQF 145
            V  SL EM +F P+   F+ +  R++ PAFG A G+ Y+  +A+  +  L+  G +I +
Sbjct: 83  VVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGY 142

Query: 146 WTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXV 205
           W   V +  W+++++V +   N   V+ +GEIE  +   K+L                  
Sbjct: 143 WRPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAP 202

Query: 206 TGPV-GFRYWKNPG--PWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQ 262
                GFRYW+  G  P+ +G         +F GW + ++ + F F G+E++GI  GE  
Sbjct: 203 NHTTTGFRYWRESGALPYLVG-----GGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETA 257

Query: 263 EPRKTVPKAIKKVVFRILVFYIGSLLVIGLLV-PYNDPKLQSNDSYVSSSPFIITIQNAG 321
            P+KT+PK+   V FRI   Y+  + ++GL + P N   + ++ +  ++SPF+I I ++G
Sbjct: 258 NPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSG 317

Query: 322 TKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFT 381
            K+LP+  NA +L+ IIS+ N+++YI SR LYGLAK+ AAPK F   ++  VP V  +  
Sbjct: 318 IKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTG 377

Query: 382 SMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPY 441
           S+ G LAYM T       F+++ + V V G   W  I  ++I + +A+K +GIS +D+P+
Sbjct: 378 SLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437

Query: 442 KAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKC 501
           +    P+ AY  +FF+ II    G+ +F  KF    F  +YI VF  I+  + ++++FK 
Sbjct: 438 RMWFQPYAAYVTLFFVTIITFFNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKT 497

Query: 502 RLVWKLQDVDLDTDRRDIEEE 522
           + V K  ++   T      EE
Sbjct: 498 KFV-KPSEISFRTRNEHEGEE 517

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  280 bits (715), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 161/528 (30%), Positives = 270/528 (51%), Gaps = 20/528 (3%)

Query: 29  QEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVT 88
           ++ +  +K+ +  RH+ M                +             Y  MG+ ++ + 
Sbjct: 84  RQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCII 143

Query: 89  QSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWT 147
           Q+ GE+  ++  ++ +F  +    +  AFG +  ++Y   W     LEL      I++WT
Sbjct: 144 QAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWT 203

Query: 148 MAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVT- 206
            +V    +++I +VL+ + N+F  R Y E EF+    KVL                    
Sbjct: 204 TSVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGND 263

Query: 207 GPVGFRYWKNPGP-WGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPR 265
           G +G RYW NPG  +G   I        F G +S+++ AAF F  TE + +TA E   PR
Sbjct: 264 GYIGGRYWNNPGAFYGTKPIH------HFKGIISTMVTAAFAFGATEFIALTAAEQANPR 317

Query: 266 KTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ-SNDSYVSSSPFIITIQNAGTKI 324
           + +P A KKVV+RIL+ ++  +++IG LVP+N P+L  S  S   +SP++I + + G ++
Sbjct: 318 RAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVIAVASHGVRV 377

Query: 325 LPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMF 384
           +PH  NAVIL++++S GNS  Y  SR+L  LA    AP +     ++G P   +L + +F
Sbjct: 378 VPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVSCVF 437

Query: 385 GSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAM 444
           G ++++  +   +  FTWLL I G++  F W+ I  SHIRF KAL  +G    +L YK+ 
Sbjct: 438 GLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGELGYKSQ 497

Query: 445 LMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWFK 500
                +YYA F M  I++ Q + + AP    K    +FF  Y+++ LF++ +  F+IW +
Sbjct: 498 TGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLYFGFKIWKR 557

Query: 501 C-RLVWKLQDVDLDTDRRDIEEEVWSDDVED-----KNKNWWDRFWNY 542
             RL   L+ +DLD+ R+  +EE+   +  +     +NK W  R  +Y
Sbjct: 558 DWRLYIPLEQIDLDSHRKTFDEELLKQEDAEYEENIRNKGWLRRIAHY 605

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  279 bits (714), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 163/526 (30%), Positives = 272/526 (51%), Gaps = 26/526 (4%)

Query: 33  QDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLG 92
            ++K+ LK RH+ +                              Y  + +V++ + Q +G
Sbjct: 73  HELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGIG 132

Query: 93  EMCTFIPVTAS----FTVF-AQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWT 147
           EM  ++P + S    F  +   +++  + G A+ + Y++ + +  A E +    ++++WT
Sbjct: 133 EMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYWT 192

Query: 148 MAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTG 207
            +VP AAWI+I    + I N   V+ YGE EFW AS+K+L                   G
Sbjct: 193 TSVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWG---GG 249

Query: 208 P----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTF-QGTELVGITAGEVQ 262
           P    +GFRYW+NPG +   I   +     F    + +I   F F  G E++ +T+ EV+
Sbjct: 250 PNHDRLGFRYWQNPGGFAHHIRGGSFGS--FLDIYTGIIKGGFAFILGPEMIAMTSSEVE 307

Query: 263 EPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQS----NDSYVSSSPFIITIQ 318
           + R+ + KA ++ V+R++ FYI   L I ++V YNDP L++    N     SSPF+I IQ
Sbjct: 308 DQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQ 367

Query: 319 NAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTV 378
           NAG K+LPHI NA IL +  SAGN+ ++  SR L  +A+N  AP+ F   ++ GVPY  V
Sbjct: 368 NAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAV 427

Query: 379 LFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRND 438
             +S    LAY+  ++     F W  NI  ++GF  W+ +  ++IRF KA+   G+ ++ 
Sbjct: 428 GLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGM-QSR 486

Query: 439 LPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKF-KVANFFAAYISVFLFIIFWVAFQI 497
           LPY A  MP+L Y+ +  + II +  G+  F P+F    NF AAYI++ +F + W+  ++
Sbjct: 487 LPYTARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWIGHRV 546

Query: 498 WFKCRLV---WK-LQDVDLDTDRRDIEEEVWSDDVED-KNKNWWDR 538
           + +       WK ++++D+ T   +IEE+    D        WW++
Sbjct: 547 YRRKIFTLKWWKSIEEIDVVTGVEEIEEKTRECDASRVLPTKWWEK 592

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  278 bits (712), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 162/523 (30%), Positives = 263/523 (50%), Gaps = 17/523 (3%)

Query: 32  QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSL 91
           +  ++ +LK RH+ M                              ++  G++++ +  S+
Sbjct: 81  RSPLQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSV 140

Query: 92  GEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW-TMAV 150
            E+    PV   FT +A RF+  ++G AN + Y   W +T  LE+      + +W T   
Sbjct: 141 AELAIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKK 200

Query: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGPVG 210
               ++++ WV++ I N+F VR YGE EF  +  K+L                       
Sbjct: 201 YRDGFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYI 260

Query: 211 F-RYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVP 269
             RYW +PG +     + + +  +F G+ S  + AAF+F G+ELVG+ A E   PRK VP
Sbjct: 261 GARYWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVP 315

Query: 270 KAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY-VSSSPFIITIQNAGTKILPHI 328
            A K+V +RI +FY+  LL+IG+LVPY DP+L    S   ++SPF+I I+N G   LP +
Sbjct: 316 GAAKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAASPFVIAIKNQGISGLPTL 375

Query: 329 FNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLA 388
            N VILI ++S GNS VY  SR L  LA     PK F+   + G P V +  TS FG +A
Sbjct: 376 VNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIA 435

Query: 389 YMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPW 448
           ++  +    + F WL+ + G++  F W  I   HIRF +AL  +G S N+L + +    W
Sbjct: 436 FVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVW 495

Query: 449 LAYYAVFFMVIIIVIQGFTSFAP---KFKVANFFAAYISVFLFIIFWVAFQIWFKC-RLV 504
            A + +F  +I++  Q + +  P        +FF  Y+S+ + +  W+  +IW K  +L 
Sbjct: 496 GAAWGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKKNWKLF 555

Query: 505 WKLQDVDLDTDRRDIEEEVWSDDVEDKN-----KNWWDRFWNY 542
            K +D+D+DT RR+++ ++    VE++      K  W R + +
Sbjct: 556 IKAEDMDIDTGRRELDLDLLRQQVEEERAALAAKPMWYRIYKF 598

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  278 bits (710), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 155/476 (32%), Positives = 261/476 (54%), Gaps = 18/476 (3%)

Query: 77  YLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALEL 136
           ++ + T +F++  +LGE+ +  PV   F V+  RF+ P+FG A    Y   WA+   LEL
Sbjct: 112 WVIISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLEL 171

Query: 137 SVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXXX 195
                 I++W   +   AW++I + ++ ++NL  V+ +GE EF ++ VK+L         
Sbjct: 172 VAASLTIRYWNSTINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILG 231

Query: 196 XXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVG 255
                      G +G +YW NPG +       N +  RF G  S  + AAF++ GTEL+ 
Sbjct: 232 IVLTCGGGPEGGYIGGKYWSNPGAF-----VGNTSSQRFHGLCSVFVTAAFSYSGTELIA 286

Query: 256 ITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV--SSSPF 313
           ++A E   PR T+PKA K+  + I V YI  L ++G LVP +DP+L    S V  ++SP 
Sbjct: 287 VSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPL 346

Query: 314 IITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGV 373
           +I I+N G K LP + NA+ILI ++S  NS VY  SR +  +A+    PK F+   + G 
Sbjct: 347 VIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGR 406

Query: 374 PYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRG 433
           P   +L T +FG L+++  +   +  FTWL  + G++  F W  I+ SHIRF   +KQRG
Sbjct: 407 PLYAILATLIFGLLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRG 466

Query: 434 ISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFK----VANFFAAYISVFLFI 489
            S ++LP+ +M   W +YY    + +++V+  +T+  P  +      +FF  Y+S  + +
Sbjct: 467 RSLDELPFVSMTGVWGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILL 526

Query: 490 IFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDD--VED---KNKNWWDRF 539
           + ++  +++ K  RL+    ++D+D+ RR ++ EV  D+  +E+   + K++  RF
Sbjct: 527 VCYIGHKLYTKSWRLLTPTTEIDIDSGRRAVDIEVLKDEKRMEEQAMREKSYLTRF 582

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  279 bits (714), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 169/568 (29%), Positives = 279/568 (49%), Gaps = 36/568 (6%)

Query: 4   NQP-QVHSFQVD-SNDTPTTIS--TLDDDQEK----------QQDVKRELKKRHISMXXX 49
            QP Q H+   D  ND  T IS  +LD  Q K          ++ +K+ +K RH+ M   
Sbjct: 97  QQPNQQHNLAEDLENDLTTAISMNSLDRVQNKPTGNGQMKFEEEALKKSIKPRHVVMISL 156

Query: 50  XXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCT-FIPVTASFTVFA 108
                        +             Y  MG+ ++ + Q+ GEM   +  +   F  + 
Sbjct: 157 GTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGGFNTYP 216

Query: 109 QRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNL 168
              + P FG A  ++Y   W     LEL      I++WT  V   A++ I +V++    +
Sbjct: 217 SMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTTVNPDAFVVIFYVVIIFIQI 276

Query: 169 FPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISS 227
           F  R Y E EF+    K+L                    G +G +YW +PG +       
Sbjct: 277 FGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAKYWHDPGAF-----RG 331

Query: 228 NVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSL 287
                RF G +++ ++AAF F  TE + +TA E   PRK +P A KKV++R++  ++G++
Sbjct: 332 TNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRVICIFVGTI 391

Query: 288 LVIGLLVPYNDPKLQ-SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVY 346
            ++G LVP++  +L  +  S   +SP+++ I   G +++PH  NAVILI++ S  NS  Y
Sbjct: 392 ALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVRVVPHFINAVILISVFSVANSAFY 451

Query: 347 IGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNI 406
             SR+L GLA+   APKFF    + G P+  +   ++FG +A+   +   D+ FTWLL I
Sbjct: 452 SSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKEDQVFTWLLAI 511

Query: 407 VGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGF 466
            G++  F W+ I  SHIRF +A+  +G S  ++ +KA L  + +YYA   MV+ ++ Q +
Sbjct: 512 SGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMMVLALIAQFW 571

Query: 467 TSFAP-----KFKVANFFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIE 520
            + AP           FF  Y+++ + I F+  +++W +  RL  + +D+DLD+ R+  +
Sbjct: 572 VAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIRAKDIDLDSYRQVFD 631

Query: 521 EEVWSDDVED-----KNKNWWDR---FW 540
           EE+   + E+     KN   W R   FW
Sbjct: 632 EELLKQEDEEYKEKLKNGPMWKRVVDFW 659

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  276 bits (707), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 171/551 (31%), Positives = 279/551 (50%), Gaps = 15/551 (2%)

Query: 1   MKLNQPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXX 60
           MK  +    +++   ++  +  S +  D E   ++K+ L  RHI +              
Sbjct: 19  MKEVKSNEETYRTSHSNLESQNSDVVSDYE--HNLKKGLSNRHIQLIALGGCIGTGLFVG 76

Query: 61  XXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAAN 120
                           ++ + T+V+ +  +L EM  ++P   S      R++ P+ G A 
Sbjct: 77  TSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEMVCYLPQQGSVPELVTRYVDPSLGFAA 136

Query: 121 GYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFW 180
           G+ Y +S+AM  A EL+    I+++WT  VP   WI+I  +++ + N   VR YGE EFW
Sbjct: 137 GWNYAYSYAMLVATELTAAAGIVRYWTDQVPQGVWITIFLIVVVVLNFSAVRFYGESEFW 196

Query: 181 IASVKVLXXXXXXXXXXXXXXXXXVTGP-VGFRYWKNPGPWGMGIISSNVNEARFFGWVS 239
            AS+K++                      VGFRYW+NPG +G  I   N+   RF    +
Sbjct: 197 FASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYHITGGNL--GRFLDLWT 254

Query: 240 SLINAAFTF-QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYND 298
           ++I +AF F    ELVG+   E ++ R+ + KA ++ ++RI+ FY+ S L+IG++V  ND
Sbjct: 255 AIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRIIFFYLSSSLMIGVIVAKND 314

Query: 299 PKL----QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYG 354
             L    + N    +SSPF+  I N+G  +L H+ N  IL +  SAGNS  Y  SR +  
Sbjct: 315 HNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILTSAWSAGNSFFYASSRSILA 374

Query: 355 LAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFA 414
           L+K   APK F+  ++ GVPY  V   S+   LAY+  ++   K F WL NI  ++GF  
Sbjct: 375 LSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTSSKVFQWLSNICTISGFIG 434

Query: 415 WLLISCSHIRFMKA-LKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-K 472
           W LI  ++IRF KA L  R + R  +PY++ L P+ AY+    + II +  G+  F   +
Sbjct: 435 WFLIGVAYIRFRKAILFNRLLDR--IPYRSPLQPFSAYFFTIVVAIITLTNGYVVFIKGR 492

Query: 473 FKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKN 532
           +   +F  +YIS+ +F+ F++  +  +K R    +  +D+ T   + EEE     V    
Sbjct: 493 WDYKDFLTSYISLPIFLAFYLGHKTIYKTRFCIPVDQIDVITGLEEAEEEA-KLSVVRVP 551

Query: 533 KNWWDRFWNYV 543
           KN W++F N++
Sbjct: 552 KNAWEKFINWL 562

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  278 bits (711), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 164/518 (31%), Positives = 266/518 (51%), Gaps = 27/518 (5%)

Query: 18  TPTTISTLDDDQEKQQ---------DVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXX 68
           +PT I ++DD+ EK+Q         ++K+ LK RHI +                      
Sbjct: 70  SPTIIDSIDDEAEKEQGKERSSSNGELKQGLKSRHIQLIALGGTIGTSLLVGTSSALANC 129

Query: 69  XXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTV-----FAQRFLSPAFGAANGYM 123
                   YL + T V+ +  +LGEM  F+P   S +         +++ P+ G A  + 
Sbjct: 130 GPAGLFISYLIISTFVYPIMNALGEMVCFLPGNGSDSAGSAAHLVHKYVDPSLGFAASWN 189

Query: 124 YWFSWAMTFALELSVVGQIIQFWTMA--VPLAAWISIVWVLLTISNLFPVRIYGEIEFWI 181
           Y++ + +  A E+S    +I++W  A  VP  AWI+I   L+ I N  PV +YGE EFW 
Sbjct: 190 YYYCFVILVAAEVSAASGVIEYWAWAEHVPKGAWITIFLSLIVILNFLPVNVYGESEFWF 249

Query: 182 ASVKVLXXXXXXXXXXXX--XXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVS 239
           AS+K+L                     G +GFRYWKNPG +   I         F    +
Sbjct: 250 ASIKILCITGLIILSFILFWGGGPKSDGILGFRYWKNPGSFAHHITGGG--GGNFLDIYT 307

Query: 240 SLINAAFT-FQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYND 298
            +I   F+   G ELV +T+ E  + R+ + KA K+ V+R++ FYI   L IG++V YND
Sbjct: 308 GIIKGGFSVILGPELVCLTSSECADQRRNIAKASKRFVWRLMFFYILGSLSIGVIVAYND 367

Query: 299 PKLQS----NDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYG 354
           P LQ+    + +   SSPF+I IQNAG + +PHI N  IL +  SAGN+ ++  SR L  
Sbjct: 368 PVLQNALAQSKAGAGSSPFVIGIQNAGIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLT 427

Query: 355 LAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFA 414
           +A+N  APK F   ++ GVPY  V  + +   LAY+  ++     F W  NI  ++GF  
Sbjct: 428 MARNGNAPKIFCRINQLGVPYTAVGASLLLSCLAYLNVSSSTADVFNWFSNISTISGFIG 487

Query: 415 WLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPK-F 473
           W+    ++IRF KA+    ++   +P++A    +  +Y++F++ +I +  G+  F P+ +
Sbjct: 488 WICACVAYIRFRKAITYNKLTHR-IPFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNW 546

Query: 474 KVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVD 511
            V +F AAYI++ +FI+ W+  +++ +  L   L+ +D
Sbjct: 547 NVKDFIAAYITLPIFIVLWIGHKVFTRTLLKAWLRPID 584

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  277 bits (708), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 166/527 (31%), Positives = 270/527 (51%), Gaps = 20/527 (3%)

Query: 29  QEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVT 88
           +  +  ++ +LK RH+ M                R             +   GT++F++ 
Sbjct: 82  KTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMV 141

Query: 89  QSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTM 148
            +LGE+    PV+  FT +A RF+  +FG A  + Y   W +   LE+      + +W  
Sbjct: 142 MALGELAVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWET 201

Query: 149 AVPLA-AWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTG 207
            V     ++++ W+++ I N+F VR YGE EF  + +KV                    G
Sbjct: 202 PVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVG 261

Query: 208 PVGF-RYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRK 266
                RYW NPG +       + +  +F G+ S  + AAF+F G+EL+G+   E + PRK
Sbjct: 262 GYVGARYWHNPGAF-----VGSTSGQKFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRK 316

Query: 267 TVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL-QSNDSYVSSSPFIITIQNAGTKIL 325
            VP A K+V +RIL+FYI  LL+IG LVPYNDP+L  S+    S+SPF+I I   G   L
Sbjct: 317 AVPSAAKQVFWRILLFYIICLLLIGFLVPYNDPRLISSSSVDASASPFVIAIVTHGISGL 376

Query: 326 PHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFG 385
           P + N VILI+++S GNS +Y  SR L  L++    PK  +   + G P V +  +S FG
Sbjct: 377 PSVINVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFG 436

Query: 386 SLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAML 445
            +A++  +   ++ F WLL I G++ FF W  I   HIRF  ALK +G   ++LP+ +  
Sbjct: 437 LIAFVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPA 496

Query: 446 MPWLAYYAVFFMVIIIVIQGFTSFAP---KFKVANFFAAYISVFLFIIFWVAFQIWFKC- 501
               +Y+ +F  +++++ Q + +  P         FF+AY++  + + F++A ++W K  
Sbjct: 497 GVIGSYWGLFLNILMLIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAFYIAHKLWKKNW 556

Query: 502 RLVWKLQDVDLDTDRRD-----IEEEVWSDDVEDKNKNWWDR---FW 540
           + +  L+DVD+DT RRD     +++E+  +      + WW R   FW
Sbjct: 557 KFLIPLEDVDIDTGRRDTDVNLLKQEIAEEKAALAMRPWWYRVYVFW 603

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  275 bits (704), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 170/526 (32%), Positives = 272/526 (51%), Gaps = 23/526 (4%)

Query: 32  QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSL 91
           Q  +K  LK RH+ M                              +   GT+++S+  +L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMAL 142

Query: 92  GEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW-TMAV 150
           GE+    P++  FT +A RF+  +FG AN + Y   W +   LE+      + FW T   
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXXXXXXXXXXXXVTGPV 209
               ++++ W+++ I N+F V+ YGE EF  + +KV+                    G +
Sbjct: 203 YRDGFVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYI 262

Query: 210 GFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVP 269
           G +YW +PG +     + +   A+F G  S  + +AF+F G+ELVG+ A E  +PRK+VP
Sbjct: 263 GGKYWHDPGAF-----AGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVP 317

Query: 270 KAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY-VSSSPFIITIQNAGTKILPHI 328
           KA K+V +RI +FYI SLL++GLLVPYNDP L    S   ++SPF+I I+  G K LP +
Sbjct: 318 KAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAASPFVIAIKTHGIKGLPTV 377

Query: 329 FNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLA 388
            N VILI ++S GNS +Y  SR +  LA+ +  P+ F    + G P V +  TS FG +A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIA 437

Query: 389 YMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPW 448
           ++  +      F WLL + G++  F W  I   HIRF KAL  +G   ++L +K+    W
Sbjct: 438 FVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVW 497

Query: 449 LAYYAVFFMVIIIVIQGFTSFAP---KFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVW 505
            +Y+ +F +VI+ + Q + +  P         FF AY+S  L +  ++  +I+   +  W
Sbjct: 498 GSYWGLFMVVIMFIAQFYVALFPVGASPSAEGFFEAYLSFPLVVAMYLGHKIY---KRNW 554

Query: 506 KL----QDVDLDTDRRDIEEEVWSDDVEDKN-----KNWWDRFWNY 542
           KL    +D+D+DT RR+++ E+   ++ ++      K  W R WN+
Sbjct: 555 KLFIPAEDMDIDTGRREVDLELLKQEIAEEKAIMATKPKWYRIWNF 600

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  273 bits (699), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 174/542 (32%), Positives = 286/542 (52%), Gaps = 27/542 (4%)

Query: 4   NQPQVHSFQVDSNDT-PTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXX 62
           + P V +++V   D+    ++ L+D  + ++ + R L  RHI+M                
Sbjct: 25  SAPVVQNYEVTPLDSISDAVTDLEDHDKIRESLNRSLSPRHINMISVAGVIGTGLYLSTA 84

Query: 63  RXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGY 122
           +             Y  MG VV+     LGEM TF+P++ SF  +A++F   +F  A   
Sbjct: 85  KSLHVGGPGSLFINYTIMGGVVYLTMLCLGEMSTFMPISGSFCSYAKKFGCESFAFALMC 144

Query: 123 MYWFSWAMTFALELSVVGQIIQFWTMA---VPLAAWISIVWVLLTISNLFPVRIYGEIEF 179
            YWF+ A++ A +L+ +  ++ +W  +    P  A   + WV L   N+  VR+YGE E+
Sbjct: 145 NYWFNDAVSVASDLTALQLVLDYWKSSQHNFPYWAASLLFWVFLLGLNVIHVRVYGEAEY 204

Query: 180 WIASVKVLXXXXXXXXXXXXXXXXXVTGP-VGFRYWK-NPGPWGMGIISSNVNEARFFGW 237
           W+A +KV+                      +GF+YW     P+  G          F G+
Sbjct: 205 WLALLKVIAIVIFFILAIVVNVGHNPDHEYIGFKYWSYKEAPFVNG----------FKGF 254

Query: 238 VSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN 297
           V+  +++AF++ GTE + +TAGE + P +  P+ +K V +RIL+FY+ ++  I + +PY+
Sbjct: 255 VTIFVSSAFSYGGTESITLTAGEARNPIRNTPRIVKTVFWRILIFYVATMFFISMNIPYD 314

Query: 298 DPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLA- 356
            P L +    V +SPF I  Q AGTK      NAVIL +I+SAGN  ++ GSR+LY +  
Sbjct: 315 YPNLSTKS--VMTSPFTIIFQMAGTKAAGSFMNAVILTSIVSAGNHALFAGSRVLYNMGL 372

Query: 357 KNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWL 416
           +    PK  T T++   PYV V+ T   G L +  +  G    +TWL NIVGV+   AWL
Sbjct: 373 EGFVFPKLITKTNRYRAPYVAVILTWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQVAWL 432

Query: 417 LISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVA 476
            I+ + IRF K L Q+G ++ +L +K    P+  Y+ V F+ +II++QG+++F P +  +
Sbjct: 433 SIAVTSIRFRKGLAQQGKTQ-ELQFKNWTYPYGPYFLVIFVTLIILVQGWSAFDP-WSTS 490

Query: 477 NFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDR-----RDIEEEVWSDDVEDK 531
           +FF+ Y+ +F+F   W+ + I+ + R V K +D+D  TDR     ++IEE    D++E  
Sbjct: 491 DFFSYYLELFVFPTCWLIWWIFKRDRFV-KPEDMDFITDRYIQSPQEIEENERLDNLEGY 549

Query: 532 NK 533
            K
Sbjct: 550 PK 551

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  274 bits (700), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 169/560 (30%), Positives = 277/560 (49%), Gaps = 29/560 (5%)

Query: 7   QVHSFQVDSNDT-PTTISTLDDDQE---KQQDVKRELKKRHISMXXXXXXXXXXXXXXXX 62
            V S Q  S+ T    +   D D +    +  +++ LK RHI M                
Sbjct: 45  DVESQQSTSSATISEKLGDGDGDADPFANEGSLQQGLKSRHIQMIALGGAIGTGLFVGTS 104

Query: 63  RXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIP-----VTASFTVFAQRFLSPAFG 117
                         Y+ + +VV+ +    GEM  ++P      + S      R++  + G
Sbjct: 105 STLALCGPAGLFISYIIISSVVYPIMCGFGEMVCYLPGNGNDASGSAAHLVARYVDKSLG 164

Query: 118 AANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEI 177
            A  + Y++ + +  A E +    ++++WT+AVP   WI I   ++ I N  PV+ YGE 
Sbjct: 165 FATAWNYYYCYIILVAAECTAASGVVEYWTVAVPKGVWILIFLGIVVILNFGPVKYYGEA 224

Query: 178 EFWIASVKVLXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEAR 233
           EFW AS+K+L                   GP    +GFRYW+ PG +   I+       R
Sbjct: 225 EFWFASIKILCIVGLIILSFILFWG---GGPNHDRLGFRYWQRPGAFTEHIMKGGF--GR 279

Query: 234 FFGWVSSLINAAFTF-QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGL 292
           F    S +I   F F  G ELV +T+ E ++ R+ + KA ++ ++R++ FY+   L I +
Sbjct: 280 FLDIYSGVIKGGFAFILGPELVCLTSAECEDQRRNIAKAARRFIWRLMFFYVLGTLAISV 339

Query: 293 LVPYNDPKL----QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIG 348
           +V YNDP L     S      SSPF+I IQNAG ++LPHI NA IL +  SAGN+ ++  
Sbjct: 340 IVAYNDPSLVSALASGKPGAGSSPFVIGIQNAGIRVLPHIINACILSSAWSAGNAFMFAS 399

Query: 349 SRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVG 408
           +R L  +A+N  AP+ F   ++ GVPYV +  +     LA++  ++     F W  NI  
Sbjct: 400 TRSLLTMARNGDAPRVFGKINRFGVPYVAISLSGGLSCLAFLNVSSSTADVFNWFSNIST 459

Query: 409 VAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTS 468
           ++GF  W+    ++IRF KA+   G+  + LP+K    P+  YY++F + +I +  G+ +
Sbjct: 460 ISGFIGWICGCVAYIRFRKAIFFNGM-YDRLPFKTWGQPYAVYYSLFVISLITLTNGYAT 518

Query: 469 FAPK-FKVANFFAAYISVFLFIIFWVAFQIW---FKCRLVWKLQDVDLDTDRRDIEEEVW 524
           F PK +K ++F AAYI++ +F++ WV  ++W   F  R   ++  +D+ T   DIEE   
Sbjct: 519 FIPKNWKGSDFVAAYITLPIFVVLWVGHKLWTRTFTKRWWRRVDQIDVTTGLVDIEERTK 578

Query: 525 -SDDVEDKNKNWWDRFWNYV 543
             D+   +    W +F + V
Sbjct: 579 ILDETRVEPSTRWQKFMDAV 598

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  274 bits (701), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 162/527 (30%), Positives = 273/527 (51%), Gaps = 20/527 (3%)

Query: 31  KQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQS 90
           K +++K+ +K RH+ M                              +L MG  V+ V Q+
Sbjct: 86  KHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQA 145

Query: 91  LGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW--T 147
            GE+   +  +   F  +    + PA G A  ++Y   W   F LEL      I+FW  +
Sbjct: 146 AGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGS 205

Query: 148 MAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVT- 206
            +V    +++I +VL+ + N F  R Y E EF+  S KVL                  T 
Sbjct: 206 RSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTS 265

Query: 207 GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRK 266
           G +G +YW++PG  G        +   F G V++L+NAAF+   +E V +TA E   PRK
Sbjct: 266 GYIGGKYWRDPGSLG-----GRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANPRK 320

Query: 267 TVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ-SNDSYVSSSPFIITIQNAGTKIL 325
           ++P A KK++++I V ++GS+++IG LVP +  +L  SNDS +  SP++I ++  G  ++
Sbjct: 321 SIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGVNVV 380

Query: 326 PHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFG 385
           P   NAVIL++++S GNS  Y  SR+L+ LA+   APK F    +AG P + ++ + +FG
Sbjct: 381 PSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISILFG 440

Query: 386 SLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAML 445
           ++ ++  +   ++ F WLL I G++  F W  I  SHIRF +AL  +G S ++L +KA  
Sbjct: 441 TICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKAQT 500

Query: 446 MPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWFKC 501
               +Y +   MV+ ++ Q + S  P    +    +FF  Y+++ +F++F+  ++IW K 
Sbjct: 501 GIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIWNKD 560

Query: 502 -RLVWKLQDVDLDTDRRDIEEEVW-SDDVED----KNKNWWDRFWNY 542
            RL  +   +DL + RR  + +V   +D+E     +N + W R  N+
Sbjct: 561 WRLFIRADQIDLVSHRRIFDADVLKQEDIEYRAKLRNSSIWHRIANF 607

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  274 bits (700), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 160/508 (31%), Positives = 277/508 (54%), Gaps = 12/508 (2%)

Query: 32  QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSL 91
           Q  ++R+LK RH+ M                +             +  M T++  +  SL
Sbjct: 81  QSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLSL 140

Query: 92  GEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW-TMAV 150
           GEM    PV+  +T +A RF+  ++G AN   Y     +   LE+      + +W   + 
Sbjct: 141 GEMAVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKSQ 200

Query: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGP-V 209
             AA++++ W+ +   N+F V+ YGE EF  + +KV+                  T   +
Sbjct: 201 YRAAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYI 260

Query: 210 GFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVP 269
           G ++W NPG +       +    +F G  S  + AAF+F  TELVG+ A E ++PRK+VP
Sbjct: 261 GSKFWSNPGAF-----VGDTAGQKFKGICSVFVTAAFSFANTELVGLAAAETEDPRKSVP 315

Query: 270 KAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL-QSNDSYVSSSPFIITIQNAGTKILPHI 328
           KA K+V +RI +FYI SLL++GLLVPY DP+L  S+    ++SPF++ ++N G K LP +
Sbjct: 316 KAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVLALKNHGIKGLPSV 375

Query: 329 FNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLA 388
            N VIL  ++S GNS+V+  SR L  L++    P  F    + G P V+++F+S FG L 
Sbjct: 376 INVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLLC 435

Query: 389 YMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPW 448
           ++  +    + F W+L++ G++  F WL IS  HIRF KAL  +  S ++L + + +  W
Sbjct: 436 FLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASPIGIW 495

Query: 449 LAYYAVFFMVIIIVIQGFTSFAP---KFKVANFFAAYISVFLFIIFWVAFQIWFKC-RLV 504
            +YY+VF +++++++Q + +  P   K   +NFF AY+S+ + +  ++  +I+ K  +L+
Sbjct: 496 GSYYSVFLIIVVLILQFWIALFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIYTKNWKLL 555

Query: 505 WKLQDVDLDTDRRDIEEEVWSDDVEDKN 532
              + +D+DT RR+++ E++  ++ ++N
Sbjct: 556 IDPKYMDIDTGRRELDIELFKQELLEQN 583

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  273 bits (697), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 162/537 (30%), Positives = 274/537 (51%), Gaps = 18/537 (3%)

Query: 10  SFQVDSNDTPTTISTLDDDQ---EKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXX 66
           SF+    DT   +   D D    + QQ +K  +K RH++M                +   
Sbjct: 40  SFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALH 99

Query: 67  XXXXXXXXXXYLFMGTVVFSVTQSLGEM-CTFIPVTASFTVFAQRFLSPAFGAANGYMYW 125
                     Y+   T+++ V Q+  E+   +  +  ++  +    +   FG A   +Y 
Sbjct: 100 FGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYG 159

Query: 126 FSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVK 185
             WA    LEL      +++WT +V    +++I +V L   + F  R Y E EF   S+K
Sbjct: 160 LQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLK 219

Query: 186 VLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAA 245
           VL                   G +G +YW +PG +G      +    RF G  S  + AA
Sbjct: 220 VLLMAGFIIMAISLTAGASEQGYIGGQYWHDPGAFG-----GDRAIDRFKGICSVWVQAA 274

Query: 246 FTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSND 305
           F + G+E + +TA E   PR++VPKA K+ ++R++V ++  +++IG LVP+N  +L S +
Sbjct: 275 FAYGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAE 334

Query: 306 --SYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPK 363
             S   +SPF+I     G +++PHI N +IL ++IS GNS +Y   RIL  LA++   PK
Sbjct: 335 GGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPK 394

Query: 364 FFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHI 423
            FT   + G P VT++F S+FG +A++  +   +  FTWL  I G++  F W  I+ SH+
Sbjct: 395 IFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHV 454

Query: 424 RFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANF 478
           RF +A++ +G S  +L Y+A      +YYA+FF VI+++ Q + + AP     +  V  F
Sbjct: 455 RFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFF 514

Query: 479 FAAYISVFLFIIFWVAFQIWFK-CRLVWKLQDVDLDTDRRDIEEEV-WSDDVEDKNK 533
           F  Y++  + ++F++ +++W +  RLV    +VDL + R+  +EEV   ++ E K +
Sbjct: 515 FQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKER 571

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  272 bits (696), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 162/521 (31%), Positives = 270/521 (51%), Gaps = 17/521 (3%)

Query: 32  QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSL 91
           Q  ++R LK RH+ M                +             +  +G +++ V  S+
Sbjct: 74  QSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSM 133

Query: 92  GEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW-TMAV 150
           GE+    PV+  FT +A RF+  +FG A  Y Y   W +   LE+      + FW T   
Sbjct: 134 GELAVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPK 193

Query: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXXXXXXXXXXXXVTGPV 209
               ++++ ++++ I N F VR YGE EF  + +KV+                  V G +
Sbjct: 194 YRDGFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYI 253

Query: 210 GFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVP 269
           G +YW NPG +     S +   +RF G  S  + AAF+F GTELVG+ + E   PRK +P
Sbjct: 254 GGKYWHNPGAF-----SGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPRKALP 308

Query: 270 KAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY-VSSSPFIITIQNAGTKILPHI 328
           +A K+V +RIL+FYI SL +IGLLVP+   +L    S   ++SPF++ IQ  G K LP +
Sbjct: 309 RAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLAIQTHGIKGLPSV 368

Query: 329 FNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLA 388
            N VILI+++S GNS VY  SR +  LA+  + P  F    + G P V ++ T +FG L+
Sbjct: 369 INVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLS 428

Query: 389 YMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPW 448
           ++  +      F WLL + G++  F+W  I   HIRF +AL  +G S ++L + +     
Sbjct: 429 FIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIA 488

Query: 449 LAYYAVFFMVIIIVIQGFTSFAP---KFKVANFFAAYISVFLFIIFWVAFQIWFKC-RLV 504
            +Y+ V  ++++++ Q + +  P        +FF+AY+S  + + F++  +IW +  +L 
Sbjct: 489 GSYFGVILVLLVLIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFYIFHKIWKRNWKLF 548

Query: 505 WKLQDVDLDTDRRDIEEEVWSDDVEDKN-----KNWWDRFW 540
            + +D+D+DT RR+++ E    ++ ++      + WW R +
Sbjct: 549 TRAKDIDIDTGRREMDTEALRQEIAEEKMLLSTRPWWYRLY 589

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  271 bits (692), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 156/476 (32%), Positives = 252/476 (52%), Gaps = 18/476 (3%)

Query: 80  MGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVV 139
           + T +F++  SLGE+    PV   F V+  RF+ P+FG A  + Y   WA+   LEL   
Sbjct: 109 ISTCLFTIVNSLGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAA 168

Query: 140 GQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXXXXXX 198
              I++W  ++   AW+SI +V +  +N+  V+ +GE EF ++ VK+L            
Sbjct: 169 SITIRYWNKSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVL 228

Query: 199 XXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITA 258
                   G +G +YW +PG +       +    RF G  +  I AAF++ G ELVG++A
Sbjct: 229 ICGGGPSGGFIGGKYWNDPGAF-----VGDTPAQRFKGLSAVFITAAFSYSGLELVGVSA 283

Query: 259 GEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV--SSSPFIIT 316
            E + PR T+PKA K+  + I + Y+  L +IG LVP NDP L +  S V  ++SP +I 
Sbjct: 284 AESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPLVIA 343

Query: 317 IQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYV 376
           IQN G K LP + NA+ILI ++S  NS VY  SR +  +A+    P+   +  K G P  
Sbjct: 344 IQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLY 403

Query: 377 TVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISR 436
            +  T + G L+++  +   D+ FTWL  + G++  F W  I+ +H+RF  A+K +  S 
Sbjct: 404 AIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSL 463

Query: 437 NDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPK----FKVANFFAAYISVFLFIIFW 492
            +LPY +M   W ++Y    + ++++   +TS  P         +FF +Y+S+ +FI  +
Sbjct: 464 EELPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIACY 523

Query: 493 VAFQIWFK-CRLVWKLQDVDLDTDRRDIEEEVWSDDVED-----KNKNWWDRFWNY 542
           +  +IW +  RL  KL +VD+D+ R D +      + E      K K ++ R WN+
Sbjct: 524 LGHKIWKRNLRLYIKLSEVDVDSGRTDTDAATLKQEKEAEAELMKTKPFYIRLWNF 579

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  273 bits (697), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 158/534 (29%), Positives = 271/534 (50%), Gaps = 28/534 (5%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           + ++KQ+++K+ +K RH  M                +             Y  MG+ V+ 
Sbjct: 137 EQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYC 196

Query: 87  VTQSLGEMCT-FIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQF 145
           + Q+ GE+   +  +   F  +    + PA G +  +++   W     LEL      I++
Sbjct: 197 IIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKY 256

Query: 146 WTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXV 205
           WT+ V    ++ I +VL+ + N+F  + Y E +F+    K+L                  
Sbjct: 257 WTVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAG 316

Query: 206 T-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEP 264
           T G +G +YW++PG +       +    RF G V++ + AAF F  +E + +TA E   P
Sbjct: 317 TDGYIGSKYWRDPGAF-----RGDTPIQRFKGIVATFVTAAFAFGMSEQLAMTASEQSNP 371

Query: 265 RKTVPKAIKKVVFRILVFYIGSLLVIGLLVPY-NDPKLQSNDSYVSSSPFIITIQNAGTK 323
           RK +P A KK+++RIL  ++ SL ++G LVPY +D  L +  S   +SP++I + + G +
Sbjct: 372 RKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVR 431

Query: 324 ILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSM 383
           ++PH  NAVIL++++S  NS  Y  SRIL  LAK   APK F    + G P V +L +++
Sbjct: 432 VVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSAL 491

Query: 384 FGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKA 443
           FG +A+  ++   +  FTWLL I G++  F W+ I  SHIRF +A+K +G S  ++ YK+
Sbjct: 492 FGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKS 551

Query: 444 MLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISVFLFIIFWVAFQIW 498
            +  W + YAV  M++ ++ Q + + AP     K    +FF  Y+++ + I  ++ F++W
Sbjct: 552 QVGVWGSAYAVLMMMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYIFFKVW 611

Query: 499 FKCRLVWKL----QDVDLDTDRRDIEEEVWSDDVED-----KNKNWWDR---FW 540
              +  W L      VDL + R   +EE+   + E+     +N  +W R   FW
Sbjct: 612 ---KNDWSLFIPANKVDLVSHRNIFDEELLKQEDEEYKERLRNGPYWKRIVDFW 662

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  271 bits (693), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 164/533 (30%), Positives = 274/533 (51%), Gaps = 21/533 (3%)

Query: 22  ISTLDDDQEKQQDV---------KRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXX 72
           +  LD +  +Q+ +         K  LK RH+ M                          
Sbjct: 67  VPELDPNLTEQERIAIITAHTPLKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPAS 126

Query: 73  XXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTF 132
               +   G++++S+  ++ EM    P++  FT +A RF+  +FG AN + Y   W +  
Sbjct: 127 LIIGWSITGSMIYSMVMAVAEMAVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVL 186

Query: 133 ALELSVVGQIIQFWTMAVPLA-AWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX 191
            LE+      + +W         ++++ W+++ I NLF V+ YGE EF  +++KV+    
Sbjct: 187 PLEIVSASITVNYWGTPTKYRDGFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVG 246

Query: 192 XXXXXXXXXXXXXVTGPVGF-RYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQG 250
                         TG     +YW +PG + +G  +     A+F G+ S  + AAF+F G
Sbjct: 247 FIILGLVLVCGGGPTGGYVGAKYWHDPGAF-VGATAG----AQFQGFCSVFVTAAFSFSG 301

Query: 251 TELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL-QSNDSYVS 309
           +EL+GI   E + PRK VP A K+V +RIL+FYI SLL IGLLVP ND +L  S++   +
Sbjct: 302 SELIGIAGSEAENPRKAVPPAAKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAA 361

Query: 310 SSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTS 369
           +SPF+I I   G + LP + N VILI ++S GNS +Y  SR L  LA+    PK  +   
Sbjct: 362 ASPFVIAITVHGIRGLPSVINVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYID 421

Query: 370 KAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKAL 429
           ++G P V +  +S FG +A++  +      F WLL I G++ FF W  I   HIRF  AL
Sbjct: 422 RSGRPLVGIAISSFFGLVAFVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAAL 481

Query: 430 KQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP---KFKVANFFAAYISVF 486
           K +  S ++LP+ + L  + +Y+ +F +V+++  Q + +  P        NFF+AY+S+ 
Sbjct: 482 KAQNRSTDELPFVSPLGVFGSYWGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLP 541

Query: 487 LFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDR 538
           + ++ ++A ++W K  ++   L  +DLDT R+ ++ ++   +V ++      R
Sbjct: 542 VVLVMYIAHKLWTKNWKIFIPLGQLDLDTGRKQLDLDLLRQEVAEERATLAAR 594

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  271 bits (692), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 168/526 (31%), Positives = 272/526 (51%), Gaps = 23/526 (4%)

Query: 32  QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSL 91
           Q  +K  LK RH+ M                              +   GT+++++  +L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMAL 142

Query: 92  GEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW-TMAV 150
           GE+    P++  FT +A RF+  +FG AN + Y   W +   LE+      + FW T   
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXXXXXXXXXXXXVTGPV 209
               ++++ W+ + I N+F V+ YGE EF  + +KV+                    G +
Sbjct: 203 YRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYI 262

Query: 210 GFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVP 269
           G +YW +PG +     + +   A+F G  S  + AAF+F G+ELVG+ A E  EPRK+VP
Sbjct: 263 GGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVP 317

Query: 270 KAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY-VSSSPFIITIQNAGTKILPHI 328
           KA K+V +RI +FYI SLL+IGLLVPYND  L    S   ++SPF+I I+  G K LP +
Sbjct: 318 KAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASPFVIAIKTHGIKGLPSV 377

Query: 329 FNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLA 388
            N VILI ++S GNS +Y  SR +  LA+ +  P+ F+   + G P V +  TS FG +A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIA 437

Query: 389 YMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPW 448
           ++  +    + F WLL + G++  F W  I   HIRF KAL  +G   ++L +K+    W
Sbjct: 438 FVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVW 497

Query: 449 LAYYAVFFMVIIIVIQGFTSFAP---KFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVW 505
            +Y+ +F ++I+ + Q + +  P         FF AY+S  L ++ ++  +I+   +  W
Sbjct: 498 GSYWGLFMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIGHKIY---KRNW 554

Query: 506 KL----QDVDLDTDRRDIEEEVWSDDVEDKN-----KNWWDRFWNY 542
           KL    + +D+DT RR+++ ++   ++ ++      K  W R WN+
Sbjct: 555 KLFIPAEKMDIDTGRREVDLDLLKQEIAEEKAIMATKPRWYRIWNF 600

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  270 bits (691), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 153/476 (32%), Positives = 263/476 (55%), Gaps = 18/476 (3%)

Query: 77  YLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALEL 136
           ++ + T +F++  +LGE+ +  PV   F V+  RF+ P+FG A    Y   WA+   LEL
Sbjct: 114 WVIISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLEL 173

Query: 137 SVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXXX 195
                 I++W   +   AW++I + ++ ++NL  V+ +GE EF ++ VK+L         
Sbjct: 174 VAASLTIRYWNHTINSDAWVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFTILG 233

Query: 196 XXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVG 255
                      G +G +YW NPG + +G  + +    RF G  S  + AAF++ GTEL+ 
Sbjct: 234 IVLTCGGGPKGGYIGGKYWSNPGAF-VGHTAGD----RFHGLCSVFVTAAFSYSGTELIA 288

Query: 256 ITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV--SSSPF 313
           ++A E   PR T+PKA K+  + I V YI  L ++G LV  +DP+L +  S V  ++SP 
Sbjct: 289 VSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAASPL 348

Query: 314 IITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGV 373
           +I I+N G K LP + NA+ILI ++S  NS VY  SR +  +A+    PK FT   + G 
Sbjct: 349 VIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGR 408

Query: 374 PYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRG 433
           P   ++ T +FG L+++  +   ++ FTWL  + G++  F W  I+ SHIRF + +K+RG
Sbjct: 409 PLYAIVATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERG 468

Query: 434 ISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFI 489
            + ++LP+ +M   W +YY    + I++V+  +TS  P         +FF  Y+S  + +
Sbjct: 469 RTLDELPFVSMTGVWGSYYGCIVIFIVLVVCFWTSLFPGGGEGANAESFFETYLSFPILL 528

Query: 490 IFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDD--VED---KNKNWWDRF 539
             +   +++ +  RL+   +++DLD+ RR ++ E+  D+  +E+   + K+ + RF
Sbjct: 529 ACYFGHKLYTRSWRLLTPTKEIDLDSGRRAVDLELMKDEKRIEEQAMRQKSLFARF 584

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  270 bits (689), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 162/554 (29%), Positives = 276/554 (49%), Gaps = 29/554 (5%)

Query: 1   MKLNQPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXX 60
           +K + P V  F+ +  DT                + ++L  RH+                
Sbjct: 65  IKSDVPHVSDFENNVYDT-----------ANDSKLNKDLSVRHLLTLAVGGAIGTGLFVN 113

Query: 61  XXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAAN 120
                           ++ + T +F++  +LGE+    PV   F V+  RF+ P+FG A 
Sbjct: 114 SGASLNTGGPASLIVAWVIVSTCLFTIVNALGELAAVFPVVGGFNVYITRFVEPSFGFAV 173

Query: 121 GYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFW 180
              Y   WA+   LEL      I++W   +   AW++I +  + ++N+  V+ +GE EF 
Sbjct: 174 NINYLAQWAVLLPLELVAASITIRYWNNTINSDAWVAIFYTAIFLANMLDVKSFGETEFV 233

Query: 181 IASVKVLXXXXXXXXXXXXXXXXXVTGP-VGFRYWKNPGPWGMGIISSNVNEARFFGWVS 239
           ++ +K+L                  +G  +G RYW +PG +       +    RF G  +
Sbjct: 234 LSMIKILAIIGFTILGIVLACGGGPSGEYIGGRYWNDPGAF-----VGDTPGRRFKGVCA 288

Query: 240 SLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDP 299
             + AAF++ GTELV ++A E   PR T+PKA K+  + I + YI  L +IG LVPYND 
Sbjct: 289 VFVTAAFSYSGTELVAVSAAESHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDE 348

Query: 300 KLQSNDSYV--SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAK 357
           +L + +S V  ++SP +I I+N G K LP + NA+ILI I+S  NS VY  SR +  +A+
Sbjct: 349 RLLNGNSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAE 408

Query: 358 NKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLL 417
               PK      K G P   +  T +FG L+++  +   ++ FTWL  + G++  F W  
Sbjct: 409 IGNLPKRLNYIDKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFS 468

Query: 418 ISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KF 473
           I+ SHIRF +A+K +  S N+LP+ ++   + ++Y    + ++++   +TS  P      
Sbjct: 469 INLSHIRFRQAMKAQDRSLNELPFVSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSDGA 528

Query: 474 KVANFFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDV---- 528
              +FF  Y+S+ +FI+ ++  +++ K  RL  K +D+DLDT RR+I+ ++   ++    
Sbjct: 529 DAESFFEGYLSLPIFIVCYLGHKVYKKDWRLYVKTKDMDLDTGRREIDLDILKQEIRLER 588

Query: 529 -EDKNKNWWDRFWN 541
            +   K ++ RF N
Sbjct: 589 EQMAQKPFYIRFLN 602

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  269 bits (687), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 161/544 (29%), Positives = 272/544 (50%), Gaps = 29/544 (5%)

Query: 23  STLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGT 82
           S+ + + E    +K+ L  RH+                                Y+ + T
Sbjct: 46  SSSEVEAEGNGKLKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIIST 105

Query: 83  VVFSVTQSLGEMCTFIP-----VTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELS 137
           V++ +  +LGEM  ++P        S      R++  +   A G+ Y++ + +  A E +
Sbjct: 106 VIYPIMNALGEMVCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECT 165

Query: 138 VVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXX 197
               ++ +WT +VP A WI+I   ++T+ N   V+ +GE EFW AS+K+L          
Sbjct: 166 AASGVVTYWTTSVPTAVWITIFLGIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSF 225

Query: 198 XXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTF-QGTE 252
                    GP    +GF YWK+PG +   I   +     F    + +I  AF F  G E
Sbjct: 226 ILFWGG---GPSHVRLGFHYWKDPGTFAHHITGGS--WGSFLDIYTGIIKGAFAFILGPE 280

Query: 253 LVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDP----KLQSNDSYV 308
           LV +T+ E  + R+ + KA K+ ++R++ FYI   L I ++V YNDP     L+      
Sbjct: 281 LVALTSSECNDQRRNIAKASKRFIWRLMFFYILGTLSISVIVAYNDPVLLNALEEGKEGA 340

Query: 309 SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNT 368
           +SSPF+I IQNAG K+LPHI NA IL +  SAGNS ++  SR L  +A N +APK F   
Sbjct: 341 ASSPFVIGIQNAGIKVLPHIINACILSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKV 400

Query: 369 SKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKA 428
           ++ GVPY +V  ++M   LA++  ++   + F W  NI  ++GF  W+    +++RF KA
Sbjct: 401 NRFGVPYYSVGLSAMLSCLAFLNVSSSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKA 460

Query: 429 LKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKF-KVANFFAAYISVFL 487
           +    +  + LP+K    P+L +Y++  + +I +  G+ +F P+F   ++F AAYI++ L
Sbjct: 461 IFYNNM-YDRLPFKTFGQPYLIWYSLLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPL 519

Query: 488 FIIFWVAFQIWFK-------CRLVWKLQDVDLDTDRRDIEEEVWSDDVED-KNKNWWDRF 539
           F+I WV  + W +        +L + + ++D+ T   + EE     D+       +W +F
Sbjct: 520 FLILWVGHKFWARYKHAVPLLKLYYPVDEIDVITGLAEAEEVAEKLDMNRIPPSTYWGKF 579

Query: 540 WNYV 543
            N++
Sbjct: 580 INWL 583

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  270 bits (691), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 155/533 (29%), Positives = 270/533 (50%), Gaps = 25/533 (4%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           + ++KQ+++K+ +K RH  M                +             Y  MG+ V+ 
Sbjct: 137 EQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYC 196

Query: 87  VTQSLGEMCT-FIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQF 145
           + Q+ GE+   +  +   F  +    + PA G +  +++   W     LEL      I++
Sbjct: 197 IIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKY 256

Query: 146 WTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXV 205
           WT +V    ++ I +VL+ + N+F  + Y E +F+    K+L                  
Sbjct: 257 WTTSVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAG 316

Query: 206 T-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEP 264
           T G +G +YW++PG +       +    RF G V++ + AAF F  +E + +TA E   P
Sbjct: 317 TDGYIGSKYWRDPGAF-----RGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNP 371

Query: 265 RKTVPKAIKKVVFRILVFYIGSLLVIGLLVPY-NDPKLQSNDSYVSSSPFIITIQNAGTK 323
           RK +P A KK+++RIL  ++ SL ++G LVPY +D  L +  S   +SP++I + + G +
Sbjct: 372 RKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVR 431

Query: 324 ILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSM 383
           ++PH  NAVIL++++S  N   Y  SRIL  LAK   APK F    + G P   +L +++
Sbjct: 432 VVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSAL 491

Query: 384 FGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKA 443
           FG +A+  ++   +  FTWLL I G++  F W+ I  SHIRF +A+K +G S  ++ YK+
Sbjct: 492 FGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKS 551

Query: 444 MLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISVFLFIIFWVAFQIW 498
            +  W + YAV  MV+ ++ Q + + AP     K    +FF  Y+++ ++I  ++ +++W
Sbjct: 552 QVGVWGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVW 611

Query: 499 FKCRLVWKL----QDVDLDTDRRDIEEEVWSDDVED-----KNKNWWDRFWNY 542
            K    W L      VDL + R   +EE+   + E+     +N  +W R  ++
Sbjct: 612 KK---DWSLFIPADKVDLVSHRNIFDEELLKQEDEEYKERLRNGPYWKRVLDF 661

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  268 bits (686), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 165/557 (29%), Positives = 287/557 (51%), Gaps = 38/557 (6%)

Query: 9   HSFQVDSNDTPTTISTLDDDQEKQQD----VKRELKKRHISMXXXXXXXXXXXXXXXXRX 64
           H   +D ++T    S+LD+++++Q +    +K+ LK RH+ +                + 
Sbjct: 44  HKETIDYSET----SSLDEEKQQQPEENGKLKQGLKSRHVQLIALGGTIGTGLLVGSSQT 99

Query: 65  XXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTV-----FAQRFLSPAFGAA 119
                       YL + T ++ +  + GEM  ++P   S +        ++++  + G A
Sbjct: 100 LATCGPAGLFTSYLIICTFIYPIMNAFGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFA 159

Query: 120 NGYMYWFSWAMTFALELSVVGQIIQFWT--MAVPLAAWISIVWVLLTISNLFPVRIYGEI 177
           + + Y++ + +  A E +    ++++W   + VP  AWI+I    +   N+ PV  YGE 
Sbjct: 160 SSWNYYYCFVILVATECTAAAGVVEYWAWALKVPKGAWITIFLFCVVALNMLPVNFYGES 219

Query: 178 EFWIASVKVLXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEAR 233
           EFW AS+K+L                   GP    +GFRYW+ PG +   I  ++     
Sbjct: 220 EFWFASIKILCILGLIILSFILFWG---GGPSHDRLGFRYWQRPGAFADHI--TDGTGGN 274

Query: 234 FFGWVSSLINAAFTF-QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGL 292
           F    + +I   F F  G ELV +T+ E  + R+ + KA ++ V+R+++FY+   L I +
Sbjct: 275 FLDVYTGVIKGGFAFVLGPELVSLTSSECHDQRRNIAKASRRFVWRLMIFYVLGSLSISV 334

Query: 293 LVPYNDPKLQS----NDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIG 348
           +V YNDP LQ+    +     SSPF+I IQNAG K+LPHI N  I+ +  SAGN+ ++  
Sbjct: 335 IVAYNDPNLQNALAQSKPGAGSSPFVIGIQNAGIKVLPHIINVCIMTSAWSAGNAYMFAS 394

Query: 349 SRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVG 408
           SR L  +A +  APKFF+  ++ GVPYV V F+ +F  LAY+  ++     F W  NI  
Sbjct: 395 SRSLLTMASHGHAPKFFSKINRFGVPYVAVGFSFLFCCLAYLNVSSSTANVFNWFSNIST 454

Query: 409 VAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTS 468
           ++GF  W+    ++IRF KA+    +  + LPYK     +L +Y++F + +I +  G+  
Sbjct: 455 ISGFIGWICACVAYIRFRKAIIFNDL-YDRLPYKGFAQKYLIWYSLFMVSLITLTNGYQI 513

Query: 469 FAPKF-KVANFFAAYISVFLFIIFWVAFQIWFKCRLVW--KLQDVDLDTDRRDIEEEVWS 525
           F P+F    +F AAYI++ +FI+ W+  ++  +    W   +  +D+ T   +IEE   +
Sbjct: 514 FIPRFWDYKDFIAAYITLPVFIVLWIGHKLVTRSWRQWYIPVDKIDVFTGLEEIEE--LT 571

Query: 526 DDVEDKN---KNWWDRF 539
           +++++K     N WD+F
Sbjct: 572 NELDEKRVPPNNAWDKF 588

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  270 bits (689), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 161/529 (30%), Positives = 272/529 (51%), Gaps = 18/529 (3%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           + + K++ +K+ +K RH+ M                +             Y  MG+ ++ 
Sbjct: 117 EGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIYC 176

Query: 87  VTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQF 145
           + Q+ GEM  T+  +   F  +    +SP  G A  ++YW  WA    LEL      I++
Sbjct: 177 IIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIKY 236

Query: 146 WTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXV 205
           WT  V    ++ I + L+ + N+F  R Y E EF+    KVL                  
Sbjct: 237 WTTKVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCGGAG 296

Query: 206 T-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEP 264
             G +G +YW +PG +       +    RF G  ++L+ AAF F G+E + +TA E   P
Sbjct: 297 NDGYIGGKYWHDPGAF-----RGDKAIDRFKGVAATLVTAAFAFGGSEFIALTASEQSNP 351

Query: 265 RKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDS-YVSSSPFIITIQNAGTK 323
           RK +P A KK+++RI++ ++GS++++G LVP+N  +L  +DS    +SP++I I + G +
Sbjct: 352 RKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVIAISSHGVR 411

Query: 324 ILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSM 383
           ++PH  NAVIL++++S GNS  Y  SRIL  L++   APKFF    + G P   ++  ++
Sbjct: 412 VVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMVIGAL 471

Query: 384 FGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKA 443
           F  +A+   ++  +  FTWLL I G++  F W  I  SHIRF +A+  +G S  ++ +K+
Sbjct: 472 FAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFKS 531

Query: 444 MLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWF 499
            L  W +YYA   M ++++ Q +   AP    K    +FF +Y+++ + I F+V +  W 
Sbjct: 532 ELGVWGSYYAAGMMFLVLIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGYMFWK 591

Query: 500 KC-RLVWKLQDVDLDTDRRDIEEEVWSDDVED-----KNKNWWDRFWNY 542
           K   L  + +D+DLD  R+  +E+V   + E+     +N   W R  N+
Sbjct: 592 KDWTLFIRAKDIDLDHHRQIFDEDVLRQEDEETKEKLRNGPLWKRILNF 640

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  268 bits (684), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 149/466 (31%), Positives = 255/466 (54%), Gaps = 13/466 (2%)

Query: 77  YLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALEL 136
           ++ + T +F+V  +LGEM    PV   F V+  RF+ P+ G A    Y   W +   LEL
Sbjct: 112 WVIISTCLFTVINALGEMAAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLEL 171

Query: 137 SVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXXX 195
                 I++W   +   AW++I + ++  +N+  V+ +GE EF ++ VK+L         
Sbjct: 172 VAASMTIKYWNDTINSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILG 231

Query: 196 XXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVG 255
                      G +G +YW NPG +       + +  +F G  S  + AAF++ G E+  
Sbjct: 232 IVLSCGGGPQGGYLGGKYWHNPGSF-----VGHTSGTKFKGLCSVFVTAAFSYSGIEMTA 286

Query: 256 ITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV--SSSPF 313
           ++A E ++PR+T+PKA K+  + I   YI  L +IG LVPY++P+L S  S V  +SSP 
Sbjct: 287 VSAAESKDPRRTIPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPL 346

Query: 314 IITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGV 373
           +I I+N G K LP + NA+ILI+IIS  NS VY  SR +  +A     P+   +  K G 
Sbjct: 347 VIAIENGGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGR 406

Query: 374 PYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRG 433
           P   +LFT  FG L+++  +    + FTWL  + G++  F W+ I+ SHIRF +A+K++ 
Sbjct: 407 PVNAILFTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQR 466

Query: 434 ISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFI 489
            S ++LPY +    W ++Y V  + +++++  +TS  P         +FF  Y+S  + I
Sbjct: 467 KSLDELPYLSQTGVWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILI 526

Query: 490 IFWVAFQ-IWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKN 534
             +V  + ++ K ++V  L+D+D+DT RR ++  +   +++++ ++
Sbjct: 527 ACYVGHKLVYRKKQIVVALEDMDIDTGRRQVDLTIRRQEMKEEQEH 572

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  269 bits (687), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 160/536 (29%), Positives = 273/536 (50%), Gaps = 30/536 (5%)

Query: 12  QVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXX 71
            VD   +P+    +D D E  + +K+ L+ RH+ +                         
Sbjct: 88  DVDLEKSPS----VDGDSEPHK-LKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPA 142

Query: 72  XXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTV-----FAQRFLSPAFGAANGYMYWF 126
                Y+ +  V++ +  +LGEM  F+P   S +         R++ P+ G A G+ Y++
Sbjct: 143 GLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFY 202

Query: 127 SWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKV 186
            + +  A E +    ++++WT AVP   WI+I   ++ I N   V++YGE EFW AS+K+
Sbjct: 203 CYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKI 262

Query: 187 LXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLI 242
           L                   GP    +GFRYW++PG +   +   ++    F    + +I
Sbjct: 263 LCIVGLIILSFILFWGG---GPNHDRLGFRYWQHPGAFAHHLTGGSL--GNFTDIYTGII 317

Query: 243 NAAFTF-QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDP-- 299
             AF F  G ELV +T+ E  + R+ + KA ++ V+R++ FY+   L I ++VPYNDP  
Sbjct: 318 KGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTL 377

Query: 300 --KLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAK 357
              L        SSPF+I IQNAG K+LPHI N  IL +  SA N+ ++  +R L  +A+
Sbjct: 378 VNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQ 437

Query: 358 NKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLL 417
              APK     +K GVPYV V  + +   LAY+  ++     F W  NI  ++GF  W+ 
Sbjct: 438 TGQAPKCLGRINKWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMC 497

Query: 418 ISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKF-KVA 476
              +++RF KA+   G+  + LP+K    P+  ++++  + II +  G+  F PK+ +VA
Sbjct: 498 GCIAYLRFRKAIFYNGL-YDRLPFKTWGQPYTVWFSLIVIGIITITNGYAIFIPKYWRVA 556

Query: 477 NFFAAYISVFLFIIFWVAFQIWFKCRLVW--KLQDVDLDTDRRDIEEEVWSDDVED 530
           +F AAYI++ +F++ W   +++ +    W   + ++D+ T   +IEE+  S ++E+
Sbjct: 557 DFIAAYITLPIFLVLWFGHKLYTRTWRQWWLPVSEIDVTTGLVEIEEK--SREIEE 610

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  269 bits (687), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 164/535 (30%), Positives = 273/535 (51%), Gaps = 30/535 (5%)

Query: 12  QVDSNDTPTTIST-LDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXX 70
           Q+  N   T IS  L ++  ++  +K+ L  RHI +                        
Sbjct: 78  QIGYNGNETIISEELINEDGRKNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGP 137

Query: 71  XXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTV-----FAQRFLSPAFGAANGYMYW 125
                 YL + T+V+ +   LGEM  ++P   S +        +R+L  +   A G+ Y+
Sbjct: 138 AGLVASYLIISTMVYPIMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYY 197

Query: 126 FSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVK 185
           + + M  A E +    ++++WT  VP  AWI +  +++   N+ PVR+YGE EFW A  K
Sbjct: 198 YCFVMLVAAECTAASGVVEYWTKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISK 257

Query: 186 VLXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSL 241
           +L                   GP    +GFRYW  PG +   I  +N +   F      +
Sbjct: 258 ILCIVGLIILSFILFWG---GGPNHDRLGFRYWITPGSFANTI--TNGSFGNFLDVYKGI 312

Query: 242 INAAFTF-QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPK 300
           I  AF+F  G ELV + + E  +PR+ + KA K+ ++R++ FYI   L I ++V YNDP 
Sbjct: 313 ILGAFSFILGPELVVLPSSECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPI 372

Query: 301 LQS----NDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLA 356
           L +    +     SSPF+I IQNAG  +LPHI N  ILI+  S+GN+ ++  SR L  +A
Sbjct: 373 LSTALIQDKPGAGSSPFVIGIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMA 432

Query: 357 KNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWL 416
            N  APK     ++ GVPYV V+ + +   +AY+  +      F W  N+  ++GF  W+
Sbjct: 433 INSQAPKCLGKINRFGVPYVAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWI 492

Query: 417 LISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPK-FKV 475
           ++S +++RF KA++  G+ ++ LPY     P+L  Y++   +II +  GF    P+ + V
Sbjct: 493 IVSVTYLRFRKAIEYHGM-KDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNV 551

Query: 476 ANFFAAYISVFLFIIFWVAFQIW---FK-----CRLVWKLQDVDLDTDRRDIEEE 522
           ++F AAY+++ +F++ W+  + +   FK     CR  ++++D+D+ T   +IE E
Sbjct: 552 SDFIAAYLTLPIFLMIWIGHKFYKYRFKIFTRQCRWWYQVEDIDVITGLEEIEME 606

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  268 bits (684), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 165/554 (29%), Positives = 280/554 (50%), Gaps = 24/554 (4%)

Query: 8   VHSFQVDSNDTPTTISTLD----DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXR 63
            +SF+  ++DT      L+    +        K+ +K RH+ M                +
Sbjct: 51  CNSFKRANSDTFDASQDLEGASINSVRSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGK 110

Query: 64  XXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGY 122
                        Y  +  V + + Q+ GEM    P +  +F V++  F+S +FG A  +
Sbjct: 111 SLHFGGPAGLLIGYSLVSVVAYIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVW 170

Query: 123 MYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIA 182
           +Y   W     LEL      I++W  ++   A+I+I + ++   + F    YGE EF  +
Sbjct: 171 LYCLQWLTVLPLELITASLTIKYWNSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFS 230

Query: 183 SVKV-LXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSL 241
           + KV +                   G +G  YW+NPG +  G   S +   +   +V  L
Sbjct: 231 TCKVSMIAGFIILSIVINCGGAGTGGYIGGEYWRNPGAFAGG---SPIGHFKGIAYV--L 285

Query: 242 INAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL 301
           + A F++ G EL  +T  E   PRK VP A KK ++RIL+ Y+ ++++IG LVPYN  +L
Sbjct: 286 VTAYFSYGGMELFALTVNEQANPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDEL 345

Query: 302 --QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNK 359
              S  S   +SP++I + + G K++PHI NAVILI+++S GNS +Y   R+L  LA+  
Sbjct: 346 MGSSGKSATHASPYVIAVASHGVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQG 405

Query: 360 AAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLIS 419
            APK F+   +AG P V ++  S+FG L+++  +   ++ FTWL  I G++  F W  I 
Sbjct: 406 YAPKIFSYVDRAGRPLVALVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAIC 465

Query: 420 CSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFK 474
            SH+RF  A+K +G S ++L YK+    W + YA+FF +I+ V Q + + AP     K  
Sbjct: 466 LSHVRFRDAMKYQGYSLSELGYKSKTGYWGSIYAIFFNIIVFVAQFWVALAPIGNGGKAD 525

Query: 475 VANFFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVED--- 530
              FF +Y++  ++I  +V ++I+ K  +L+  L ++DL++ R   ++ +   + ++   
Sbjct: 526 AEAFFQSYLAFPIWISCYVGYKIYSKEWKLLVPLDEIDLNSHRHIFDKHILQQEDDEHKE 585

Query: 531 --KNKNWWDRFWNY 542
             KN  WW +  N+
Sbjct: 586 KLKNSGWWVKMANF 599

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  268 bits (686), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 158/545 (28%), Positives = 274/545 (50%), Gaps = 23/545 (4%)

Query: 12  QVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXX 71
           +++ N++   I     +  K   +K+ ++ RH+ M                         
Sbjct: 95  ELEKNESSDNIGARTGN--KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPA 152

Query: 72  XXXXXYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAM 130
                Y  MG++++ + Q+ GEM   +  +T  +  +    +   FG A  ++Y   W  
Sbjct: 153 GLLIGYGIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLC 212

Query: 131 TFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXX 190
              LEL      I++WT +V    ++ I +VL+   N+F  R Y E EF+    K+L   
Sbjct: 213 VCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMT 272

Query: 191 XXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQ 249
                            G +G +YW +PG +     +   +  RF G V++L+ AAF F 
Sbjct: 273 GFFILGIIIDVGGAGNDGFIGGKYWHDPGAF-----NGKHSIDRFKGVVATLVTAAFAFG 327

Query: 250 GTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL-QSNDSYV 308
           G+E + IT  E   PRK VP A K++++RIL  ++ +++++G LVPYN  +L  S+    
Sbjct: 328 GSEFIAITTAEQANPRKAVPGAAKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGT 387

Query: 309 SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNT 368
            +SP++I + + G +++PH  NAVIL++++S  NS+ Y  +RIL  L++   AP+ FT  
Sbjct: 388 KASPYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYI 447

Query: 369 SKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKA 428
            KAG P + +  +++FG +A+   +   D+ FTWLL I G++  F W  I  SHIRF +A
Sbjct: 448 DKAGRPLIAMGVSALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRA 507

Query: 429 LKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYIS 484
           +K +G S  +L +++    W + YA   M++I++ Q + + AP    K     FF  Y++
Sbjct: 508 MKVQGRSLGELGFRSQTGVWGSTYACIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLA 567

Query: 485 VFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVED-----KNKNWWDR 538
           + + I  +V ++IW K  +L  +   +DL + R+  +EE+   + E+     KN   W R
Sbjct: 568 MPILIALYVGYKIWKKDWKLFIRADKIDLISHRQIFDEELIKQEDEEFRERLKNGPCWKR 627

Query: 539 ---FW 540
              FW
Sbjct: 628 VVAFW 632

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  269 bits (687), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 154/533 (28%), Positives = 270/533 (50%), Gaps = 25/533 (4%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           + + KQ+++K+ +K RH  M                +             Y  MG+ V+ 
Sbjct: 137 EQEPKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYC 196

Query: 87  VTQSLGEMCT-FIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQF 145
           + Q+ GE+   +  +   F  +    + PA G +  +++   W     LEL      I++
Sbjct: 197 IIQACGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKY 256

Query: 146 WTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXV 205
           WT+ V    ++ I +VL+ + N+F  + Y E +F+    K+L                  
Sbjct: 257 WTVKVNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAG 316

Query: 206 T-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEP 264
           T G +G RYW++PG +       + +  RF G V++ + AAF F  +E + +TA E   P
Sbjct: 317 TDGYIGSRYWRDPGAF-----RGDTSIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNP 371

Query: 265 RKTVPKAIKKVVFRILVFYIGSLLVIGLLVPY-NDPKLQSNDSYVSSSPFIITIQNAGTK 323
           RK +P A KK+++RIL  ++ SL ++G LVPY +D  L +  S   +SP++I + + G +
Sbjct: 372 RKAIPSAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVR 431

Query: 324 ILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSM 383
           ++PH  NAVIL++++S  NS  Y  SRIL  LAK   APK F    + G P V ++ +++
Sbjct: 432 VVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAV 491

Query: 384 FGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKA 443
           FG +A+  ++   +  FTWLL I G++  F W+ I  SHIRF K +K +G S  ++ YK+
Sbjct: 492 FGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKS 551

Query: 444 MLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISVFLFIIFWVAFQIW 498
            +  W + YAV  MV+ ++ Q + + +P     K    +FF  Y+++ + I  ++ +++W
Sbjct: 552 QVGVWGSAYAVVLMVLALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYKVW 611

Query: 499 FKCRLVWKL----QDVDLDTDRRDIEEEVWSDDVED-----KNKNWWDRFWNY 542
              +  W L      +DL + R   +EE+   + E+     +N  +W R  ++
Sbjct: 612 ---KRDWSLFIPADKIDLVSHRNIFDEELLKQEDEEYKDRLRNGPFWKRVLDF 661

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  268 bits (684), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 160/556 (28%), Positives = 273/556 (49%), Gaps = 27/556 (4%)

Query: 9   HSFQVDSNDTPTTISTLDD--------DQEKQQDVKRELKKRHISMXXXXXXXXXXXXXX 60
           H  + D N   +  S  DD        D E  + +K+ ++ RH+ M              
Sbjct: 65  HHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSLGTGIGTGLLVG 124

Query: 61  XXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAA 119
                           Y  M + ++ + Q++GEM   ++ +   F  +    + PA   +
Sbjct: 125 NGTTLAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFS 184

Query: 120 NGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFP-VRIYGEIE 178
             ++Y   W     LEL      IQ+WT  V    ++ I ++L+   N+F   R Y E E
Sbjct: 185 IAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETE 244

Query: 179 FWIASVKVLXXXXXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGW 237
           F   S K+L                    G +G +YW++PG +       +    RF G 
Sbjct: 245 FICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFKGV 299

Query: 238 VSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN 297
           VS+L+ AAF+F  TE + ITA E   PRK +P A KKV++R L+ Y+ S++++GLLVPY+
Sbjct: 300 VSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYD 359

Query: 298 DPKL-QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLA 356
             +L  S+ +   +SP+++ +   G +++PH  NAVILI++ S  +S  Y  SR+L  LA
Sbjct: 360 SSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLA 419

Query: 357 KNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWL 416
           +   APK FT   + G P +  L  ++   +A+   ++   + F WLL I G++  F W 
Sbjct: 420 RQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWA 479

Query: 417 LISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----K 472
           LI  SHIRF +A+K +G S +++ YK+ +  W + YA   M++I++ Q +    P     
Sbjct: 480 LICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGS 539

Query: 473 FKVANFFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVED- 530
             V  FF  Y+++ +FI+ ++ ++IW +  RL  + +D+DL + R   + E+   + E+ 
Sbjct: 540 ADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEY 599

Query: 531 ----KNKNWWDRFWNY 542
               +N   W R +++
Sbjct: 600 QEKLRNGPVWRRVYDF 615

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  267 bits (682), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 167/565 (29%), Positives = 279/565 (49%), Gaps = 33/565 (5%)

Query: 1   MKLNQPQVHSFQ----------VDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXX 50
           + +N P    FQ          ++  D   T +           +KR LK RH+ M    
Sbjct: 45  VHVNDPNKSRFQNFVDGFRELRMEDVDPNLTAAERAAIATASSPLKRHLKNRHLQMIAIG 104

Query: 51  XXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQR 110
                       +             ++  G++V+SV Q+LGE+   +PV+ S+  +  R
Sbjct: 105 GSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGELAVALPVSGSYLSYVSR 164

Query: 111 FLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLA-AWISIVWVLLTISNLF 169
           F+ P+FG A  Y Y     +T  LEL      + +W +    A A++++ ++++   NLF
Sbjct: 165 FIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKYADAFVALFYIVIVGINLF 224

Query: 170 PVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVT--GPVGFRYWKNPGPWGMGIISS 227
            V+ YGE EF  + +KV                   +  G +G RYW NPG +  G    
Sbjct: 225 GVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIGARYWYNPGGFAHG---- 280

Query: 228 NVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSL 287
                 F G+ +  + +AF+F G+E+  + A E + PRK +P+A K+V +RI +FY+ SL
Sbjct: 281 ------FKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDLPRAAKQVFWRITLFYVISL 334

Query: 288 LVIGLLVPYNDPKL-QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVY 346
            +IG LVPY D  L  ++    S+SPF+I I  AG K LP + N VILI ++S GN  VY
Sbjct: 335 TLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKGLPSVVNVVILIAVLSVGNCCVY 394

Query: 347 IGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNI 406
             SR +  LA     P+ F    + G P V +L  ++FG L+++  ++   + F W+L I
Sbjct: 395 AASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLLSFLSASSNYGEVFDWMLAI 454

Query: 407 VGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGF 466
            G+  FF W  I   H+RF +AL  +G S ++L YKA    W + Y +  + I++  Q +
Sbjct: 455 SGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGIWGSLYGIGLIFIVLCFQFW 514

Query: 467 TSFAPKFKVAN---FFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEE 522
            +  P     N   FF+AY+S+ + I F+   +++ +    + K  D+D+DT RR+++ E
Sbjct: 515 VALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTRSWTFLIKSSDIDIDTGRREMDLE 574

Query: 523 VWSDDVED-----KNKNWWDRFWNY 542
           +   ++++     ++K  W R + +
Sbjct: 575 LLKQEIQEEQQYIRSKPIWYRIYRF 599

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  266 bits (681), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 161/553 (29%), Positives = 273/553 (49%), Gaps = 23/553 (4%)

Query: 2   KLNQPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXX 61
           K  +PQ  + + +  +        +D    Q+ +K+ +K RHI+M               
Sbjct: 43  KRAEPQGQTIREEKLENGLETVRTNDYNATQKKMKQTMKSRHITMISLGTGIGTGLLVAN 102

Query: 62  XRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEM-CTFIPVTASFTVFAQRFLSPAFGAAN 120
            +             Y+   T+++ V Q+  E+  ++  +  ++  +    +   F  A 
Sbjct: 103 GKALHFGGPGGLVIGYVTTSTMLYCVIQACCELGVSYATLPGNYNSYPSFLVDSGFNFAV 162

Query: 121 GYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFW 180
            ++Y   WA+   LEL      I++W  ++    +++I +  +   + F  + Y E EF 
Sbjct: 163 AWVYGLQWAIVLPLELVTSSMTIKYWNDSINPDVFVAIFYCFIVFIHFFGSQGYAESEFI 222

Query: 181 IASVKVLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPW-GMGIISSNVNEARFFGWVS 239
             S KVL                  +G +G +YW  PG + G   I        F G  S
Sbjct: 223 FNSCKVLMMVGFIIMGISVNCGASKSGYIGGKYWHTPGAFVGEKAID------HFKGICS 276

Query: 240 SLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDP 299
             + +AF + G+E + +TA E   PRK+VPKA K+ ++R+L+ ++  ++++G LVPY+ P
Sbjct: 277 VWVQSAFAYGGSEFIALTAAEQTNPRKSVPKATKRWLYRVLIVFLTPIILVGFLVPYDSP 336

Query: 300 KLQSNDSYVSS--SPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAK 357
            L  +    +S  SPF+I   + G K++PHI NAVILI++IS GNS  Y   RIL  LA+
Sbjct: 337 LLLGSPGQAASHASPFVIAAASHGVKVVPHIINAVILISVISVGNSAFYSAPRILLSLAE 396

Query: 358 NKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLL 417
               PK FT   + G P VT+LF ++FG ++++  +   +  FTWL  IV ++  F W  
Sbjct: 397 QGMGPKVFTYVDRKGRPLVTMLFVAIFGLISFVAASDNEETVFTWLSAIVSLSQLFTWSA 456

Query: 418 ISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----K 472
           IS SHIRF  A+K +G S  +L YKA    W ++YA+ F +I++  Q + + AP     K
Sbjct: 457 ISLSHIRFRDAMKTQGRSLGELGYKANTGYWGSWYAIAFNIIVLAAQFWVAIAPIGNGGK 516

Query: 473 FKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKL----QDVDLDTDRRDIEEE-VWSDD 527
             V NFF  Y++  + + F+  +++W++    WKL      VDL++ R+  + + +  +D
Sbjct: 517 LDVNNFFQNYLAFPVLVFFYFGYKLWYR---DWKLFIPADKVDLESHRKIFDADLIKQED 573

Query: 528 VEDKNKNWWDRFW 540
            E K +     FW
Sbjct: 574 FEHKERIRNSSFW 586

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  267 bits (683), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 153/547 (27%), Positives = 272/547 (49%), Gaps = 27/547 (4%)

Query: 12  QVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXX 71
           +++ N++   I    +   K   +K+ ++ RH+ M                         
Sbjct: 95  ELEKNESSDNIGA--NTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPA 152

Query: 72  XXXXXYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAM 130
                Y  MG++++ + Q+ GEM   +  +T  +  +    +   FG A  ++Y   W  
Sbjct: 153 GLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLC 212

Query: 131 TFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXX 190
              LEL      I++WT +V    ++ I +VL+   N+F  R Y E EF+    K+L   
Sbjct: 213 VCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMT 272

Query: 191 XXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEA--RFFGWVSSLINAAFT 247
                            G +G +YW +PG +       N   A  RF G  ++L+ AAF 
Sbjct: 273 GFFILGIIIDVGGAGNDGFIGGKYWHDPGAF-------NGKHAIDRFKGVAATLVTAAFA 325

Query: 248 FQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN-DPKLQSNDS 306
           F G+E + IT  E   PRK +P A K++++RIL  ++ +++++G LVPYN D  L S   
Sbjct: 326 FGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGG 385

Query: 307 YVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFT 366
              +SP++I + + G +++PH  NAVIL++++S  NS+ Y  +R+   L++   APK F+
Sbjct: 386 GTKASPYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFS 445

Query: 367 NTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFM 426
              +AG P + +  +++F  +A+   +   ++ FTWLL I G++  F W  I  SH+RF 
Sbjct: 446 YIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFR 505

Query: 427 KALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAY 482
           +A+K +G S  +L +K+    W + YA   M++I++ Q + + AP    K     FF  Y
Sbjct: 506 RAMKVQGRSLGELGFKSQTGVWGSAYACIMMILILIAQFWVAIAPIGEGKLDAQAFFENY 565

Query: 483 ISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVED-----KNKNWW 536
           +++ + I  +V +++W K  +L  +   +DLD+ R+  +EE+   + E+     +N  +W
Sbjct: 566 LAMPILIALYVGYKVWHKDWKLFIRADKIDLDSHRQIFDEELIKQEDEEYRERLRNGPYW 625

Query: 537 DR---FW 540
            R   FW
Sbjct: 626 KRVVAFW 632

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  265 bits (677), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 170/543 (31%), Positives = 284/543 (52%), Gaps = 25/543 (4%)

Query: 5   QPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRX 64
            P+ +    + + + TT    D +   ++D+ R LK R ++M                + 
Sbjct: 20  SPKENHVVCELDPSFTTDENYDPEANIREDLTRALKPRVVNMISIAGIIGTGLYLSTSKS 79

Query: 65  XXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMY 124
                       Y  MG VV+    +LGEM T++P++ SF V+A++F S +F  A  + Y
Sbjct: 80  LHTGGPASLFMNYTIMGGVVYLTLLALGEMSTYMPISGSFCVYARKFGSESFACALMWNY 139

Query: 125 WFSWAMTFALELSVVGQIIQFWTMA---VPLAAWISIVWVLLTISNLFPVRIYGEIEFWI 181
           WF+ A++ A +L+ +  ++ +W  +    P  A   I W ++   N+  VR YGE E+W+
Sbjct: 140 WFNDAVSVASDLTALQLVMDYWKTSEHGFPYWAASLIFWFVVVCLNVIHVRFYGEAEYWL 199

Query: 182 ASVKVLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFF----GW 237
           A +K++                 +   VG    KNP    +G  +    EA F     G+
Sbjct: 200 AMLKIIAIIIFFILS--------IVVNVG----KNPQHEYIGFKNWTRGEAPFVDGIKGF 247

Query: 238 VSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN 297
            S  ++A+F + GTE + +T GE + P +  PK +K V +RIL+FY+GS   I + +PY+
Sbjct: 248 ASLFVSASFAYGGTESITLTNGEAENPIRNTPKIVKTVFWRILIFYVGSTFFIAMNIPYD 307

Query: 298 DPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAK 357
            P L S    + +SPF +  Q AGTK      NAVI+ ++ISA N  ++ GSRI+Y +  
Sbjct: 308 YPGLDSKS--IVTSPFTLVFQMAGTKGAGSFMNAVIMTSVISACNHALFAGSRIMYNMGL 365

Query: 358 NKAAP-KFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWL 416
               P +  + T++  VPYV+VL T+  G+L +  +  G    +TWL NIVGV+   AWL
Sbjct: 366 EGFLPARIVSRTNRNKVPYVSVLITAAVGALCFGASFIGAGTLWTWLQNIVGVSNQIAWL 425

Query: 417 LISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVA 476
            I  + IRF K L+++G   ++L YK    P+  Y+ + F+  II+IQG+++FAP + V+
Sbjct: 426 CIGITSIRFRKGLEKQG-KTHELIYKNWTYPYGPYFVIIFVSFIILIQGWSAFAP-WNVS 483

Query: 477 NFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWW 536
           NFF+ Y+ +F+F + ++ + +  + R V K +D+D  TDR    +E+   +    N   W
Sbjct: 484 NFFSYYLELFVFPVCFIIWWLVKRDRFV-KYEDMDFTTDRYIPTKEIIELNETLDNLKGW 542

Query: 537 DRF 539
            ++
Sbjct: 543 KKY 545

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  267 bits (682), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 157/524 (29%), Positives = 265/524 (50%), Gaps = 18/524 (3%)

Query: 29  QEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVT 88
            EK +D+K+ +K RH+ M                              Y  MGT ++ + 
Sbjct: 114 NEKSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCII 173

Query: 89  QSLGEMCT-FIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWT 147
           Q+ GE+   +  +   F  +    + PA G +  ++Y   W     LEL      I++WT
Sbjct: 174 QAAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWT 233

Query: 148 MAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVT- 206
             V    ++ I +VL+   N F  R Y E EF+    KVL                    
Sbjct: 234 TKVDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAGND 293

Query: 207 GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRK 266
           G +G +YW +PG +     + + +  RF G + + + AAF F  TE + +TA E   PRK
Sbjct: 294 GYLGAKYWHDPGAF-----NGDKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRK 348

Query: 267 TVPKAIKKVVFRILVFYIGSLLVIGLLVPYN-DPKLQSNDSYVSSSPFIITIQNAGTKIL 325
            +P A KKV++RI+  ++ S+ +IG LVPYN D  L S  S + +SP++I + + G +++
Sbjct: 349 AIPSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKASPYVIAVSSHGVRVV 408

Query: 326 PHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFG 385
           PH  NAVIL++++S GNS  Y  SR+L  LA+   APK+F    + G P+  +L +++FG
Sbjct: 409 PHFINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFG 468

Query: 386 SLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAML 445
            +A+  T+    + F+WLL I G++  F W+ I  SHIRF +A++ +G S  ++ Y +  
Sbjct: 469 VIAFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYLSQS 528

Query: 446 MPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWFKC 501
             + + YA   + + ++ Q + + AP    K    NFF  Y+++ + I F+  +++W + 
Sbjct: 529 GVYGSAYAAIMLFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYRVWKRD 588

Query: 502 -RLVWKLQDVDLDTDRRDIEEEVWSDDVED-----KNKNWWDRF 539
            +L  + +D+DLDT R+  +E +   + E+     +N   W RF
Sbjct: 589 WKLFIRAKDIDLDTHRQIFDENILRQEDEEYKEKLRNGPMWRRF 632

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  265 bits (677), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 175/541 (32%), Positives = 283/541 (52%), Gaps = 25/541 (4%)

Query: 6   PQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXX 65
           P+ +   V+ + + TT    D +   ++D++R LK RHI+M                +  
Sbjct: 25  PKKNEVVVELDPSLTTEEDYDPEANIREDLQRALKPRHINMISIAGVIGTGLYLSTAKSL 84

Query: 66  XXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYW 125
                      Y  MG VV+     LGEM T++P++ SF  +A++F S +F  A  + YW
Sbjct: 85  YQGGPASLFMNYTIMGGVVYLTLLCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYW 144

Query: 126 FSWAMTFALELSVVGQIIQFW-TMAVPLAAWIS--IVWVLLTISNLFPVRIYGEIEFWIA 182
           F+ A++ A +++ +  ++ +W T A     W +  + W L+ + N+  VR YGE E+W+A
Sbjct: 145 FNDAVSVASDMTALQLVMDYWDTEASGFPYWAASLLFWFLVVLLNVIHVRFYGEAEYWLA 204

Query: 183 SVKVLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFF----GWV 238
            +KV+                 +   VG     NP    +G  + N  EA F     G+ 
Sbjct: 205 MLKVIAIIIFFILS--------IVVNVG----HNPQHEYIGFKNWNHGEAPFVDGFKGFA 252

Query: 239 SSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYND 298
           S  ++A+F + GTE + +T GE   P +  PK +K V +RILVFY+GS   I + +PY+ 
Sbjct: 253 SLFVSASFAYGGTESITLTNGEAANPLRNTPKIVKTVFWRILVFYVGSTFFIAMNIPYDY 312

Query: 299 PKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKN 358
           P L +    V +SPF +  Q AGTK      NAVI+ ++ISA N  ++ GSR++Y +   
Sbjct: 313 PGLDTKS--VVTSPFTLVFQMAGTKAAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLE 370

Query: 359 KAAP-KFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLL 417
              P K  + T++  VPYV+VL TS  G L +  +  G    +TWL NIVGV+   AWL 
Sbjct: 371 GFLPKKIVSRTNRYKVPYVSVLITSSIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLC 430

Query: 418 ISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVAN 477
           I  + IRF K L+++G   ++L YK    P+  Y+ V F+  II++QG+++F P + V N
Sbjct: 431 IGITSIRFRKGLEKQG-KTHELRYKNWTYPYGPYFLVIFVTFIILVQGWSAFDP-WDVTN 488

Query: 478 FFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWD 537
           FF+ Y+ +F+F   ++ + ++ + R V KL+D+D  TDR    +E+   +    +   W 
Sbjct: 489 FFSYYLDLFVFPFCFIIWWLYKRDRFV-KLEDMDFVTDRYIPTKEIIELNENLDHLKGWK 547

Query: 538 R 538
           R
Sbjct: 548 R 548

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  266 bits (680), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 161/548 (29%), Positives = 273/548 (49%), Gaps = 27/548 (4%)

Query: 12  QVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXX 71
           +   ++ P      D   +    +K+ +K RH+ M                +        
Sbjct: 73  RAPGSNNPDKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPA 132

Query: 72  XXXXXYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAM 130
                Y  MG+ ++ + Q+ GE+   +  ++  F  +    + PA G +  ++Y   W  
Sbjct: 133 GLVIGYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLC 192

Query: 131 TFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXX 190
              LEL      I++WT +V    +++I +VL    N+F  R Y E EF+  + KVL   
Sbjct: 193 VMPLELVTASITIKYWTTSVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMIT 252

Query: 191 XXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQ 249
                            G +G +YW +PG +     S +     F G VS+L+ AAF F 
Sbjct: 253 GFFILGIIVNCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFG 307

Query: 250 GTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ-SNDSYV 308
            TE + +TA E   PRK++P A KKV++RI+V ++GS+ ++G LVP+N  +L  S  S  
Sbjct: 308 ATEFIALTAAEQANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSAT 367

Query: 309 SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNT 368
            +SP++I I + G K++PH  NAVIL++++S GNS  Y  SR+L  LA+   AP F    
Sbjct: 368 HASPYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYV 427

Query: 369 SKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKA 428
            + G P + ++ +++FG ++++  +   +  FTWLL I G++  F W  I  SHIRF +A
Sbjct: 428 DREGRPTLAMIISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRA 487

Query: 429 LKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYIS 484
           +K +G S  +L +K+ +  W +YYA   M++I++ Q +T+ AP    K     FF  Y++
Sbjct: 488 MKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLA 547

Query: 485 VFLFIIFWVAFQIWFKCRLVWKL----QDVDLDTDRRDIEEEVWSDDVED-----KNKNW 535
           + + I  +  +++W   +  W L      +DL ++RR  +E+V   +  +     +N  W
Sbjct: 548 MPILIALYFGYKVW---KRDWTLYIPASKIDLISNRRIFDEDVLKQEDAEFREKLRNSGW 604

Query: 536 WDR---FW 540
             R   FW
Sbjct: 605 LRRAAEFW 612

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  266 bits (679), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 161/522 (30%), Positives = 265/522 (50%), Gaps = 17/522 (3%)

Query: 32  QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSL 91
           +  ++R LK RH+ M                              +  +G +++SV  ++
Sbjct: 77  RSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAM 136

Query: 92  GEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW-TMAV 150
           GE+    PV   FT +  RF+  +FG A  Y+Y   W +   LE+      + +W T A 
Sbjct: 137 GELAVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAK 196

Query: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXXXXXXXXXXXXVTGPV 209
               ++++ +V++ I N+F V+ YGE EF  + +KV                   V G V
Sbjct: 197 YRDGFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYV 256

Query: 210 GFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVP 269
           G +YW NPG +       N  + RF    S  + AAF+F GTELVG+ A E + PRK +P
Sbjct: 257 GGKYWHNPGAFN----GDNAGQ-RFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALP 311

Query: 270 KAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY-VSSSPFIITIQNAGTKILPHI 328
           +A K+V +RI +FYI SL +IGLLVPY    L  + S   ++SPF++ I+  G   LP +
Sbjct: 312 RAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPFVLAIKTHGISGLPSV 371

Query: 329 FNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLA 388
            N VILI+++S GNS+VY  SR L  LA     P+ F+   + G P V +L T  FG L 
Sbjct: 372 INVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLC 431

Query: 389 YMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPW 448
           ++  +      F WL+ + G++  F W  I   H+RF +AL  +G S ++L + + +  W
Sbjct: 432 FIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVW 491

Query: 449 LAYYAVFFMVIIIVIQGFTSFAPKFKVAN---FFAAYISVFLFIIFWVAFQIWFKC-RLV 504
            +Y+ V  + ++ + Q + +  P     N   FF AY+SV + + F++A +++ +     
Sbjct: 492 GSYFGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAHKLYTRNWTFA 551

Query: 505 WKLQDVDLDTDRRDIE-----EEVWSDDVEDKNKNWWDRFWN 541
            + +D+D+DT RR+++     +E+  + +    K WW R ++
Sbjct: 552 KRAKDIDIDTGRRELDLDALKQEIAEEKLRLSTKPWWYRVYH 593

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  263 bits (673), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 174/520 (33%), Positives = 252/520 (48%), Gaps = 23/520 (4%)

Query: 18  TPTTIST--LDDDQEKQQ-----DVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXX 70
           +P  I T  + DD++  +      VKR LK RHIS+                        
Sbjct: 8   SPLNIKTVKIRDDRDVSEFDPNTGVKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGP 67

Query: 71  XXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAM 130
                 ++ +G + F+V +S+GEM T  P    FT  A+RF S A  A  GY Y   +  
Sbjct: 68  LALLLGFVIIGIIAFAVMESIGEMITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFA 127

Query: 131 TFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXX 190
             A E + +  I+QFW   VPL A+  I W++  I  L  V ++GE E+W++ +K+L   
Sbjct: 128 VLANEYNTLSSILQFWGPQVPLYAYTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLI 187

Query: 191 XXXXXXXXXXXXXXVTGPV-GFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQ 249
                            P  GF YWK+PG    G          F G     +  +  + 
Sbjct: 188 VYYIFSIIYMSGGVRNKPAFGFHYWKDPGSLSHG----------FKGIAVVFVFCSSFYS 237

Query: 250 GTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVS 309
           GTE V +TA E + P K+VP A+++ ++RI+V YIG  +  G  VP+NDP L  N + V 
Sbjct: 238 GTESVALTATESKNPTKSVPYAVRQTLWRIVVVYIGIAIFYGSTVPFNDPNLSVN-TKVL 296

Query: 310 SSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTS 369
            SP  I I  AG     H+ NA IL + ISA N ++YIGSR L  LA    APKF   T 
Sbjct: 297 KSPIAIAISRAGWAGGSHLVNAFILFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTD 356

Query: 370 KAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKAL 429
           K GVP   +   +  G ++ M  + G   A+++++N+ GV  F  W +IS +H+R  KA 
Sbjct: 357 KRGVPIPAITIFNALGLISLMNMSVGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAW 416

Query: 430 KQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFI 489
             +G    +LPYKA+  PW   +++   + + +IQG+TS  P FK   F  AYI +   I
Sbjct: 417 VAQGRLLEELPYKALFYPWTPIFSLISNIFLALIQGWTSLVP-FKAPEFVDAYILLPAAI 475

Query: 490 IFWVAFQIW--FKCRLVWKLQDVDLDTDRRDIEEEVWSDD 527
           I +V   ++     R+V  L  V+LD  RR   E   SD 
Sbjct: 476 ILYVGVCVFKNHNFRIV-DLTSVNLDEGRRKDMENDQSDQ 514

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  265 bits (678), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 158/524 (30%), Positives = 260/524 (49%), Gaps = 15/524 (2%)

Query: 7   QVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXX 66
           +    ++D N T      +   +  Q  +K  LK RH+ M                    
Sbjct: 54  RAEEMELDPNLTEAERIAI---KTAQSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALR 110

Query: 67  XXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWF 126
                     +   GT+++S+  ++GE+    PV   FT +A RF+  +FG A  ++Y  
Sbjct: 111 TAGPAGILIGWGLTGTMIYSMVMAVGELAVVFPVAGGFTTYATRFVDESFGFAANFIYML 170

Query: 127 SWAMTFALELSVVGQIIQFW-TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVK 185
            W +   LE+      + +W T       ++++ +V++ I N+F V+ YGE EF  + +K
Sbjct: 171 QWLVVLPLEIVAASITVNYWGTDPKYRDGFVALFYVVIVIINMFGVKGYGEAEFIFSFIK 230

Query: 186 VLXXXXXXXXXXXXXXXXXVTGP-VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINA 244
           V+                      +G +YW NPG +       +    +F G+ +  + A
Sbjct: 231 VITVIGFIIMAIVLICGGGKDHKYIGAQYWYNPGAF-----VGDTAGQQFQGFCTVFVTA 285

Query: 245 AFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSN 304
           AF+F G+ELVG+   E +EPRK+VP A K+V +RI +FYI  LL+IG+LVP + P+L   
Sbjct: 286 AFSFAGSELVGLAGSEAEEPRKSVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGA 345

Query: 305 DSY-VSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPK 363
            S   ++SPF+I I N G K LP + N VILI ++S GNS +Y  SR L  LA     P 
Sbjct: 346 SSVDAAASPFVIAIVNHGIKGLPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPS 405

Query: 364 FFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHI 423
                 + G P V +  ++ FG +A++  +      F WL+ + G++  F W  I   HI
Sbjct: 406 ICGYIDRGGRPLVGIAISAFFGLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHI 465

Query: 424 RFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP---KFKVANFFA 480
           R+  AL  +G S ++LP++A    W +Y+  F  +++ + Q +    P   K    +FF 
Sbjct: 466 RYRGALAAQGRSTDELPFQAPAGVWGSYWGFFMCILMFIAQFYVGLFPPGTKPNAYDFFL 525

Query: 481 AYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEV 523
           AY+S  +FI  +   +IW +  +L   L+D+D+DT RR+++ +V
Sbjct: 526 AYLSFCIFIALYAFHKIWKRNWKLFIPLKDLDIDTGRREVDLDV 569

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  266 bits (680), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 156/547 (28%), Positives = 269/547 (49%), Gaps = 20/547 (3%)

Query: 7   QVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXX 66
           Q H  + D     TT         K   +K+ ++ RH+ M                    
Sbjct: 92  QAHELEKDE----TTDKIAPHTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALV 147

Query: 67  XXXXXXXXXXYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYW 125
                     Y  MG++++ + Q+ GEM   +  +T  +  +    +   FG A  ++Y 
Sbjct: 148 HAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYC 207

Query: 126 FSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVK 185
             W     LEL      I++WT +V    ++ I +VL+   N+F  R Y E EF+    K
Sbjct: 208 LQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCK 267

Query: 186 VLXXXXXXXXXXXXXXXXXVT-GPVGFRYWKNPGPW-GMGIISSNVNEARFFGWVSSLIN 243
           +L                    G +G +YW  PG + G+  I       RF G V++L+ 
Sbjct: 268 ILMMTGFFILGIIIDVGGAGNDGYIGGKYWHEPGAFNGVHAID------RFKGVVATLVT 321

Query: 244 AAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN-DPKLQ 302
           AAF F G+E + IT  E   PRK +P A K++++RIL  ++ +++++G LVPYN D  L 
Sbjct: 322 AAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLG 381

Query: 303 SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAP 362
           S+     +SP++I I + G ++ PH  NAVIL++++S  NS+ Y  +R+   L++   AP
Sbjct: 382 SSGGGTKASPYVIAIASHGVRVAPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAP 441

Query: 363 KFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSH 422
           K F+   +AG P + +  +++F  +A+   +   D+ FTWLL I G++  F W  I  SH
Sbjct: 442 KIFSYIDRAGRPLIAMCVSALFAVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSH 501

Query: 423 IRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANF 478
           IRF +A+K +G S  +L +K+    W + Y+   M++I++ Q + + AP    K     F
Sbjct: 502 IRFRRAMKVQGRSLGELGFKSQTGVWGSIYSCIMMILILIGQFWVAIAPIGEGKLDAQAF 561

Query: 479 FAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEE-VWSDDVEDKNKNWW 536
           F  Y+++ + I+ +V +++W K  +L  +   +DL + R+  +EE +  +D E + +   
Sbjct: 562 FENYLAMPILIVLYVGYKMWNKDWKLFIRADKIDLTSHRQIFDEELIKQEDDEYRERLRT 621

Query: 537 DRFWNYV 543
             +W  V
Sbjct: 622 GPYWRRV 628

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  265 bits (677), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 159/535 (29%), Positives = 267/535 (49%), Gaps = 15/535 (2%)

Query: 9   HSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXX 68
           + ++++ N+     S   +D+   Q +++ ++ RH+ M                      
Sbjct: 55  NQYEIEKNEINNIKSDQFNDKLNNQ-LQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNA 113

Query: 69  XXXXXXXXYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYWFS 127
                   Y+ M + ++ + Q+ GEM   ++ +   F  +    +  A+  A  ++Y   
Sbjct: 114 GPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQ 173

Query: 128 WAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFP-VRIYGEIEFWIASVKV 186
           W     LEL      I++W   V    +++I ++L+   NLF   R Y E EF+    K+
Sbjct: 174 WLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKI 233

Query: 187 LXXXXXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAA 245
           L                  T G +G  YW NPG +       +    RF G VS+L+ AA
Sbjct: 234 LMIAGFFILGIILICGGAGTSGYIGVSYWNNPGAF-----RGHTPGTRFKGIVSTLVTAA 288

Query: 246 FTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL-QSN 304
           F+F  TE + ITA E   PRK +P A KKV++R L  Y+GS++++G LVPYN P+L  S 
Sbjct: 289 FSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSK 348

Query: 305 DSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKF 364
            S   +SP++I + + G +I PH  NAVILI+++S  NS+ Y  SR+L  LAK   APK 
Sbjct: 349 SSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKI 408

Query: 365 FTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIR 424
           FT   + G P   ++  S+  ++A+  ++    + F+WLL I G++  F W  I  SHIR
Sbjct: 409 FTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIR 468

Query: 425 FMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFA 480
           F +A+K +G S N+L YK+ +  W + YA   M +I++ Q + +  P       + NFF 
Sbjct: 469 FRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFK 528

Query: 481 AYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKN 534
            Y+++ + ++F+  ++ W K   L  + +D+DL + R   +E+V   +     +N
Sbjct: 529 EYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKEN 583

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  265 bits (678), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 155/544 (28%), Positives = 274/544 (50%), Gaps = 23/544 (4%)

Query: 13  VDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXX 72
           ++ ND+   I+    +  K   +K+ ++ RH+ M                          
Sbjct: 96  LEKNDSTDKINPPAGN--KSGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAG 153

Query: 73  XXXXYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMT 131
               Y  MG++++ + Q+ GE+   +  +T  +  +    +   FG A  ++Y   W   
Sbjct: 154 LLIGYAIMGSILYCIIQACGELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCV 213

Query: 132 FALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX 191
             LEL      I++WT +V    ++ I +VL+   N+F  R Y E EF+    K+L    
Sbjct: 214 CPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTG 273

Query: 192 XXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQG 250
                           G +G +YW +PG +     +   +  RF G V++L+ AAF F G
Sbjct: 274 FFILSIIIDVGGAGNDGFIGGKYWHDPGAF-----NGKHSIDRFKGVVATLVTAAFAFGG 328

Query: 251 TELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN-DPKLQSNDSYVS 309
           +E + IT  E   PRK +P A K++++RIL  ++ +++++G LVPYN D  L S      
Sbjct: 329 SEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTK 388

Query: 310 SSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTS 369
           +SP++I I + G +++PH  NAVIL++++S  NS+ Y  +R+   L++   APKFF+   
Sbjct: 389 ASPYVIAIASHGVRVVPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYID 448

Query: 370 KAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKAL 429
           +AG P + +  +++F  +A+   +   ++ FTWLL I G++  F W  I  SHIRF +A+
Sbjct: 449 RAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAM 508

Query: 430 KQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISV 485
           K +G S  +L +K+    W + YA   M++I++ Q + + AP    K     FF  Y+++
Sbjct: 509 KVQGRSLGELGFKSQTGVWGSMYACIMMLLILIGQFWVAIAPIGEGKLDAQAFFENYLAM 568

Query: 486 FLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVED-----KNKNWWDR- 538
            + I  +V ++IW K  +L  +   +DL++ R+  +EE+   + E+     +N  +W R 
Sbjct: 569 PILIALYVGYKIWTKDWKLFIRADKIDLESHRQIFDEELIKQEDEEYRERLRNGPYWKRV 628

Query: 539 --FW 540
             FW
Sbjct: 629 AAFW 632

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  264 bits (675), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 169/548 (30%), Positives = 276/548 (50%), Gaps = 23/548 (4%)

Query: 7   QVHSFQVDSNDTPTTISTLDDD--QEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRX 64
           +    +VD N     +S LD    +     ++  LK RH+ M                  
Sbjct: 56  ERERLEVDPN-----MSELDQIAFRTANSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTA 110

Query: 65  XXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMY 124
                       +   GT+++S+  +LGE+    PV+  FT +A RF+  ++G AN   Y
Sbjct: 111 LRTAGPAGILIGWGLTGTMIYSMVMALGELAVLFPVSGGFTTYATRFIDESYGFANNINY 170

Query: 125 WFSWAMTFALELSVVGQIIQFW-TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIAS 183
              W +   LE+      + +W T       ++++ W+ + I NLF V+ YGE EF  + 
Sbjct: 171 MLQWLVVLPLEIVAASITVNYWGTNPRYRDGFVALFWLAIFIINLFGVKGYGEAEFIFSI 230

Query: 184 VKVLXXXXXXXXXXXXXXXXX-VTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLI 242
           +KV+                  V G +G RYW +P     G    +   ARF G  S  +
Sbjct: 231 IKVITVVGFIILGIILNCGGGPVKGYIGGRYWHHP----YGAFVGDSAGARFKGVCSVFV 286

Query: 243 NAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ 302
            AAF+F G+ELVG+ + E   PRK+VPKA K+V +RI +FY+ +L ++GLLVPY + +L 
Sbjct: 287 TAAFSFAGSELVGLASAETANPRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLI 346

Query: 303 SNDSY-VSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAA 361
              S   ++SPF+I I   G + LP + N VILI ++S GNS +Y  SR L  LA+    
Sbjct: 347 GASSVDAAASPFVIAITTHGIRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFL 406

Query: 362 PKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCS 421
           PKFF    ++G P  ++L TS FG +A++  +    + F WLL + G++  F W  I   
Sbjct: 407 PKFFGYIDRSGRPLYSILVTSGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLC 466

Query: 422 HIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP---KFKVANF 478
           HIRF KAL  +G   ++L + +    + +Y+ +F ++++ + Q + +  P   K     F
Sbjct: 467 HIRFRKALSAQGRGTDELSFVSPAGVYGSYWGLFMIILMFIAQFYVALFPPGAKPNAKAF 526

Query: 479 FAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVEDKN----- 532
           F AY+S  + I  ++  +I+ K  ++  K +D+D+DT R+D + ++   +V ++      
Sbjct: 527 FEAYLSFPIVIACYLGHKIYKKNWKIFIKAEDMDIDTGRKDDDLDLLRQEVAEERAVLAT 586

Query: 533 KNWWDRFW 540
           K WW R+W
Sbjct: 587 KPWWYRWW 594

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  265 bits (676), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 156/525 (29%), Positives = 264/525 (50%), Gaps = 14/525 (2%)

Query: 28  DQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSV 87
           D    + +K+ ++ RH+ M                              Y  MG++++ +
Sbjct: 123 DANDNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCI 182

Query: 88  TQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146
            Q+ GEM   +  +   + V+    +   FG A  ++Y   W     LEL      I++W
Sbjct: 183 IQATGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYW 242

Query: 147 TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVT 206
           T +V    +++I + L+ I N+F  + Y E EF+    KVL                   
Sbjct: 243 TTSVNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGN 302

Query: 207 -GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPR 265
            G +G  YW  PG +       + +   F G   +L+ AAF + GTE + +TA E   PR
Sbjct: 303 DGYLGGLYWHTPGAF-----RGDSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPR 357

Query: 266 KTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSND-SYVSSSPFIITIQNAGTKI 324
             +P A KKV++RI+  Y+ S+L+IG LVP++  +L  +D S  S+SP+++     G ++
Sbjct: 358 AAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLAASLHGVRV 417

Query: 325 LPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMF 384
           +PH  NAVILI+++S GNS  Y  SR+L  LA+   APK+F    + G P   +L +++F
Sbjct: 418 VPHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALF 477

Query: 385 GSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAM 444
           G +A+   +    + FTWLL I G++  F W  I  SHIRF  A+K +G S  ++ Y A 
Sbjct: 478 GVIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQ 537

Query: 445 LMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWFK 500
              W ++YA+F M +I + Q + + AP    +    NFF  Y+++ + I+ ++ ++I++K
Sbjct: 538 TGVWGSWYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYK 597

Query: 501 C-RLVWKLQDVDLDTDRRDIEEEVW-SDDVEDKNKNWWDRFWNYV 543
              L+ K +D+DL + R+  +E++   +D E + +     FW  V
Sbjct: 598 DWTLLIKAEDIDLQSHRQIFDEDLLKEEDFEYRQRLKNGPFWRRV 642

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  265 bits (676), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 163/547 (29%), Positives = 278/547 (50%), Gaps = 23/547 (4%)

Query: 7   QVHSFQVDSNDTPT-TISTLDDDQEK-------QQDVKRE--LKKRHISMXXXXXXXXXX 56
            ++S +VD N+     I  L+DD E         +D+ ++  +K RH+ M          
Sbjct: 116 DMNSNEVDPNNKKNENIYALNDDLEDGTTSIAASEDMPKKGGMKARHVIMMTLATGIGTG 175

Query: 57  XXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPA 115
                 +             Y  +  V + V Q+ GEM    P +   F  +   F+S  
Sbjct: 176 LLVANAKSLHFSGPAGLVVGYFMVSFVTYFVVQAAGEMAIAYPTLPGGFNTYQSLFISKP 235

Query: 116 FGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYG 175
           FG A  +++  +W     LEL      +++WT ++    ++ I ++ L   +   +R+Y 
Sbjct: 236 FGFATVWIFALNWLTILPLELITSSITVKYWTTSINPDIFVLIFYLFLLFVHFIGLRLYA 295

Query: 176 EIEFWIASVKVLXXXXXXX-XXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARF 234
           E EF+  S K+L                    G +G +YW +PGP+     +S+   ARF
Sbjct: 296 EAEFFFNSCKILMITGFIIFSIVVNCGGAGHDGYIGGKYWHDPGPF-----ASDNGAARF 350

Query: 235 FGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLV 294
                 LINA F++ GTEL  ++  E + PRK VP A K  V+R+ + Y+ ++++IG  V
Sbjct: 351 KEVCYVLINAYFSYGGTELYVLSVNEQENPRKAVPVAAKTSVYRVAIIYLLTMILIGFNV 410

Query: 295 PYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYG 354
           PYN P L  N +   +SP+++  Q  G KI+PH  NAVIL+++IS  NS ++ G R+L  
Sbjct: 411 PYNSPDLMGNANSKDASPYVLAAQIHGVKIVPHFINAVILLSVISVANSALFAGPRLLAT 470

Query: 355 LAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFA 414
           LA+   APKF T   +AG P + +   S+FG +A+  T+   D+ FTWL  I G++  FA
Sbjct: 471 LAEQGFAPKFLTYVDRAGRPLLALCVCSLFGVIAFAATSKKEDEVFTWLAAIAGLSELFA 530

Query: 415 WLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-AP-- 471
           W  I  SHIRF  A+K  G S +++ YKA+   W +YY +FF +++++ Q + +  AP  
Sbjct: 531 WSGILLSHIRFRWAMKYHGKSMDEVGYKAITGIWGSYYGLFFNLLVLIAQFWVALSAPGS 590

Query: 472 --KFKVANFFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDV 528
             +    +FF +Y++  +++ F++ + I+ K   ++  L+D+D+D  RR  + +    + 
Sbjct: 591 GGQVTAISFFESYLAFVIWVFFYLCYMIYNKDWTILIPLKDIDVDYQRRIYDADFLRQEK 650

Query: 529 EDKNKNW 535
           E+  + +
Sbjct: 651 EESYEKY 657

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  263 bits (671), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 157/524 (29%), Positives = 262/524 (50%), Gaps = 15/524 (2%)

Query: 5   QPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRX 64
           +     +  D   TP   S ++D      ++ ++L  RH+                    
Sbjct: 60  KGDTKEYPRDVKATPEAASYVEDIN--NTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGAS 117

Query: 65  XXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMY 124
                       ++ + T +F+V  SLGE+    PV   F V+  RF+ P+F  A    Y
Sbjct: 118 LTTGGPASLVIGWVIVSTCLFTVINSLGELAAAFPVVGGFNVYITRFIEPSFAFAINLNY 177

Query: 125 WFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASV 184
              W +   LEL      I++W   +   AW++I +  + ++N+  V+ +GE EF ++ V
Sbjct: 178 LAQWLVLLPLELVAASITIRYWNDKINSDAWVAIFYTAIALANMLDVKSFGETEFILSMV 237

Query: 185 KVLXXXX-XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLIN 243
           K+L                    G +G +YW NPG +       +   ++F G  S  + 
Sbjct: 238 KILAIIGFGILGIVLTCGGGPHGGYIGGKYWHNPGAF-----VGHSAGSQFKGLCSVFVT 292

Query: 244 AAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQS 303
           AAF++ G E+  ++A E + P++T+PKA K+  + I V Y+G L +IG LVPYNDP+L +
Sbjct: 293 AAFSYSGIEMTAVSAAESRNPKETIPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLN 352

Query: 304 NDSYV--SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAA 361
             S V  ++SP +I I+N G K LP + NA+ILI I+S  NS VY  SR +  +A     
Sbjct: 353 GSSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNL 412

Query: 362 PKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCS 421
           PKF +   K G P   +L T  FG L+++  +   ++ FTWL  + G++  F W+ I+ S
Sbjct: 413 PKFLSKVDKRGRPLNAILLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLS 472

Query: 422 HIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVAN 477
            IRF  A+K +G S +++P+ +    W A+Y V  + +++V   +TS  P         +
Sbjct: 473 LIRFRDAMKAQGRSLDEMPFLSQSGTWGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKS 532

Query: 478 FFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIE 520
           FF  Y+S+ + I  +V  ++W +  RL+  L ++DLD+ RR ++
Sbjct: 533 FFEGYLSLPILIACYVGHKLWKRDWRLLVPLMEMDLDSGRRVLD 576

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  262 bits (670), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 161/523 (30%), Positives = 272/523 (52%), Gaps = 17/523 (3%)

Query: 32  QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSL 91
           Q  +K +LK RH+ M                +             +  MGT+++++  +L
Sbjct: 82  QTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMAL 141

Query: 92  GEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW-TMAV 150
           GE+    P++  FT +A RF+  +FG A  + Y   W +T  LE+      + +W T   
Sbjct: 142 GELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPK 201

Query: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXX-VTGPV 209
               ++++ W+++   N+F V+ YGE EF  + +KV+                    G +
Sbjct: 202 YRDGFVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYI 261

Query: 210 GFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVP 269
           G +Y+ +PG +     + +   A+F G  S  + AAF+F G+ELVG+ A E  +PRK+VP
Sbjct: 262 GGKYFHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSVP 316

Query: 270 KAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY-VSSSPFIITIQNAGTKILPHI 328
           KA K+V +RI +FYI SLL+IGLLVPYND +L    S   ++SPF+I I   G K LP +
Sbjct: 317 KAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAASPFVIAIVTHGIKGLPSV 376

Query: 329 FNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLA 388
            N VILI ++S GNS ++  SR    LA+    P+ F    + G P V ++ TS  G +A
Sbjct: 377 VNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGLIA 436

Query: 389 YMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPW 448
           ++  +   +  F WLL + G++  F W  I   HIRF KAL  +G S ++L +K+    W
Sbjct: 437 FVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPTGVW 496

Query: 449 LAYYAVFFMVIIIVIQGFTSFAP---KFKVANFFAAYISVFLFIIFWVAFQIWFKC-RLV 504
            +Y+ +F +VI+ + Q + +  P         FF AY+S  L +  ++  +I+ +  +L+
Sbjct: 497 GSYWGLFMIVIMFIAQFYVALFPVNGSPSAEGFFEAYLSFPLVLAMYIGHKIYKRNWKLL 556

Query: 505 WKLQDVDLDTDRRDIEEEVWSDDVEDKN-----KNWWDRFWNY 542
               ++D+D+ RR+++ E+   ++ ++      K  W R +++
Sbjct: 557 IPAGEMDIDSGRREVDLELLKQEIAEEKAILATKPAWFRVYSF 599

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  264 bits (674), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 162/560 (28%), Positives = 270/560 (48%), Gaps = 30/560 (5%)

Query: 6   PQVHSFQVDSNDTPTTISTLDDDQE-----KQQDVKRELKK----RHISMXXXXXXXXXX 56
           P ++   +++      I T   D+E     K++D   EL++    RH+ M          
Sbjct: 121 PDIYIDDLENKQQVELIGTTIQDEELLPGQKKEDSNAELRQTIKPRHVIMMSLGTGIGTG 180

Query: 57  XXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPA 115
                 +             Y  MGT ++ + Q+ GEM   +  +T SF  F    + P 
Sbjct: 181 LLVGNAKPLAAAGPAPLVIGYGIMGTCIYCIIQACGEMAVAYGNLTGSFNTFPSFLVDPG 240

Query: 116 FGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYG 175
           F  A  ++Y   W     LEL      IQ+WT  V    ++ I +VL+ + N F  + Y 
Sbjct: 241 FNFAVAWVYCIQWLCVCPLELVTASMTIQYWTTKVDPDVFVVIFYVLILLINFFGAKGYA 300

Query: 176 EIEFWIASVKVLXXXXXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARF 234
           E EF   + KVL                  T G +G +YW +PG +            RF
Sbjct: 301 EAEFIFNTCKVLMICGFFILAICIDTGAAGTDGYIGAKYWNDPGAF-----RGQTKIERF 355

Query: 235 FGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLV 294
            G + + + AAF F  TE + +TA E   PRK +P A KK+++R+LV ++ ++++IG LV
Sbjct: 356 KGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKIIYRVLVIFLNTIILIGFLV 415

Query: 295 PYN-DPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILY 353
           PY+ D  L S  S   +SP+++ I   G ++  H  NAVILI++IS GNS  Y  SR+L 
Sbjct: 416 PYDSDQLLGSGGSATKASPYVLAISLHGVRVAQHFVNAVILISVISVGNSAFYSSSRLLM 475

Query: 354 GLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFF 413
            LA+  +APK F    + G P + +  +++   +A+  T+    + FTWL+ I G++  F
Sbjct: 476 SLAQQGSAPKIFDYVDREGRPLIAMCCSAVIAVIAFCATSPKETEVFTWLMAIAGLSQLF 535

Query: 414 AWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKF 473
            W  I  SH+RF +A+K +G S  ++ Y +      + YA   M++ ++ Q + +  P  
Sbjct: 536 TWFAICLSHLRFRRAMKVQGRSLGEMGYLSQTGILGSLYAAIMMILALIAQFWVALVPMG 595

Query: 474 ----KVANFFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDV 528
                  +FF+ Y+++ + I+F+  ++IW +  RL  + +D+DL + R   +EE+   + 
Sbjct: 596 THTPDANSFFSNYLAMPILIVFYFGYKIWKRDWRLFIRAKDIDLISHRTIYDEELLRQED 655

Query: 529 ED-----KNKNWWDR---FW 540
           E+     +N   W R   FW
Sbjct: 656 EEYREKLRNGPKWKRVAAFW 675

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  262 bits (669), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 156/548 (28%), Positives = 278/548 (50%), Gaps = 26/548 (4%)

Query: 9   HSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXX 68
             +++D  D   + +        +  +KR LK RH+ M                +     
Sbjct: 58  REYKLDDVDPNLSSTERAAIATARSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIG 117

Query: 69  XXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSW 128
                   ++  G++V+SV Q++GE+C  +PV+ S+  +  RF+ P+FG A  Y Y    
Sbjct: 118 GPAAVILAWILTGSMVYSVVQAIGELCVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGN 177

Query: 129 AMTFALELSVVGQIIQFWTMAVPLA-AWISIVWVLLTISNLFPVRIYGEIEFWIASVKVL 187
            +T  LE+      + +W +    A  ++++ +V + + N   V+ YGE EF  + +KVL
Sbjct: 178 LVTMPLEIVAASITVDYWNVDHKYADGFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVL 237

Query: 188 XXXXXXXXXXXXXXXXXV--TGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAA 245
                               TG +G +YW NPG +  G          F G+ +  + +A
Sbjct: 238 AIVGFIILGIVLVCGGGSNNTGYIGTKYWHNPGGFAHG----------FKGFAAIFVTSA 287

Query: 246 FTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL-QSN 304
           F+F G+E+  + A E + PR+ +PKA K+V +RI +FY+ SL +IG LVPY +  L  S+
Sbjct: 288 FSFSGSEMFALGAAESKNPRRDLPKAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASS 347

Query: 305 DSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKF 364
               S+SPF+I I+ AG   LP + N VIL+ ++S GN+ V+  SR    LA     PK 
Sbjct: 348 SVDASASPFVIAIKEAGISGLPSVINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKK 407

Query: 365 FTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIR 424
           F    + G P   ++ + +FG L+++ ++      F W+L + G+  FF W  I   H+R
Sbjct: 408 FAYVDRKGRPLAGLILSMVFGLLSFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLR 467

Query: 425 FMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFK---VANFFAA 481
           F + L+ +G S ++L +KA    W + Y +  + +++  Q + +  P  K     +FF  
Sbjct: 468 FRQGLRAQGRSTDELAFKAQTGIWGSIYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQ 527

Query: 482 YISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKN------ 534
           Y+S+ + I+F++  +++ +  RLV   +++DLDT RR+++ E+   +++++N++      
Sbjct: 528 YLSLPVVIVFYMGHKVYSRNWRLVIPAKELDLDTGRREVDLELLKQEIKEENESIRSRPI 587

Query: 535 WWD--RFW 540
           W+   RFW
Sbjct: 588 WYRIYRFW 595

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  262 bits (670), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 156/535 (29%), Positives = 271/535 (50%), Gaps = 26/535 (4%)

Query: 11  FQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXX 70
             VD   +P+     D D E ++ +K+ L+ RH+ +                        
Sbjct: 86  MDVDLEKSPSA----DGDNEPRK-LKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGP 140

Query: 71  XXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTV-----FAQRFLSPAFGAANGYMYW 125
                 Y+ +  V++ +  +LGEM  F+P   S +         R++  + G A G+ Y+
Sbjct: 141 GGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYF 200

Query: 126 FSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVK 185
           + + +  A E +    ++++WT AVP   WI++  +++ + N   V++YGE EFW AS+K
Sbjct: 201 YCYVILVAAECTAASGVVEYWTTAVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIK 260

Query: 186 VLXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSL 241
           +L                   GP    +GFRYW++PG +   +   ++    F    + +
Sbjct: 261 ILCIVGLIILSFILFWGG---GPKHDRLGFRYWQHPGAFAHHLTGGSL--GNFTDIYTGI 315

Query: 242 INAAFTF-QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDP- 299
           I  AF F  G ELV +T+ E  + R+ + KA ++ V+R++ FY+   L I ++VPYNDP 
Sbjct: 316 IKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPV 375

Query: 300 ---KLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLA 356
               L        SSPF+I IQNAG K+LPHI N  IL +  SA N+ ++  +R L  +A
Sbjct: 376 LVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMA 435

Query: 357 KNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWL 416
           +   APK     ++ GVPYV V  + +   LAY+  ++     F W  NI  ++GF  W+
Sbjct: 436 QTGQAPKCLGKINRWGVPYVAVAASFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWI 495

Query: 417 LISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKF-KV 475
               +++RF KA+   G+  + LP+K    P+  ++++  + II +  G+  F PK+ KV
Sbjct: 496 CGCIAYLRFRKAIFYNGL-YDRLPFKTWGQPYTVWFSLIVVSIITITNGYAIFIPKYWKV 554

Query: 476 ANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVED 530
           A+F AAY+++ +F++ W+  +++ +    W L   ++D  R  +E E  S ++E+
Sbjct: 555 ADFIAAYVTLPIFLVLWLGHKLYTRTWHQWWLPVSEIDVTRGLVEIEEKSREIEE 609

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  259 bits (662), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 141/447 (31%), Positives = 246/447 (55%), Gaps = 16/447 (3%)

Query: 77  YLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALEL 136
           YLF G+++  V  SL EM  F P+   F+ +  +++ PAFG A G+ Y+  +A+  +  L
Sbjct: 75  YLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLKYAIVLSANL 134

Query: 137 SVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXX 196
           +  G +I +W   + +A W+++++    + N   VR +G++E ++   K+          
Sbjct: 135 TAFGLVIGYWRPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKLTILLLIFIVC 194

Query: 197 XXXXXXXXVTGP----VGFRYWKNPG--PWGMGIISSNVNEARFFGWVSSLINAAFTFQG 250
                     GP    +GFRYW+  G  P+ +       N  +F GW + +I + F F G
Sbjct: 195 LVITCG---GGPDHTTIGFRYWRESGFLPYLV-----KGNTGKFLGWWACVIQSIFGFMG 246

Query: 251 TELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLV-PYNDPKLQSNDSYVS 309
           +E++GI  GE   PRKT+PKA + V+ RI VFYI  + V+GL V P+N   + ++ +  +
Sbjct: 247 SEMIGIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVHAHSTDAN 306

Query: 310 SSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTS 369
           +SPF+I I  +G K+LP   NA +L+ I S+  +++YI SR LYGLAK+ AAPK F   +
Sbjct: 307 ASPFVIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPKIFLRLN 366

Query: 370 KAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKAL 429
           K  +P V  +  S+ G LAYM T       F ++ + V V G   W  I  ++I + + +
Sbjct: 367 KHKIPMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYIHYDRVV 426

Query: 430 KQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFI 489
           K  G+  +++P++    P+ AY A+FF+ +I    G+++F  KF    F  +YI +F  +
Sbjct: 427 KSHGVRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFILKFNYKLFITSYIGIFANV 486

Query: 490 IFWVAFQIWFKCRLVWKLQDVDLDTDR 516
           +  + +++++K + V K +++  +  +
Sbjct: 487 LLVLGYKLYYKTKWV-KPEEITFEKKQ 512

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  259 bits (663), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 170/538 (31%), Positives = 270/538 (50%), Gaps = 16/538 (2%)

Query: 5   QPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRX 64
           +  V    + S D       L +D+ K   +K+ LK+RHI M                  
Sbjct: 17  EADVEDCDIRSTDETLKQGVLHNDRTK---LKQGLKERHIKMLTLVGVFGTGLFLSSGGT 73

Query: 65  XXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMY 124
                       YLF+G VV     ++ E+ +F+P T +    A++F+  + G   G++ 
Sbjct: 74  LKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVGFTFGWIS 133

Query: 125 WFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASV 184
            +S  M    ELS    I+++WT   P A +I+I  VL  ++N++ +R YGE+E+ +   
Sbjct: 134 TYSSLMPG--ELSATAVIMRYWTDISP-AVFITIFGVLFVVTNIYTIRFYGEVEY-VFGW 189

Query: 185 KVLXXXXXXXXXXXXXXXXXVTGP--VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLI 242
             L                 V G   +GF YW++PGP+   I+  ++   +F G+ S+L 
Sbjct: 190 LKLILIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFAEYIVGGSI--GKFVGFWSALS 247

Query: 243 NAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ 302
           +  +++ G + + I AGE +  R  +    K V  RI+V Y+ ++ V+ L+VPYND  + 
Sbjct: 248 SVVYSYSGIQNIAILAGETKNSRHAIYHGAKNVFLRIIVLYLVTVFVLTLIVPYNDALIA 307

Query: 303 SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAP 362
           S      SSPF+I +  AG K+LPHI NA++L +  SAGN  +  GSR L+ LA    AP
Sbjct: 308 SGTGTAKSSPFVIAMNRAGIKVLPHIVNALVLTSAWSAGNLAIIEGSRNLFCLATKNQAP 367

Query: 363 KFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSH 422
           K F  TSK G+PYV V+F S F  LAYM  +      F W   +V       W+LIS +H
Sbjct: 368 KIFLKTSKRGIPYVGVIFISCFLPLAYMSCSESSSTVFGWFQELVSSNTLLRWILISANH 427

Query: 423 IRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAA 481
           I   +ALK +G SR+DLPY   + P+ A+++     I ++  GF +F    F + +FF  
Sbjct: 428 IYMDRALKAQGYSRSDLPYSTPIAPYAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTR 487

Query: 482 YISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRF 539
           Y  + L I  +  ++++ K R + + ++VDL +   DI E    + +E K+K  W R 
Sbjct: 488 YFIIPLAIGLFTFWKLFKKTRYL-RPEEVDLASIFDDIREN--PEHIE-KSKPIWARL 541

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  262 bits (669), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 163/543 (30%), Positives = 270/543 (49%), Gaps = 22/543 (4%)

Query: 14  DSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXX 73
           D    P T    DDD    +++K+ +K RH+ M                           
Sbjct: 91  DIEGKPRTEPEKDDDA---RELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGL 147

Query: 74  XXXYLFMGTVVFSVTQSLGEMCT-FIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTF 132
              Y  MG+ ++ + Q+ GE+   +  +T  F  +    + PAFG A  ++Y   W    
Sbjct: 148 VIGYAIMGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVC 207

Query: 133 ALELSVVGQIIQFWTMAVPLAAWISIVWVL-LTISNLFPVRIYGEIEFWIASVKVLXXXX 191
            LEL      I++WT  V    ++ I + L L I+ L     Y E EF+  S K+L    
Sbjct: 208 PLELVTASMTIKYWTTKVDPDVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTG 267

Query: 192 XXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQG 250
                           G +G R W NPG +       +    RF G VS+L+NAAF F  
Sbjct: 268 FFILGIVVICGGAGNDGYIGTRLWHNPGSF-----RGDKPVDRFKGVVSTLVNAAFAFGM 322

Query: 251 TELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN-DPKLQSNDSYVS 309
           +E +G+TA E   PRK +P A KK+++RI+  Y+GS+ ++G LVPY+ D  L S+ +   
Sbjct: 323 SEFLGVTASEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATK 382

Query: 310 SSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTS 369
           +SP+++ I   G +++PH  NAVIL++++S GNS  Y  SR L  L++   AP F     
Sbjct: 383 ASPYVLAISLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVD 442

Query: 370 KAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKAL 429
           + G P      +++ G +A+  T+   D+ F WLL I G++  F W  I  SH+RF +A+
Sbjct: 443 RNGRPLKAYCVSALVGVIAFCATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAM 502

Query: 430 KQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISV 485
           + +G S  ++ +K+ +  + + Y+   MV+I++ Q +T+  P    K  V  FF  Y+++
Sbjct: 503 RVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLAM 562

Query: 486 FLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVED-----KNKNWWDRF 539
            +FI+ +  F+IW K  RL  + +D+DL + R   +EE+   + E+     ++   W R 
Sbjct: 563 PIFIVLYFGFKIWKKDWRLFIRAEDIDLVSHREIFDEELLKQEDEEYRRKLRDGPMWRRV 622

Query: 540 WNY 542
           +++
Sbjct: 623 YDF 625

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  261 bits (667), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 162/534 (30%), Positives = 265/534 (49%), Gaps = 20/534 (3%)

Query: 26  DDDQEKQQD------VKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLF 79
           ++DQE  QD      +K+ ++ RH+ M                +             +  
Sbjct: 74  ENDQESLQDNNKHEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFV 133

Query: 80  MGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSV 138
           MGT V+ V Q+ GEM    P ++  F  +    + P FG A  ++Y   W   F LEL  
Sbjct: 134 MGTCVYCVIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVT 193

Query: 139 VGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXX 198
               I++WT A+    ++++ ++L+ + N F  R Y E EF+  + KVL           
Sbjct: 194 ASITIKYWTTAINPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGIL 253

Query: 199 XXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGIT 257
                    G +G +YW+ PG +G      +     F G VS+L+NAAF+   +E V +T
Sbjct: 254 VNTGAAGNDGYIGAKYWREPGSFG-----GHTAIDHFKGVVSTLVNAAFSLGCSEFVALT 308

Query: 258 AGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ-SNDSYVSSSPFIIT 316
           A E   PRK+VP A KK+++++ V ++GS+ +IG LVP N  +L  S DS V  SP++I 
Sbjct: 309 AAEQANPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVSPYVIA 368

Query: 317 IQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYV 376
           + + G +++PH  NAVIL++++S GNS  Y  SR+L  LA+   AP  F    + G P +
Sbjct: 369 VASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLM 428

Query: 377 TVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISR 436
            ++ +   G L ++  +   +  F WLL I G++  F W  I  SHIRF KAL  +G   
Sbjct: 429 AMMVSITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGW 488

Query: 437 NDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIFW 492
           + L +KA    W +YY+   M++  + Q +T   P    K    +FF  Y++  +F+  +
Sbjct: 489 DGLGFKAQTGVWGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFVALY 548

Query: 493 VAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVW-SDDVEDKNKNWWDRFWNYVA 544
             ++I+ K  +L    + +DLD  R+  + +V   +D E + K      W+ +A
Sbjct: 549 FGYKIYNKNWQLFIPAEKIDLDLHRKIFDADVLKQEDAEYRAKLRDSSMWHRIA 602

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  260 bits (665), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 164/527 (31%), Positives = 271/527 (51%), Gaps = 17/527 (3%)

Query: 28  DQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSV 87
            +     +K  LK RH+ M                              +   GT+++ +
Sbjct: 74  HRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYCM 133

Query: 88  TQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW- 146
             ++GE+    P++  FT +A RF+  +FG AN + Y   W     LE+      + +W 
Sbjct: 134 VMAMGELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEIVAASITVNYWG 193

Query: 147 TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXXXXXXXXXXXXV 205
           T       ++++ WV++ I NLF V+ YGE EF  + +KVL                   
Sbjct: 194 TDPKYRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPE 253

Query: 206 TGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPR 265
            G +G +Y+ +PG +       +   ARF G  S  + AAF+F G+EL+GI A E  EPR
Sbjct: 254 GGYIGGKYFHDPGAF-----VGDTAGARFQGVCSVFVTAAFSFAGSELIGIAAAESAEPR 308

Query: 266 KTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY-VSSSPFIITIQNAGTKI 324
           K+VPKA K+V +RI +FY+ SLL++GLLVPY D +L    S   ++SPF+I I + G + 
Sbjct: 309 KSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAASPFVIAITSHGIRG 368

Query: 325 LPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMF 384
           LP + N VILI ++S GNS VY  SR L  LA+    PK F    ++G P   + FTS F
Sbjct: 369 LPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRPLFGIAFTSAF 428

Query: 385 GSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAM 444
           G +A++  +    + F WLL + G++  F W  I   HIRF  AL  +G S ++LP+KA 
Sbjct: 429 GLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGRSTDELPFKAP 488

Query: 445 LMPWLAYYAVFFMVIIIVIQGFTSFAP---KFKVANFFAAYISVFLFIIFWVAFQIWFKC 501
              + + + +F +V++ + Q + +  P   K     FF +Y+S  + + F+   +++ + 
Sbjct: 489 AGIYGSMWGLFMIVLMFMAQFYVALFPPGGKPSAEVFFQSYLSFPVVLAFYFGHKLYARN 548

Query: 502 -RLVWKLQDVDLDTDRRDIEEEVWSDDVEDKN-----KNWWDRFWNY 542
            +L+  L  +D+DT RR+++ +V   ++ ++      + WW R++++
Sbjct: 549 WKLLIPLSKLDIDTGRREMDLDVLRQEIAEEKQMMSTRPWWYRWYSF 595

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  261 bits (666), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 168/527 (31%), Positives = 276/527 (52%), Gaps = 20/527 (3%)

Query: 29  QEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVT 88
           +  +  ++ +LK RH+ M                +             +   GT++F++ 
Sbjct: 82  KTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMV 141

Query: 89  QSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTM 148
            +LGE+    PV+  F  +A RF+  +FG AN + Y F W +   LE+      + +W  
Sbjct: 142 MALGELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWET 201

Query: 149 AVPLA-AWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTG 207
            V     ++++ W+++ I N+F VR YGE EF  + +KV+                   G
Sbjct: 202 PVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPVG 261

Query: 208 PVGF-RYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRK 266
                RYW +PG +     + +    RF G+ S  + AAF+F G+ELVGI + E + PRK
Sbjct: 262 GYVGGRYWHDPGAF-----AGHSPGRRFKGFCSVFVTAAFSFAGSELVGIASAESKNPRK 316

Query: 267 TVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL-QSNDSYVSSSPFIITIQNAGTKIL 325
           +VP+A K+V +RIL+FYI  LL++GLLVPY DP+L  S+    S+SPF+I I   G   L
Sbjct: 317 SVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFVIAIVTHGISGL 376

Query: 326 PHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFG 385
           P + N VILI+++S GNS++Y  SR L  L++    PK      + G P V +   S FG
Sbjct: 377 PSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICSGFG 436

Query: 386 SLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAML 445
            +A++  +   ++ F WLL I G++ F  W  I   HIRF  ALK  G S ++LP+K+ +
Sbjct: 437 LIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFKSPV 496

Query: 446 MPWLAYYAVFFMVIIIVIQGFTSFAPKFKVAN---FFAAYISVFLFIIFWVAFQIWFKC- 501
               +Y+ +   V+++V Q + +  P     N   FF+AY++  + + F++A ++W +  
Sbjct: 497 GIIGSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLAFYIAHKLWKRNW 556

Query: 502 RLVWKLQDVDLDTDRRD-----IEEEVWSDDVEDKNKNWWDR---FW 540
           +L+  L+D+D+DT RR+     +++E+  +      + WW R   FW
Sbjct: 557 KLLIPLKDIDIDTGRRETDINLLKQEIAEEKAALAMRPWWYRVYVFW 603

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  260 bits (665), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 159/541 (29%), Positives = 270/541 (49%), Gaps = 25/541 (4%)

Query: 17  DTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXX 76
           +T +  + L D +     ++R ++ RH++M                +             
Sbjct: 66  ETASVQTDLTDGR-----LRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIG 120

Query: 77  YLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALE 135
           Y  +  V + + Q+ GEM    P +  +F  ++  F+S  FG A+ ++Y   W   F LE
Sbjct: 121 YAAVSVVAYIMMQAAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLE 180

Query: 136 LSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXX 194
           L      I++WT +V    +I+I +V +   + F  R YGE EF     KVL        
Sbjct: 181 LITASLTIKYWTDSVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVIL 240

Query: 195 XXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELV 254
                      +G +G RYW +PG + +G  +S     +F G+   L+   F++ GTEL 
Sbjct: 241 AIVINCGGAGNSGYIGARYWHDPGAFAVGDPAS-----KFKGFCYVLVTGYFSYGGTELY 295

Query: 255 GITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL--QSNDSYVSSSP 312
            +T  E   PR+ +  A K+ ++RILV Y+ ++++IG LVP+   +L      S   +SP
Sbjct: 296 AMTVNEQSSPRRAIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASP 355

Query: 313 FIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAG 372
           +++ +   G K++PHI NAVILI ++S GNS +Y G R+L  LA+   APKF     +AG
Sbjct: 356 YVLAVSLHGVKVVPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAG 415

Query: 373 VPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQR 432
            P + ++  S+ G LA++  +   +  FTWL  I G++  F W  I  SHIRF +A+K  
Sbjct: 416 RPLMALIACSVIGLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYH 475

Query: 433 GISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISVFL 487
           G S + L YK++   W + Y V F +++ V Q + + AP     K  V +FF +Y++  L
Sbjct: 476 GYSLSQLGYKSITGLWGSIYGVCFNILVFVAQFWVALAPIGNNGKTDVLSFFQSYLAFPL 535

Query: 488 FIIFWVAFQIWFKCRLVWK-LQDVDLDT-----DRRDIEEEVWSDDVEDKNKNWWDRFWN 541
           + +F++ + ++    ++ + L+D+D++      D   IE+E        +N NW  R  +
Sbjct: 536 WFVFFLGYMVYSGEWMILRPLKDIDINHFRCVYDEERIEQEKLEHKTMLQNSNWLGRLKH 595

Query: 542 Y 542
           +
Sbjct: 596 F 596

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  261 bits (666), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 157/534 (29%), Positives = 268/534 (50%), Gaps = 26/534 (4%)

Query: 12  QVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXX 71
            VD   +P+    ++ D E  + +K+ L+ RH+ +                         
Sbjct: 92  DVDVEKSPS----VEGDNEPHK-LKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPA 146

Query: 72  XXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTV-----FAQRFLSPAFGAANGYMYWF 126
                Y+ +  V++ +  +LGEM  F+P   S +         R++  + G A G+ Y++
Sbjct: 147 GLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFY 206

Query: 127 SWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKV 186
            + +  A E +    ++++WT AVP   WI+I   ++ + NL  V++YGE EFW AS+K+
Sbjct: 207 CYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKI 266

Query: 187 LXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLI 242
           L                   GP    +GFRYW++PG +   +   ++    F    + +I
Sbjct: 267 LCIVGLIILSFILFWGG---GPNHDRLGFRYWQHPGAFAHHLTGGSL--GNFTDIYTGII 321

Query: 243 NAAFTF-QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL 301
             AF F  G ELV +T+ E  + R+ + KA ++ V+R++ FY+   L I ++VPYNDP L
Sbjct: 322 KGAFAFILGPELVCMTSAECADQRRNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSL 381

Query: 302 ----QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAK 357
                       SSPF+I IQNAG K+LPHI N  IL +  SA N+ ++  +R L  +A+
Sbjct: 382 VNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQ 441

Query: 358 NKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLL 417
              APK     ++ GVPYV V  + +   LAY+  ++     F W  NI  ++GF  W+ 
Sbjct: 442 TGQAPKCLGRINRWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMC 501

Query: 418 ISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKF-KVA 476
              +++RF KA+   G+  + LP+K    P+  + ++  + II +  G+  F PK+ K+A
Sbjct: 502 GCIAYLRFRKAIFYNGL-FDRLPFKTWGQPYTVWASLIVVGIITLTNGYAIFIPKYWKIA 560

Query: 477 NFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVED 530
           +F AAYI++ +F++ W   +++ +    W L   ++D     IE E  S ++E+
Sbjct: 561 DFIAAYITLPIFLVLWFGHKLYTRTWSQWWLPVSEIDVTTGLIEIEEKSREIEE 614

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  259 bits (661), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 164/543 (30%), Positives = 274/543 (50%), Gaps = 20/543 (3%)

Query: 5   QPQVHSFQVDSNDTPTTIS------TLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXX 58
           +P+++   VD      ++        L +D+ K   +K+ LK+RHI M            
Sbjct: 16  KPKIYEEDVDEEHDIVSVEETVKRGVLHNDRTK---LKQGLKERHIKMLTLVGVFGTGLF 72

Query: 59  XXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGA 118
                             YLF+G VV     ++ E+ +F+P T +    A++F+  + G 
Sbjct: 73  LSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVGF 132

Query: 119 ANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIE 178
             G++  +S  M    ELS    I+++WT   P A +I++  +L  ++N++ +R YGE+E
Sbjct: 133 TFGWISTYSSLM--PGELSATAVIMRYWTDVSP-AVFITVFGILFVVTNIYTIRFYGELE 189

Query: 179 FWIASVK-VLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGW 237
           +    +K VL                     +GF YW+ PGP+   ++  ++   +F G+
Sbjct: 190 YIFGWLKLVLIFILIISGLVIDLGGTKGQERLGFHYWREPGPFANYLVGGHI--GKFVGF 247

Query: 238 VSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN 297
            +++ +  +++ G + + I AGE +  R  +    K V  RI+V Y+ ++ ++ L+VPYN
Sbjct: 248 WAAISSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFLRIIVLYLVTVFILTLIVPYN 307

Query: 298 DPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAK 357
           D  + +      SSPF+I +  AG K+LPHI NA+IL +  SAGN  +  GSR L+ LA 
Sbjct: 308 DKLIATGTGTARSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLAT 367

Query: 358 NKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLL 417
              APK F  TSK G+PYV V+F S F  LAYM  +      F W   +V       W+L
Sbjct: 368 KNQAPKIFLRTSKRGIPYVGVIFISSFLPLAYMSCSKSSATVFGWFQELVSSNTLLRWIL 427

Query: 418 ISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVA 476
           IS +HI   +ALK +G SR+DLPY   + P+ A+++     I ++  GF +F    F + 
Sbjct: 428 ISANHIHMDRALKAQGYSRSDLPYSTPMGPFAAWFSGIMSFIFLLTGGFYNFIHGHFDIE 487

Query: 477 NFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWW 536
           +FF  Y  + L I  +  ++++ K + + +  +VDL++   DI+E   + +   K KN W
Sbjct: 488 SFFTRYFIIPLAIGLFTFWKLFKKTKYL-RPHEVDLESIFDDIKE---NPEHIVKTKNAW 543

Query: 537 DRF 539
            RF
Sbjct: 544 ARF 546

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  260 bits (665), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 158/537 (29%), Positives = 266/537 (49%), Gaps = 34/537 (6%)

Query: 8   VHSFQVDSNDTPTTIS---------TLDDDQE---------KQQDVKRELKKRHISMXXX 49
           + SF+    + P+T+          TL+  ++         K +++K  +K RH+ M   
Sbjct: 78  IDSFKRADKEQPSTLEHDLTKTFEGTLEPSEDGTQPAEVAGKSEELKHSIKPRHVIMISL 137

Query: 50  XXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCT-FIPVTASFTVFA 108
                                      Y  MG+ ++ + Q+ GEM   +  +   F  + 
Sbjct: 138 GTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGEMAVLYSKLIGGFNSYP 197

Query: 109 QRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISN- 167
              + PA G +  ++Y   W     LEL      I++WT  V    ++ I +VL+ + N 
Sbjct: 198 SFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYVLIILINV 257

Query: 168 LFPVRIYGEIEFWIASVKVLXXXXX-XXXXXXXXXXXXVTGPVGFRYWKNPGPW-GMGII 225
           L     Y E EF+  S K+L                    G +G RYW +PG + G   I
Sbjct: 258 LGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDGYIGGRYWHDPGAFRGEHAI 317

Query: 226 SSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIG 285
                  RF G VS+L+NAAF F  +E++G+TA E   PRK +P A KK+++RI+  Y+G
Sbjct: 318 D------RFKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKAIPSAAKKMIYRIVCIYLG 371

Query: 286 SLLVIGLLVPYN-DPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSN 344
           S++++G LVP+N D  L S+   V +SP+++ +   G +++PH  NAVIL++++S  NS 
Sbjct: 372 SVVIVGFLVPWNSDQLLGSSGGGVKASPYVLAVSTHGVRVVPHFINAVILLSVLSVANSA 431

Query: 345 VYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLL 404
            Y  SR+L GLA+   APK F    + G P + +   ++   +++  T+   D+ F WLL
Sbjct: 432 FYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVNVISFCATSPKEDQVFVWLL 491

Query: 405 NIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQ 464
            I G++  F W  I  SHIRF +A+  +G S  ++ +K+    W ++YA   M++I++ Q
Sbjct: 492 AISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQCGVWGSWYAFIMMMLILIAQ 551

Query: 465 GFTSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDR 516
            + + AP    +  V  FF  Y++  + I  +  ++I+ K  RL  + +D+DLD +R
Sbjct: 552 FWVAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIYTKDWRLFIRAKDIDLDINR 608

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  259 bits (663), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 154/529 (29%), Positives = 266/529 (50%), Gaps = 19/529 (3%)

Query: 28  DQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSV 87
           D +  + +K+ ++ RH+ M                              Y  M T ++ V
Sbjct: 92  DNQINEKLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYCV 151

Query: 88  TQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146
            Q++GEM   ++ +   F+ +    + P    A  ++Y   W     LEL      IQ+W
Sbjct: 152 MQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQYW 211

Query: 147 TMAVPLAAWISIVWVLLTISNLFP-VRIYGEIEFWIASVKVLXXXXX-XXXXXXXXXXXX 204
           T  V    ++ I ++L+   N+F   R Y E EF+    K+L                  
Sbjct: 212 TTKVNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGGAG 271

Query: 205 VTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEP 264
            +G +G RYW +PG +      + +N  RF G VS+L+ AAF F GTE + ITA E   P
Sbjct: 272 NSGFIGARYWHSPGAFRG---DNGIN--RFKGIVSTLVTAAFAFGGTEFLAITASEQANP 326

Query: 265 RKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL-QSNDSYVSSSPFIITIQNAGTK 323
           RK +P A KKV++R L+ Y+GS++++G LVPYN  +L  S+     +SP++I + + G +
Sbjct: 327 RKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKASPYVIAVASHGIR 386

Query: 324 ILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSM 383
           ++PH  NAVILI++ S  +S  Y  SR+L  LA+   APK FT   K G P +  +  ++
Sbjct: 387 VVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVGAI 446

Query: 384 FGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKA 443
              +++   ++     F WLL+I G++  F W +IS SHIRF +A+K +G S +++ +K+
Sbjct: 447 IAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGFKS 506

Query: 444 MLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWF 499
               W + YA   M+++++ Q +    P         +FF AY+++ +FI+ +  ++IW 
Sbjct: 507 QAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYFGYKIWN 566

Query: 500 KC-RLVWKLQDVDLDTDRRDIEEEVWSDDVED-----KNKNWWDRFWNY 542
           +  RL  + +++DL   R   + E+   + ++     +N   W + +N+
Sbjct: 567 RDWRLFIRAKNIDLIAHRHIYDPELLRQERKEMRERARNAPLWRKIYNF 615

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  258 bits (659), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 149/480 (31%), Positives = 259/480 (53%), Gaps = 22/480 (4%)

Query: 77  YLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALEL 136
           ++ + T +F+V  SLGE+    P+   F V+  RF+ P+ G A    Y   W +   LEL
Sbjct: 85  WVIISTCLFTVINSLGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLEL 144

Query: 137 SVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXXX 195
                 I++W   +   AW++I +V + ++N+  V+ +GE EF ++ VK+L         
Sbjct: 145 VAASLTIKYWNDKINSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILG 204

Query: 196 XXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVG 255
                      G +GF+YW NPG +  G      N ++F G  S  + AAF+F G E++ 
Sbjct: 205 IVLASGGGPSGGYLGFKYWNNPGAFVGG-----TNASKFKGLCSVFVTAAFSFSGIEMIA 259

Query: 256 ITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV--SSSPF 313
           ++A E + PRK +PKA K+  + +   Y+  L ++G LVPYND +L +  + V  ++SP 
Sbjct: 260 VSAAESKNPRKVIPKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPL 319

Query: 314 IITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGV 373
           +I I+N G K LP + NA+ILI I+S  NS VY  SR +  +A     PK  +   K G 
Sbjct: 320 VIAIENGGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGR 379

Query: 374 PYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRG 433
           P   ++ T +FG L+++  +   ++ FTWL  + G++  F W+ I+ S IRF +A++ + 
Sbjct: 380 PMNALIVTLIFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQN 439

Query: 434 ISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFI 489
            S ++LPY +    W A+Y V  + ++IV   +TS  P         +FF +++S+ + +
Sbjct: 440 RSLDELPYLSQTGIWGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILL 499

Query: 490 IFWVAFQIWFKCRLVWKLQ----DVDLDTDRRDIEEEVWSDDVEDK----NKNWWDRFWN 541
           + +   +++F     W+LQ    ++D+D+ R+ I+EE    + E++    N ++  +FW+
Sbjct: 500 VCYFGHKLYFARN--WRLQIGAEEMDIDSGRKIIDEEGLKQEREEEEKAMNSSFLIKFWH 557

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  258 bits (660), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 154/533 (28%), Positives = 268/533 (50%), Gaps = 18/533 (3%)

Query: 15  SNDTPTTISTLDDDQEKQQDVK-----RELKKRHISMXXXXXXXXXXXXXXXXRXXXXXX 69
           +ND  ++  + D+D  +Q D+      ++L  RH+                         
Sbjct: 61  TNDITSSERSRDNDDVEQVDINNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGG 120

Query: 70  XXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWA 129
                  ++ +GT +F+V  SLGE+    PV   F V+  RF+ P+F  A    Y   W 
Sbjct: 121 PASLVIDWVIIGTCLFTVINSLGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWL 180

Query: 130 MTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXX 189
           +   LEL      I++W   +   AW++I +  + ++N+  V+ +GE EF ++ +K+L  
Sbjct: 181 VLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSI 240

Query: 190 XX-XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTF 248
                             G +G +YW+NPG +    +  N +  +F G  S  + AAF++
Sbjct: 241 IGFSILGIVLSCGGGPHGGYIGGKYWRNPGAF----VGHN-SGTKFKGLCSVFVTAAFSY 295

Query: 249 QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV 308
            G E+  ++A E + PR+T+PKA K+  + I   Y+  L +IG LVP NDP+L +  S V
Sbjct: 296 SGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSV 355

Query: 309 --SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFT 366
             +SSP +I I+N   K LP + NA+ILI ++S  NS VY  SR +  +A     PKF  
Sbjct: 356 DAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLN 415

Query: 367 NTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFM 426
              K G P   +L T  FG L+++  +    + FTWL  + G++  F W+ I+ SHIRF 
Sbjct: 416 RVDKRGRPMNAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFR 475

Query: 427 KALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAY 482
           KA+K +  S ++LP+ +      ++Y    + ++++   +TS  P         +FF  Y
Sbjct: 476 KAMKVQERSLDELPFISQTGVLGSWYGFVVLFLVLIASFWTSLFPIGSSGASAESFFEGY 535

Query: 483 ISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKN 534
           +S  + I+ +   +I+ +   L+ K++D+DLDT R+ ++  +  ++++ + +N
Sbjct: 536 LSFPILIVCYFGHKIYTRNWTLMVKIEDIDLDTGRKQVDLTLRREEMKIEREN 588

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  258 bits (660), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 160/524 (30%), Positives = 260/524 (49%), Gaps = 18/524 (3%)

Query: 23  STLDDDQEK---QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLF 79
           S L+D  E       +K+ +K RH+ M                +             Y+ 
Sbjct: 76  SDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYIL 135

Query: 80  MGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSV 138
           +  V + + Q+ GEM    P + A+F  ++  F+S +FG A  ++Y F W     LEL  
Sbjct: 136 VSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELIT 195

Query: 139 VGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXX 198
               IQFW   +    +I I +V L   + F V+ YGE EF     K+L           
Sbjct: 196 ASMTIQFWNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIV 255

Query: 199 XXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGIT 257
                    G +G  YW NPG +     + + +  RF      L+ A F+F G EL  ++
Sbjct: 256 INCGGAGNDGYIGATYWHNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGGMELFALS 310

Query: 258 AGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ-SNDSYVSSSPFIIT 316
             E   PRK+ P A K+ ++RI+V Y+ ++++IG  VPYND +L  +  S   +SP+++ 
Sbjct: 311 VQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLA 370

Query: 317 IQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYV 376
               G KI+PHI NAVILI+++S  NS++Y G R++  LA+   APKF     + G P  
Sbjct: 371 ASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLR 430

Query: 377 TVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISR 436
            ++   +FG +A++  ++  +  FTWL  I G++  F W  I  SH+RF +A+K +G S 
Sbjct: 431 ALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSL 490

Query: 437 NDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISVFLFIIF 491
           ++L YKA    W + Y VFF +++ V Q + + AP     K    +FF  Y++  +++ F
Sbjct: 491 DELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAF 550

Query: 492 WVAFQIWFK-CRLVWKLQDVDLDTDRRDIEEEVW-SDDVEDKNK 533
           +  + ++ +   L+  L  +DLD  RR  + E+   +D E+K K
Sbjct: 551 YFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEK 594

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  260 bits (664), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 154/536 (28%), Positives = 269/536 (50%), Gaps = 30/536 (5%)

Query: 12  QVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXX 71
           ++D   +P+      D       +K+ L+ RH+ +                         
Sbjct: 144 ELDLEKSPSA-----DGDAGPHRLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPA 198

Query: 72  XXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTV-----FAQRFLSPAFGAANGYMYWF 126
                Y+ +  V++ +  +LGEM  F+P   S +         R++  + G A G+ Y++
Sbjct: 199 GLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYY 258

Query: 127 SWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKV 186
            + +  A E +    ++++WT AVP   WI+I   ++ + N   V++YGE EFW AS+K+
Sbjct: 259 CYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVLLNFSAVKVYGESEFWFASIKI 318

Query: 187 LXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLI 242
           L                   GP    +GFRYW++PG +   +   ++    F    + +I
Sbjct: 319 LCIVGLIILSFILFWGG---GPKHDRLGFRYWQHPGSFAHHLAGGSL--GNFTDIYTGII 373

Query: 243 NAAFTF-QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL 301
             AF F  G ELV +T+ E  + R+ + KA ++ V+R++ FY+   L I ++VPYNDP L
Sbjct: 374 KGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAITVIVPYNDPSL 433

Query: 302 ----QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAK 357
                       SSP++I IQNAG K+LPHI N  IL +  SA N+ ++  +R L  +A+
Sbjct: 434 VNALAQGKPGAGSSPYVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQ 493

Query: 358 NKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLL 417
              APK     ++ GVPYV V  + +   LAY+  ++     F W  NI  ++GF  W+ 
Sbjct: 494 TGQAPKCLGKINRFGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWIC 553

Query: 418 ISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKF-KVA 476
              +++RF KA+   G+  + LP+K    P+  ++++  + II +  G+  F PK+  VA
Sbjct: 554 GCIAYLRFRKAIFFNGL-YDRLPFKTWGQPYTVWFSLTVVSIITITNGYAIFIPKYWNVA 612

Query: 477 NFFAAYISVFLFIIFWVAFQIWFKCRLVW--KLQDVDLDTDRRDIEEEVWSDDVED 530
           +F AAYI++ +F++ W+  +++ +    W   + ++D+ T   +IEE+  S D+E+
Sbjct: 613 DFIAAYITLPIFLVLWLGHKLYTRTWNHWWHSVSEIDVTTGLVEIEEK--SRDIEE 666

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  258 bits (658), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 166/565 (29%), Positives = 278/565 (49%), Gaps = 32/565 (5%)

Query: 4   NQPQVHSFQVD--------SNDTP--TTISTLDDDQEKQQDVKRELKK----RHISMXXX 49
           +  QVHSF  +        S D+P    I         ++D+ + L K    RH+     
Sbjct: 33  SSSQVHSFTSNTPSPFNEKSKDSPIEDNIDITSQSSVTKEDINKSLNKDLSIRHLLTLAV 92

Query: 50  XXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQ 109
                                      ++ + T +F+V  SLGE+    PV   F V+  
Sbjct: 93  GGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINSLGELAAAFPVVGGFNVYIT 152

Query: 110 RFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLF 169
           RF+ P+F  A    Y   W +   LEL      I++W   +   AW++I + ++T++N+ 
Sbjct: 153 RFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNSTINSDAWVAIFYTVITLANML 212

Query: 170 PVRIYGEIEFWIASVKVLXXXX-XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSN 228
            V+ +GE EF ++ VK+L                    G +G +YW NPG +       +
Sbjct: 213 DVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYLGGKYWHNPGAF-----VGH 267

Query: 229 VNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLL 288
            +  +F G  S  + AAF++ G E+  ++A E ++PRKT+PKA K+  + I   Y+  L 
Sbjct: 268 TSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIPKAAKRTFWLITASYVTILT 327

Query: 289 VIGLLVPYNDPKLQSNDSYV--SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVY 346
           ++G LVPY+DP+L S  S V  ++SP +I I+N G K L  + NA+ILI+IIS  NS VY
Sbjct: 328 LVGCLVPYDDPRLMSGTSSVDAAASPLVIAIENGGIKGLDSLMNAIILISIISVANSAVY 387

Query: 347 IGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNI 406
             SR +  +A     PK      K G P    L T  FG L+++  +   ++ FTWL  +
Sbjct: 388 ACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLLSFIAASDKQNEVFTWLSAL 447

Query: 407 VGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGF 466
            G++  F W+ I+ SHIRF +A+ ++  S +++PY +    W + Y V  + +++V   +
Sbjct: 448 SGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFW 507

Query: 467 TSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIE- 520
           TS  P       V +FF  Y+S+ + I+ ++  +++FK    V  L+++DLDT R+ ++ 
Sbjct: 508 TSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLYFKNWSWVVTLEEMDLDTGRKALDP 567

Query: 521 ----EEVWSDDVEDKNKNWWDRFWN 541
                EV +++      ++  RFW+
Sbjct: 568 HLHRAEVIAEEAAVAKMSFIKRFWH 592

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  258 bits (658), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 166/561 (29%), Positives = 273/561 (48%), Gaps = 45/561 (8%)

Query: 5   QPQVHSFQ--VDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXX 62
           QP  + FQ  +DS   P       D      ++KR LK RH+ M                
Sbjct: 59  QPPRNIFQRCIDSFKPPL------DGSFHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSG 112

Query: 63  RXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGY 122
           +             +   GT +      LGE+    PV  +F  ++ RFL P+       
Sbjct: 113 QALASGGPLALIIGWSIAGTQIVGTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVIST 172

Query: 123 MYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIA 182
           +Y   W     LE+      IQ+W  ++    W++I + ++   NLF  R +GE EF  +
Sbjct: 173 IYVIQWFFVLPLEIIASAMTIQYWNQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFS 232

Query: 183 SVKVLXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWV 238
           S+KV+                   GP    VG RYW +PG    G          F G +
Sbjct: 233 SIKVITIIGFIILCIVLICG---GGPDHDFVGARYWHDPGCLSHG----------FPGVL 279

Query: 239 SSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYND 298
           S L+ A+++  GTE+V + +GE   PR+ +P AIK+  +RIL F++ SL +IG LVPY +
Sbjct: 280 SVLVVASYSLGGTEMVCLASGETN-PRE-LPSAIKQTFWRILFFFLISLTLIGFLVPYTN 337

Query: 299 PKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKN 358
           P L    S V++SPF+I I+    K LP I NAVILI+I+S GNS ++  SR L  +A  
Sbjct: 338 PNLLGGSS-VNNSPFVIAIKLHHIKALPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQ 396

Query: 359 KAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLI 418
              PKFF    +AG P   +L  S+FG LA++  ++   + F WL+ I G+A    WL I
Sbjct: 397 GLIPKFFGYIDRAGRPLTGILTNSLFGLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSI 456

Query: 419 SCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP------- 471
           + SHIRF  A+K +G S ++L + + +  W + Y+     +I++ Q + +  P       
Sbjct: 457 NISHIRFRLAMKAQGKSLDELEFVSAVGMWGSAYSALINSLILIAQFYCALWPIGGWKDS 516

Query: 472 KFKVANFFAAYISVFLFIIFWVAFQIWFKCRL-----VWKLQDVDLDTDRRDIEEEVWSD 526
             +   FF +Y+   +    +V  +++++ +      +  L  +DL+TDR++I+ +V   
Sbjct: 517 SERAKTFFQSYLCALIMAFLFVCHKVFYRYKTGKWWAIMDLDKIDLETDRKNIDIDVLKQ 576

Query: 527 DVEDKNKN-----WWDRFWNY 542
           ++ ++N++     W+ R++++
Sbjct: 577 EIAERNRHLQASPWYVRWYHF 597

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  256 bits (655), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 181/561 (32%), Positives = 279/561 (49%), Gaps = 38/561 (6%)

Query: 1   MKLNQPQVHSFQVDSN-DTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXX 59
           +K++  +   ++V S+ D     S  D +Q  ++D+ R L  RHI+M             
Sbjct: 11  VKVDSGKQEIYEVSSSLDIDELRSDFDPEQNIREDLTRALSPRHINMISIAGIIGTGLYL 70

Query: 60  XXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAA 119
              +             Y  +G VV+     LGEM TF+P++ SF  +A++F S +F  A
Sbjct: 71  STAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGEMSTFMPISGSFCSYARKFGSESFACA 130

Query: 120 NGYMYWFSWAMTFALELSVVGQIIQFWTMA---VPLAAWISIVWVLLTISNLFPVRIYGE 176
             + YWF+ A++ A +L+ +  ++ +W  A    P      I W  +   N+  VRIYGE
Sbjct: 131 LMWNYWFNDAVSVASDLTALQLVLDYWHTADHHFPYWGASLIFWFFVLFLNVIHVRIYGE 190

Query: 177 IEFWIASVKVLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFF- 235
            E+W+A +KV+                 +   VG    KNP    +G  +    EA F  
Sbjct: 191 AEYWLAMLKVIAIVIFFIMS--------IIVNVG----KNPQHEYIGFKNWTHGEAPFVN 238

Query: 236 ---GWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGL 292
              G+ S  ++A F + GTE + +T GE   P +  PK +K V +RIL+FY+ S   IG+
Sbjct: 239 GFKGFASLFVSACFAYGGTESITLTGGEASNPVRNTPKIVKTVFWRILIFYVLSTFFIGM 298

Query: 293 LVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRIL 352
            +PY+ P L +    V +SPF +  Q AGT+      NAVIL ++ISA N  ++ GSRI+
Sbjct: 299 NIPYDYPGLSTKS--VMTSPFTLVFQMAGTRGAGSFMNAVILTSVISACNHALFAGSRIM 356

Query: 353 YGLAKNKAAP-KFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAG 411
           Y +A +   P K    T++   PYV VL T   G L    +  G    +TWL NIVGV+ 
Sbjct: 357 YNMALDGYLPKKIVGRTNRYKAPYVAVLITWAVGGLCLGASFIGAGTLWTWLQNIVGVSN 416

Query: 412 FFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP 471
             AWL I  + IRF K L+ +G   + L +K    P+  Y+ V F V II+IQG+ +F P
Sbjct: 417 QIAWLCIGITSIRFRKGLEVQG-KTDLLQFKNWTYPFGPYFLVIFTVFIILIQGWQAFDP 475

Query: 472 KFKVANFFAAYISVFLF----IIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDD 527
            + V +FF+ Y+ +F+F    II+W+  + WF      K +D+D  TDR    +E+   +
Sbjct: 476 -WSVTDFFSVYLELFVFPFVYIIWWLWKRDWFV-----KYEDMDFVTDRYIPTKEIVELN 529

Query: 528 VEDKNKNWWDR----FWNYVA 544
               N   W +    F +Y+A
Sbjct: 530 ERLDNLKGWKKVRQIFSDYIA 550

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  256 bits (654), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 171/527 (32%), Positives = 259/527 (49%), Gaps = 22/527 (4%)

Query: 15  SNDTPTTISTLDDDQ-EKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXX 73
           S + P T +    +Q +    VKR LK RHIS+                           
Sbjct: 23  SKEEPDTHNIKSFEQFDPNTGVKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPLSL 82

Query: 74  XXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFA 133
              +  +G V F+V +S+GEM T  P  + F+  ++RF S A  A +GY Y   +    A
Sbjct: 83  LLGFGIIGIVAFAVMESIGEMITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAVLA 142

Query: 134 LELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXX 193
            E + +  I+QFW   VPL  +I I  V   +  +  V I+GE E+W+A  K++      
Sbjct: 143 NEYNTLSSILQFWGPQVPLYGYILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIAYY 202

Query: 194 XXXXXXXXXXXVTGPV-GFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTE 252
                         P  GF YW NPG    G          F G     +  +  + GTE
Sbjct: 203 IFSIIYISGGIKNRPAFGFHYWNNPGALADG----------FKGIAVVFVFCSSFYSGTE 252

Query: 253 LVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSP 312
            V + A E + P K VP AIK+  +RI++ Y+G  +  G  VPYND  L ++   + S P
Sbjct: 253 SVALAATESRNPGKAVPIAIKQTFWRIIIVYLGIAVFYGATVPYNDTSLGAHTKALKS-P 311

Query: 313 FIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAG 372
             I I  AG +   H+ NA ILIT +SA N ++YIGSR L  LA    APKF   T K G
Sbjct: 312 IAIAITRAGWEGGVHLVNAFILITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDKRG 371

Query: 373 VPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQR 432
           VP   +   +  G ++ M  + G   A+++++N+ GV  F  W +IS +H+RF KA   +
Sbjct: 372 VPIPAITLFNALGLVSLMNVSVGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWDLQ 431

Query: 433 GISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYI----SVFLF 488
           G S ++LPYK++L PW   +++   + + +IQG+T+F P F   +F  AYI    +V L+
Sbjct: 432 GRSASELPYKSLLFPWGPIFSLAANIFLGLIQGWTTFVP-FSAKDFVDAYILLPAAVILY 490

Query: 489 IIFWVAFQIWFKCRLVWKLQDVDLDTDRR-DIEEEVWSDDVEDKNKN 534
           I+  +     FK   +  L+ VDL+  RR D++ +   +D E K+++
Sbjct: 491 IVISLVKIGGFK---LVDLRTVDLEEGRREDLDSDGTDEDSEGKDRS 534

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  258 bits (658), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 157/537 (29%), Positives = 267/537 (49%), Gaps = 21/537 (3%)

Query: 9   HSFQVDSN--DTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXX 66
           H+ Q++ N  D    +++   D +    +K+ +K RH+ M                +   
Sbjct: 67  HTKQINENTSDLEGDVNSFTSDSK----LKKSMKSRHVVMMTLGTGIGTGLLVANAKGLH 122

Query: 67  XXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYMYW 125
                     Y  +  V + + Q+ GEM    P + A+F  ++  F+S  FG A  ++Y 
Sbjct: 123 YGGPAALVIGYFLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYC 182

Query: 126 FSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVK 185
           F W     LEL      I+FW   +    +I I +V L   + F V+ YGE EF     K
Sbjct: 183 FQWLTVLPLELITAAMTIKFWNDTINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCK 242

Query: 186 VLXXXXXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINA 244
           +L                    G +G +YW+NPG +     + + +  RF      L+ A
Sbjct: 243 ILMIAGFIILSVVINCGGAGNDGYIGGKYWRNPGAF-----AGDTSAGRFKNVCYILVTA 297

Query: 245 AFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ-S 303
            F+F G EL  ++  E   PRKT P A K+ ++RILV Y+ ++++IG  VPYND +L  +
Sbjct: 298 YFSFGGMELFALSVQEQANPRKTTPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGA 357

Query: 304 NDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPK 363
             S   +SP+++     G K++PHI NAVILI++IS  NS++Y G R++  LA+    PK
Sbjct: 358 GGSATHASPYVLAASIHGVKVVPHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPK 417

Query: 364 FFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHI 423
           F     + G P + ++  S+FG + ++  ++  +  F WL  I G++  F W  I  SH+
Sbjct: 418 FLDYVDREGRPLIALIVCSVFGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHL 477

Query: 424 RFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANF 478
           RF +A+K +G S ++L YKA    W + Y VFF +++ + Q + + AP     K    +F
Sbjct: 478 RFRQAMKVQGRSLDELGYKATTGIWGSAYGVFFNILVFIAQFWVALAPLNNGGKCSAESF 537

Query: 479 FAAYISVFLFIIFWVAFQIWFK-CRLVWKLQDVDLDTDRRDIEEEVW-SDDVEDKNK 533
           F +Y++  ++I F++ + I+ +    +  L  +DLD  R   + E+   +D+E++ +
Sbjct: 538 FQSYLAFPIWIAFYLGYMIYNRDFTFLNPLDKIDLDFHRHIYDPELMRQEDLENEER 594

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  257 bits (657), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 163/533 (30%), Positives = 272/533 (51%), Gaps = 23/533 (4%)

Query: 28  DQEK------QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMG 81
           D EK      +  +K  LK RH+ M                +             +   G
Sbjct: 74  DAEKIAIATARSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTG 133

Query: 82  TVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQ 141
           T+++S+  ++GE+    PV+  FT +A RF+  +FG A  + Y   W +T  LE+     
Sbjct: 134 TMIYSMVMAVGELAVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASI 193

Query: 142 IIQFWTM-AVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXX 200
            + +W + A     ++++ WV   I NLF V+ YGE EF  A +KV+             
Sbjct: 194 TVNYWGVDAKYRDGFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILI 253

Query: 201 XXXXVTGPVGF-RYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAG 259
                 G     +YW +PG +       +    +F G+ +  I A+F+F G+E+VG+   
Sbjct: 254 CGGGPVGGYIGAKYWHHPGAF-----VGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGS 308

Query: 260 EVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY-VSSSPFIITIQ 318
           E + PRK+VP A K+V +RI +FY+  LL+IG+LVPYND +L    S   ++SPF+I + 
Sbjct: 309 ESENPRKSVPGAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAASPFVIAVV 368

Query: 319 NAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTV 378
           N G + LP + N VILI+++S GNS++Y+ SR L  LA+    PK      + G P V +
Sbjct: 369 NQGIRGLPSVINVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAI 428

Query: 379 LFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRND 438
              S FG +A++  ++   + F WLL + G++  F+W  I   HIRF +AL  +G S ++
Sbjct: 429 GIASAFGLIAFVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDE 488

Query: 439 LPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVAN---FFAAYISVFLFIIFWVAF 495
           LP+ + +    +Y+ +F  V++++ Q +    P     N   FF AY+S  + + F++  
Sbjct: 489 LPFVSTVGIAGSYWGIFICVLMLIAQFYVGLFPAGASPNAKDFFMAYLSFPIVLAFYIFH 548

Query: 496 QIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNW-----WDRFWNY 542
           +IW K  +L  K +D+D+DT RR+++ ++   +V  +  +      W R W +
Sbjct: 549 KIWKKNWKLYIKAEDMDIDTGRREVDRDLLKQEVAAERADLAARPIWYRCWKF 601

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  258 bits (659), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 161/563 (28%), Positives = 276/563 (49%), Gaps = 36/563 (6%)

Query: 4   NQPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKK----RHISMXXXXXXXXXXXXX 59
             PQ H+  +D      T  T++  ++ + D   +LKK    RH+ +             
Sbjct: 82  ENPQPHT-NLDMELVGVTSETIEQHKKDEGDTGDKLKKTIQPRHVILISLGTGIGTGLLV 140

Query: 60  XXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGA 118
                            Y  MG++++ + Q+ GEM   ++ +   F  +    + P F  
Sbjct: 141 GNGATLAQAGPAGLVIGYGIMGSLIYCIIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSF 200

Query: 119 ANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWV-LLTISNLFPVRIYGEI 177
           A  ++Y   W     LEL      I++WT  V    ++ I +V +L I+ L   R Y E 
Sbjct: 201 ATAWVYCLQWLCVCPLELVTASMTIKYWTTKVDPDVFVIIFYVFILGINILGGARGYAEA 260

Query: 178 EFWIASVKVLXXXXXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFG 236
           EF   S K+L                  T G +G RYW +PG +            RF G
Sbjct: 261 EFIFNSCKILMMIGFFILGIIIICGGAGTDGYIGGRYWHDPGAF-----RGERAVDRFKG 315

Query: 237 WVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPY 296
            V++L+ AAF+F  +E + +TA E   PR+ +P A KK+++R L  Y+ S++++G LVPY
Sbjct: 316 VVATLVTAAFSFGQSEFIAVTASEQSNPRRAIPSAAKKIIYRALCIYLASIILLGFLVPY 375

Query: 297 NDPKL---QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILY 353
           N  +L   QSN   + +SP+++ + N G +++PH  NAVI+I+++S  NS  Y   R+L 
Sbjct: 376 NSSQLLGAQSNG--IKASPYVLAVANHGVRVVPHFINAVIIISVLSVSNSAFYSSPRMLL 433

Query: 354 GLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFF 413
            L++   APK F+   +AG P + ++  S+F  +A+  T+   D+ FTWLL + G++  F
Sbjct: 434 TLSQQGFAPKIFSYVDRAGRPTMGIIVASLFAVIAFCATSPKEDQVFTWLLAVSGLSQIF 493

Query: 414 AWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-- 471
            W+ I  SH+RF +A+  +G S  +  + + +  + + Y+ F + +I+V Q + +  P  
Sbjct: 494 TWMSICLSHLRFRRAMTVQGRSLGECGFLSQVGIYGSAYSFFVLALILVGQFWVALKPVG 553

Query: 472 --KFKVANFFAAYISVFLFIIFWVAFQIWFKC-----RLVWKLQDVDLDTDRRDIEEEVW 524
             K    +FF  Y++  +    W+A  I +KC     RL  K QD+DL   R+  +E++ 
Sbjct: 554 SKKVDANSFFENYLAAPI----WIALYIGYKCYTKDWRLYIKSQDIDLVAHRQIYDEDIL 609

Query: 525 SDDVED-----KNKNWWDRFWNY 542
             + E+     KN  +W R +++
Sbjct: 610 RQEREEETERLKNGPYWKRAYSF 632

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  258 bits (660), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 158/536 (29%), Positives = 264/536 (49%), Gaps = 29/536 (5%)

Query: 4   NQPQVHSFQVDSNDTPT-----TISTLDDD--------QEKQQDVKRELKKRHISMXXXX 50
           N P+  +  + SN+        ++S LD          + K  ++K+ +K RH+ M    
Sbjct: 105 NSPEKDTASITSNEMMIDEEILSLSNLDGQRVPPPRKIENKSDELKKTIKPRHVLMISLG 164

Query: 51  XXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQ 109
                                     +  MGT ++ + Q++GEM   +  +   F  +  
Sbjct: 165 TGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQAVGEMAVAYSDLVGGFNAYPS 224

Query: 110 RFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVL-LTISNL 168
             + PAFG +  ++Y   W     LEL      I++WT  V    ++ I +VL L I+ +
Sbjct: 225 FLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTKVDPDVFVIIFYVLILAINIV 284

Query: 169 FPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVT-GPVGFRYWKNPGPW-GMGIIS 226
                Y E EF   S K+L                    G +G +YW  PG + G   I 
Sbjct: 285 GGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDGYIGGKYWHEPGAFRGEHAID 344

Query: 227 SNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGS 286
                 RF G +++L+NAAF F  +E +G+TA E   PRK +P A KK+++RI+  ++ S
Sbjct: 345 ------RFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMLYRIVCMFLAS 398

Query: 287 LLVIGLLVPYN-DPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNV 345
           + ++G LVPY+ D  L S+   V +SP+++ +   G K++PH  NAVILI+++S  NS  
Sbjct: 399 ITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVKVVPHFINAVILISVLSVANSAF 458

Query: 346 YIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLN 405
           Y  SR+L  LA+   APK F    + G P V +   S+FG +A+  T+   D+ F WLL 
Sbjct: 459 YSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGVIAFCATSPKEDEVFVWLLA 518

Query: 406 IVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQG 465
           I G++  F W+ I  SH+RF +A+  +G S  +L +++ +  W + YA   MV I++ Q 
Sbjct: 519 ISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVGAWGSSYAAIMMVCILIAQF 578

Query: 466 FTSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVW-KLQDVDLDTDR 516
           + + AP    K    NFF  Y+++ + +  +  ++I+ K   ++ + +D+DL + R
Sbjct: 579 WVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTKNWTIFIRAKDIDLVSHR 634

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  256 bits (653), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 172/533 (32%), Positives = 254/533 (47%), Gaps = 29/533 (5%)

Query: 13  VDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXX 72
           VD ++ P  +S  D +      VKR LK RHIS+                          
Sbjct: 32  VDISEEPD-VSKFDPNT----GVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLA 86

Query: 73  XXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTF 132
               +  +G + F+V +S+GE+ T  P    FT  A+RF   A  A  GY Y   +    
Sbjct: 87  LLLGFSIIGVIAFAVMESIGEIITLYPSGGGFTTLARRFHGDALSAVCGYAYVVVFFAVL 146

Query: 133 ALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXX 192
           A E + +  I+QFW   VPL  +I I W    I  L  V ++GE E+W++  K++     
Sbjct: 147 ANEYNTLSSILQFWGPQVPLYGYILIFWFAFEIFQLIGVSLFGETEYWLSWFKIVGLVAY 206

Query: 193 XXXXXXXXXXXXVTGPV-GFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGT 251
                          P  GF YW +PG    G          F G     +  +  + GT
Sbjct: 207 YIFSIIYISGGIKDRPAFGFHYWNSPGSLSHG----------FKGIAVVFVFCSTFYSGT 256

Query: 252 ELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSS 311
           E V + A E + P K VP A+++ ++R+L+ YIG  +  G  VP++DP L S  + V  S
Sbjct: 257 ECVALAATESKNPGKAVPLAVRQTLWRVLIVYIGIAVFYGATVPFDDPNL-SATTKVLKS 315

Query: 312 PFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKA 371
           P  I I  AG     H+ NA IL+T ISA N ++YIGSR L  LA    APK    T + 
Sbjct: 316 PISIAISRAGWAGGAHLVNAFILVTCISAINGSLYIGSRTLTNLAHEGLAPKILAWTDRR 375

Query: 372 GVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQ 431
           GVP   +   +  G ++ M  + G   A+++++N+ GV  F  W +IS +H+R  KA   
Sbjct: 376 GVPIPAITVFNALGLISLMNVSVGASDAYSYIVNLSGVGVFIVWGVISYTHLRVRKAWVT 435

Query: 432 RGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIF 491
           +G S  +LPYKA+L PW   +++   V + +IQG+TSF P F   NF  AYI + + I+ 
Sbjct: 436 QGRSLEELPYKALLYPWTPIFSLIANVFLALIQGWTSFVP-FDAGNFVDAYILLPVAIVL 494

Query: 492 WVAFQIW--FKCRLVWKLQDVDLDTDRR--------DIEEEVWSDDVEDKNKN 534
           +VA  ++     R+V  L+ VDLD  RR        D E  + S ++    K+
Sbjct: 495 YVAICVFKNHHFRIV-DLKSVDLDEGRRKDIDADFSDQESSLASSEITKDKKS 546

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  257 bits (656), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 154/530 (29%), Positives = 269/530 (50%), Gaps = 17/530 (3%)

Query: 15  SNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXX 74
           ++D+P   + L+      Q+ K+ +K RH+ M                +           
Sbjct: 74  ADDSPDH-NDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLV 132

Query: 75  XXYLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFA 133
             Y  +  V + + Q+ GEM    P +  SF  +   F+S  FG A  +++   W     
Sbjct: 133 IAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLP 192

Query: 134 LELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXX 193
           LEL      I++W  ++    ++ I +V L   + F V+ YGE EF   + K+L      
Sbjct: 193 LELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFI 252

Query: 194 X-XXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTE 252
                         G +G +YW +PG +     SSN   +RF G   +L+NA F++ G E
Sbjct: 253 IFAIVVNCGGAGKDGYIGGKYWHDPGAFA----SSN-GASRFKGICYNLVNAYFSYGGNE 307

Query: 253 LVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL--QSNDSYVSS 310
           L  ++  + + PRK+ P A K  V+RI+V Y+ ++++IG +VP+N  +L   S  + + +
Sbjct: 308 LFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHA 367

Query: 311 SPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSK 370
           SP+++     G K++PHI NAVILI +IS  NS++Y G R+L  LA+   AP+F +   +
Sbjct: 368 SPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDR 427

Query: 371 AGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALK 430
            G P   +L +++ G + +  T+   ++ FTWL  I G++  F W  I  SHIRF +A+K
Sbjct: 428 RGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMK 487

Query: 431 QRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISV 485
            +  S + L YKA    W +Y+ V F +++   Q + + +P     K    +FFA+Y+++
Sbjct: 488 LQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAM 547

Query: 486 FLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEE-VWSDDVEDKNK 533
            ++++F+  +  W+K   ++  L  VDLD  R+  + E +  +D+E+K +
Sbjct: 548 PIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKER 597

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  257 bits (657), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 160/533 (30%), Positives = 270/533 (50%), Gaps = 17/533 (3%)

Query: 13  VDSNDTPTTISTLDDDQEK---QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXX 69
           + ++D    ++T + + E    + ++K+ +K RH+ M                       
Sbjct: 85  IPADDKINEMTTAEPEAEMASVEDNLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAG 144

Query: 70  XXXXXXXYLFMGTVVFSVTQSLGEMCT-FIPVTASFTVFAQRFLSPAFGAANGYMYWFSW 128
                  Y  MGT V+ + QS GEM   +  +   F  +    + P F         F+ 
Sbjct: 145 PAGLVTGYAIMGTCVYCIIQSAGEMAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTM 204

Query: 129 AMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLX 188
               +  +       ++WT  V    ++ I +VL+ + N+F  R Y E EF+    KVL 
Sbjct: 205 VDCLSFGIGYCFDDYKYWTTRVDPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLM 264

Query: 189 XXXXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFT 247
                              G +G  YW+NPG +       +     F G V++L+ AAF 
Sbjct: 265 MAGFFILGIIINVGGAGNDGYLGNIYWRNPGAF-----RGDKGIDHFKGVVATLVTAAFA 319

Query: 248 FQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL-QSNDS 306
           F GTE + +TA E   PRK +P A KKV++RI++ Y+ S+++IG LVP+  P+L  S  +
Sbjct: 320 FGGTEFIALTAAEQSNPRKAIPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSA 379

Query: 307 YVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFT 366
             ++SP++I + + G +++PH  NAVIL++++S GNS  Y  SR+L  L+K   APK+F 
Sbjct: 380 ATAASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFD 439

Query: 367 NTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFM 426
              + G P   ++ +++FG +A+  T+    + FTWLL I G++  F W+ I  SHIRF 
Sbjct: 440 YVDREGRPSRAMIVSALFGVIAFCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFR 499

Query: 427 KALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAY 482
            A+K +G S  ++ +KA    W +YY++F M++ ++ Q + + AP    +    NFF  Y
Sbjct: 500 AAMKAQGRSMGEVGFKAQTGIWGSYYSIFLMILTLIGQFWVAIAPIGTAELSARNFFENY 559

Query: 483 ISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVW-SDDVEDKNK 533
           +++ + I F+  ++IW K   L  K +D+DL + R+  +EE+   +D E K K
Sbjct: 560 LAMPILIGFYFGYKIWKKDWTLYIKAEDIDLISHRQIFDEELLKQEDYELKEK 612

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  257 bits (656), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 157/513 (30%), Positives = 260/513 (50%), Gaps = 23/513 (4%)

Query: 35  VKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEM 94
           + R LK RH+ M                +             +    T++  +  SLGE+
Sbjct: 83  LSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGEL 142

Query: 95  CTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLA- 153
               PV+  +  +A RF+  ++G AN + Y     +   LE+      + +W        
Sbjct: 143 AVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKYKL 202

Query: 154 AWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGP----V 209
           A++++ WV++   NLF VR +GE E   + +KV+                   GP    +
Sbjct: 203 AFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISG---GGPDHEVI 259

Query: 210 GFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVP 269
           G +YW +PGP+       N    +F G  S  + AAF+F G+EL+G+ A E +EPRK++P
Sbjct: 260 GGKYWNDPGPF-----VGNAPSDKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIP 314

Query: 270 KAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY-VSSSPFIITIQNAGTKILPHI 328
           KA K+V +RI +FYI SLL++GLLVP N+  L +      + SPF+I +     ++LP I
Sbjct: 315 KAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHSPFVIAMDMHRIRVLPSI 374

Query: 329 FNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLA 388
            N VIL  +IS GNS+VY  SR +  LA++   PK F    + G P   + FTS+FG L 
Sbjct: 375 INVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLC 434

Query: 389 YMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPW 448
           ++       + F WLL I G++ FF WL I+ +H+RF  ALK +G + N+L + +     
Sbjct: 435 FVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGFI 494

Query: 449 LAYYAVFFMVIIIVIQGFTSFAP--------KFKVANFFAAYISVFLFIIFWVAFQIWFK 500
            + YAV  + +++V Q + +  P        K     FF  Y+S  + I+ ++A +IW +
Sbjct: 495 GSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWSR 554

Query: 501 C-RLVWKLQDVDLDTDRRDIEEEVWSDDVEDKN 532
             +   K +++D+DT RR+++ E++ +++  + 
Sbjct: 555 NWKFFIKAKEMDIDTGRRELDLELFKEELAQER 587

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  256 bits (655), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 164/561 (29%), Positives = 272/561 (48%), Gaps = 45/561 (8%)

Query: 5   QPQVHSFQ--VDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXX 62
           QP  + FQ  +DS   P       D      ++KR LK RH+ M                
Sbjct: 59  QPPRNIFQRCIDSFKPPL------DGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSG 112

Query: 63  RXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGY 122
           +             +   G+ +      LGE+    PV  +F  ++ RFL P+       
Sbjct: 113 QAIATGGPLAVVIGWAIAGSQIIGTIHGLGEITVRFPVVGAFANYSTRFLDPSLSFVIST 172

Query: 123 MYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIA 182
           +Y   W     LE+      +Q+W  ++    W++I +  +   NLF  R +GE EF  +
Sbjct: 173 IYVIQWFFVLPLEIISSAMTVQYWNQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFS 232

Query: 183 SVKVLXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWV 238
           SVKVL                   GP    VG +YW +PG    G          F G +
Sbjct: 233 SVKVLTICGFIILCIVLICG---GGPDHDFVGAKYWHDPGCLAHG----------FPGVL 279

Query: 239 SSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYND 298
           S L+ A+++  GTE+V + +GE     K +P AIK+  +RIL F++ SL +IG LVPY +
Sbjct: 280 SVLVVASYSLGGTEMVCLASGETDP--KELPSAIKQTFWRILFFFLVSLTLIGFLVPYTN 337

Query: 299 PKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKN 358
             L    S V++SPF+I I+    K+LP I NAVILI+I+S GNS ++  SR L  +A  
Sbjct: 338 ENLLGGSS-VNNSPFVIAIKLHQIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQ 396

Query: 359 KAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLI 418
              P+FF    +AG P   ++  S+FG LA++  ++   + F WL+ I G+A    WL I
Sbjct: 397 GLIPRFFGYIDRAGRPLTGIITNSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSI 456

Query: 419 SCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP------- 471
           + SHIRF  A+K +G S ++L + + +  W + Y+     +I+V Q + +  P       
Sbjct: 457 NISHIRFRLAMKAQGRSLDELEFVSAVGIWGSAYSAVINSLILVAQFYCALWPIGGWENS 516

Query: 472 KFKVANFFAAYISVFLFIIFWVAFQIWFKCRL-----VWKLQDVDLDTDRRDIEEEVWSD 526
             +   FF +Y+   + I+ +V  +I+++ +      +  L  +DL+TDR++I+ E+   
Sbjct: 517 SIRAKKFFQSYLCALIMIVLFVGHKIFYRYKTGKWWSMLPLNKIDLETDRKNIDIEILKQ 576

Query: 527 DVEDKNKN-----WWDRFWNY 542
           ++ ++N++     W+ R++++
Sbjct: 577 EIAERNRHLRASPWYVRWYHF 597

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  254 bits (650), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 153/501 (30%), Positives = 252/501 (50%), Gaps = 23/501 (4%)

Query: 7   QVHSFQVDSNDTPTTISTLDDD-----QEKQQDVKRELKKRHISMXXXXXXXXXXXXXXX 61
           +V +    ++DT       + D      E  Q ++R  K+RH+ M               
Sbjct: 13  RVDTLDTGNSDTQQNGEVYELDFQEAIGESSQTLQRGFKQRHVDMLAIAGAIGTGLVIGT 72

Query: 62  XRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANG 121
                          ++F G+++  V  SL EM +F P+  SF+ +A R++ PA G A G
Sbjct: 73  GTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEMASFAPMDKSFSGYATRYVDPALGFATG 132

Query: 122 YMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWI 181
           + Y+  +A+  A ELS +G ++Q+W   + +A +I +  V+L   N   ++ YGE+EFW 
Sbjct: 133 WNYFLKYAIALASELSAIGLLVQYWREDLSIAIFIVVFLVVLLSLNFMNIKFYGEVEFWS 192

Query: 182 ASVKVLXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPG--PWGMGIISSNVNEARFF 235
           A +K L                   GP    +GFRYW+     P+ +          RF 
Sbjct: 193 ALLKFLVLIICFVTGLVLTCG---GGPSKETIGFRYWREYAFVPYLV-----KGTTGRFL 244

Query: 236 GWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVP 295
           GW + +I + + + G+E +G+  GE   P+KT+P A + V+FRI  FYI  +L++GL++ 
Sbjct: 245 GWWACVIQSCYAYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLILGLIIS 304

Query: 296 YNDPKL-QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYG 354
            +D  L  +  S  S SPF+I   NAG K LP   NA++++ I SA N+ +Y+ SR  YG
Sbjct: 305 PHDKTLANAKTSDASGSPFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCSRTAYG 364

Query: 355 LAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFA 414
           LAK+  APK F   ++ GVP+   L   +   L++M  +      F +L + V V G   
Sbjct: 365 LAKDGMAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTVFGTLN 424

Query: 415 WLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFK 474
           WL +  S+I + +A     + R+ +P++    P+ AY  +FF+ +II   G+++F   FK
Sbjct: 425 WLSVLISYIGYERARVFHDVPRDRIPFRMWFQPYSAYVCLFFVSLIIFFNGYSAFIAGFK 484

Query: 475 VANFFAAYISVFLFI---IFW 492
             +F  +YI + +FI   +FW
Sbjct: 485 YKSFIVSYIGIAVFIGNTLFW 505

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  256 bits (653), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 152/539 (28%), Positives = 267/539 (49%), Gaps = 26/539 (4%)

Query: 8   VHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXX 67
           V SF+   +D    +   D++      +K+ +K RH+ M                     
Sbjct: 40  VDSFKKKQDDD---VVGYDEETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAK 96

Query: 68  XXXXXXXXXYLFMGTVVFSVTQSLGEM-CTFIPVTASFTVFAQRFLSPAFGAANGYMYWF 126
                    Y     +++ + Q+ GE+   +  +T ++T ++   + PA G +  ++Y  
Sbjct: 97  AGPGGLIIGYGVASAMLYCIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCI 156

Query: 127 SWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKV 186
            W   F L+L      I++WT   P   +++I++ L+   NLF  + Y E EF   + KV
Sbjct: 157 QWMTVFPLQLVTAAITIKYWTDTNP-DIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKV 215

Query: 187 LXXXXXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAA 245
           L                    G +G RYW  PG +  G          F G       AA
Sbjct: 216 LMMVGFVILGIIINCGGAGNDGYIGARYWHTPGAFSTG----------FKGVCYVFCYAA 265

Query: 246 FTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSND 305
           F + G E++ +TA E + PRK++P A KKV++RIL+ Y+ + L++  LVPY+ P+L S  
Sbjct: 266 FAYGGIEVMVLTASEQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTG 325

Query: 306 SYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFF 365
           S   +SPF+I I + G  ++PHI NAVIL+ ++S GNS++Y   R+L  L++   APK F
Sbjct: 326 SASRASPFVIAIASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVF 385

Query: 366 TNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRF 425
               + G P +  L     G LA++  +   +  F+WLL I G++  F W+ I  SH+RF
Sbjct: 386 NYVDRQGRPLLCFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRF 445

Query: 426 MKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFA 480
             A+K +G S  ++ YK+    W +++A+   + ++V Q + + AP     K    +FF 
Sbjct: 446 RDAMKAQGRSLGEVGYKSQTGYWGSWFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQ 505

Query: 481 AYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDR 538
           +Y++  + I  +  ++I++K  RL     +VDL++ R+  +E    D+++ ++ +W ++
Sbjct: 506 SYLAAPVLIFIYFGYKIYYKDWRLCIPATEVDLNSHRKIFDE----DELKQEDLDWKEK 560

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  254 bits (650), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 161/541 (29%), Positives = 268/541 (49%), Gaps = 19/541 (3%)

Query: 3   LNQPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXX 62
           +++ +V   +  + D       L +D+ K   +K+ LK RHI M                
Sbjct: 17  IDEAEVQLEEGVTLDETIKQGVLHNDRTK---LKQGLKARHIKMLTLVGVFGTGLFLSSG 73

Query: 63  RXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGY 122
                         Y+ +G VV     ++ E+ +F+P T +    +++F+  A G   G+
Sbjct: 74  GTLKKTGPVGMLIAYVLVGIVVGCNQIAIAEVASFMPATGATIRHSEQFIDEAVGFTFGW 133

Query: 123 MYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIA 182
           +  +S  M    ELS    ++ +WT   P A +I+I  VL  ++N++ +R YGEIE++  
Sbjct: 134 ISTYSSLMPG--ELSATAVVMTYWTDLSP-AIFITIFGVLFILTNIYTIRFYGEIEYFFG 190

Query: 183 SVKVLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLI 242
            +K+                      +GF YW+NPGP+   ++  +    +F G+ ++L 
Sbjct: 191 WLKLALIAILIITGLVIDLGGTKQERLGFHYWRNPGPFAEYLVGGDT--GKFVGFWAALS 248

Query: 243 NAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ 302
           +  +++ G + + I AGE +  R  +    K V  RI++ Y+ ++ V+ L+VPYND  + 
Sbjct: 249 SVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFVRIILLYLITVFVLTLIVPYNDKLIA 308

Query: 303 SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAP 362
           +      SSPF+I ++ AG K+LPHI NA+IL +  SAGN  +  GSR L+ LA    AP
Sbjct: 309 TGSGNARSSPFVIAMERAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAP 368

Query: 363 KFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSH 422
           K F  TSK G+P+V VLF S F  LAYM  +      F+W   +V       W+LIS +H
Sbjct: 369 KIFLKTSKRGIPWVGVLFISSFLPLAYMSCSESSATVFSWFQELVSSNTLLRWILISANH 428

Query: 423 IRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAA 481
           I   +AL+ +G SR DLPY   + P+ A+++     I ++  GF +F    F + +FF+ 
Sbjct: 429 IHMDRALRAQGYSRKDLPYSTTIAPYAAWFSGIMSFIFLLTGGFYNFIHGNFDIESFFSR 488

Query: 482 YISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEE---------VWSDDVEDKN 532
           Y  + L I  +  ++++ K R + +  +VDL +   DI E          +W   +  KN
Sbjct: 489 YFIIPLAIALFTFWKLFKKTRYL-RPHEVDLQSIFEDIRENPEYIPETTPLWKRLIFKKN 547

Query: 533 K 533
           K
Sbjct: 548 K 548

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  256 bits (655), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 149/527 (28%), Positives = 264/527 (50%), Gaps = 19/527 (3%)

Query: 30  EKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQ 89
           EK   +KR++K RH+ M                +             Y  MG+ ++S+ Q
Sbjct: 97  EKGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQ 156

Query: 90  SLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTM 148
           + GE+    P +T +F  +    + PA   A   +Y   W   F LE+      I++W  
Sbjct: 157 AAGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNT 216

Query: 149 AVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGP 208
           ++    W  I +V++   N+     Y E +F+  + K+L                     
Sbjct: 217 SINPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSV 276

Query: 209 -VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKT 267
            +G +YW +PG +     + +   +RF   VS+L+ AAF F  +E V +TA E   PRK 
Sbjct: 277 YIGGKYWNDPGAF-----NGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKA 331

Query: 268 VPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSS-PFIITIQNAGTKILP 326
           +P A K+V++RI+  Y+ S++++G LVPYN P+L  + S    S P++I + + G K++P
Sbjct: 332 IPSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVP 391

Query: 327 HIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGS 386
              NAVILI+++S GN + Y  SRIL  L++   APKFF    + G P   ++  ++ G 
Sbjct: 392 SFINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGC 451

Query: 387 LAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLM 446
           + ++  ++  +  FTWL+ + G++  F W  I  SH+RF KA++ +  S  +L +++ + 
Sbjct: 452 ICFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVG 511

Query: 447 PWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISVFLFIIFWVAFQIWFKC 501
            W +YY +F M+++ + Q + +  P          NFFA Y+++ +F+  +  F+IW K 
Sbjct: 512 VWGSYYGIFMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFKIWKKD 571

Query: 502 -RLVWKLQDVDLDTDRRDIEEEVWSDDVED-----KNKNWWDRFWNY 542
            RL     ++DL + R+  +EE+   + E+     K+ + W +  N+
Sbjct: 572 WRLYIPASEIDLISHRKIFDEEILKQEDEEYKIKMKHASIWVKLSNF 618

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  256 bits (653), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 160/544 (29%), Positives = 263/544 (48%), Gaps = 18/544 (3%)

Query: 9   HSFQVDSNDTPTTISTLDDDQEKQQDVKRELKK----RHISMXXXXXXXXXXXXXXXXRX 64
           H F +DS   P      D ++   +   R LKK    RH+ M                + 
Sbjct: 37  HRF-IDSFKPPVEDEKSDLEEMSMESTDRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKG 95

Query: 65  XXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYM 123
                       Y+ +  V + + Q+ GEM    P +  SF  +   F+S   G A  ++
Sbjct: 96  LSYGGPGALVIGYILVSFVTYFMIQAAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWL 155

Query: 124 YWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIAS 183
           +   W     LEL      IQ+W  ++    WI I +V L   ++F V+ YGE+EF   +
Sbjct: 156 FLIQWLTVLPLELITGTMTIQYWNDSINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNT 215

Query: 184 VKVLXXXXXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLI 242
            K+L                  T G +G +YWKNPG +     +S+ +  RF      L+
Sbjct: 216 CKILFIGGFIIFSIVVNAGGAGTDGYIGAKYWKNPGSF-----ASSTSAGRFKDVCYVLV 270

Query: 243 NAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPY-NDPKL 301
            A F++ GTEL  ++  E   PR++ PKA K+ ++RIL+ Y+ ++++IG  VP+ ND  +
Sbjct: 271 TAYFSYGGTELYVLSVNEQANPRRSTPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLM 330

Query: 302 QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAA 361
            +  S   +SP+++     G K++PHI NAVILI + S GNS++Y   R+   LA+   A
Sbjct: 331 GAGGSSTHASPYVLAASIHGVKVVPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYA 390

Query: 362 PKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCS 421
           PK      + G P + +   ++ G +A+   ++  ++ FTWL  I  ++  F W  I  S
Sbjct: 391 PKCLAYIDREGRPIIALAACAVVGVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLS 450

Query: 422 HIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP---KFKVANF 478
           HIRF  A+K +G   N+L YKA+   W + +   F V++ + Q + + +P         F
Sbjct: 451 HIRFRMAMKVQGKDLNELGYKALTGVWGSMWGFGFCVLVFIAQFWVALSPPGGTISAEGF 510

Query: 479 FAAYISVFLFIIFWVAFQIWFK-CRLVWKLQDVDLDTDRRDIEEE-VWSDDVEDKNKNWW 536
           F +Y++  L++ F+ A+ +W +    + KL+D+DLD  RR  + E +  +D E K K   
Sbjct: 511 FESYLAFPLWLFFYFAYMLWKRDFTFLTKLEDIDLDAHRRIYDPEFLRQEDEERKEKIRN 570

Query: 537 DRFW 540
             FW
Sbjct: 571 SSFW 574

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  256 bits (655), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 153/563 (27%), Positives = 272/563 (48%), Gaps = 33/563 (5%)

Query: 3   LNQPQVHSFQVDSNDTPTTISTLDDDQ------EKQQDVKRELKKRHISMXXXXXXXXXX 56
           ++ P     + +   T + +S   D Q      EK   +++ +K RH+ +          
Sbjct: 93  IDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVLLMSLGTGIGTG 152

Query: 57  XXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPA 115
                               Y  MG+ ++ + Q+ GEM   +  +  +F  +    +  A
Sbjct: 153 LLVGNGSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEA 212

Query: 116 FGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYG 175
           FG +  ++Y   W     LEL      IQ+WT  V    ++ I +VL+   N+F  + Y 
Sbjct: 213 FGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADVFVVIFYVLIIFINVFGAKGYA 272

Query: 176 EIEFWIASVKVLXXXXXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARF 234
           E EF+  S KVL                    G +G +YW NPG +       + +  RF
Sbjct: 273 EAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRF 327

Query: 235 FGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLV 294
              +S+   AAF F  +E + I A E   PR+ +P A K +++RIL  ++ S+ ++G LV
Sbjct: 328 KDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLV 387

Query: 295 PYNDPKLQSNDSYVS-SSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILY 353
           PYN  +L  + S  + +SP++I + + G +++PH  NAVIL++++S  NS  Y   RILY
Sbjct: 388 PYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILY 447

Query: 354 GLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFF 413
            L++   AP +F    + G P   ++ +++F  +A+   ++  +  FTWLL I G++  F
Sbjct: 448 SLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLF 507

Query: 414 AWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-- 471
            W+ I  SHIRF +A+K +G S +++ +K+ +  W + YA   M + ++ + + S AP  
Sbjct: 508 TWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIG 567

Query: 472 --KFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKL----QDVDLDTDRRDIEEEVWS 525
                  NFF  Y+++ + I+ +  ++I   C+  WKL    +D+DL + R+  + E+  
Sbjct: 568 EDHLDAQNFFENYLAMPILIVLYFGYKI---CKRDWKLFIRAKDIDLVSHRKIYDGELIK 624

Query: 526 DDVED-----KNKNWWDR---FW 540
            + E+     +N  +W +   FW
Sbjct: 625 QEEEEFKERLRNGPFWKKVVAFW 647

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  256 bits (653), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 151/544 (27%), Positives = 277/544 (50%), Gaps = 17/544 (3%)

Query: 8   VHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXX 67
           +  F + + D+P + S       +++  +R+L  R +SM                     
Sbjct: 94  IDDFVLQNRDSPKSQSL----SLEERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQ 149

Query: 68  XXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFS 127
                    +     V   +++ +  M T++PVT SF  F +RF+  + G A G+ Y+  
Sbjct: 150 GGPGSLLIAFCLWSVVFIGLSKCMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVC 209

Query: 128 WAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVL 187
            A     E++ V  ++++WT  +P AA IS++ +L    NL+ V  +GE EF+++  KV+
Sbjct: 210 QAANVCFEITAVCLVVEYWTDKIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVV 269

Query: 188 XXXXXXXXXXXXXXXXXVTGPV-GFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAF 246
                                V GF+ W NPG +   I   +V   RF G++S L+ A +
Sbjct: 270 LAIGLIIFTVVVMAGGNPQHTVLGFKNWSNPGAFAEYISDGSV--GRFHGFMSCLVFALY 327

Query: 247 TFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL----Q 302
            F G + +G  A E   PRK +P + +KV  R+++FYIG  + +G+L+PYNDP +    +
Sbjct: 328 VFWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIK 387

Query: 303 SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAP 362
                  +SP++  ++  G ++LPHI N +IL +IISAGNS++Y  SR+L+ LA +  AP
Sbjct: 388 EGAVGAGASPYVSAMKTLGIRVLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAP 447

Query: 363 KFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSH 422
           + F  T+K GVP    +   +   LAY+  +   +   TW LN+   A    ++ I  S+
Sbjct: 448 RIFKVTTKKGVPVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSY 507

Query: 423 IRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAA 481
           ++F K    + +    LPY +  +P+LA++++F++V+++++ G+T F    +   +F  +
Sbjct: 508 LQFRKGCLAQNVDLKSLPYYSSSLPYLAWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFS 567

Query: 482 YISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDI--EEEVWSDDVEDKNKNWWDRF 539
           Y  +  F++F    +++   + V  L ++DL T   ++  E+  W+++      NW+DR 
Sbjct: 568 YFMIPFFLVFLFGHKLYKGTKSVRPL-EMDLFTGIEELADEDRYWAEN--PPTLNWFDRA 624

Query: 540 WNYV 543
           + ++
Sbjct: 625 FGFL 628

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  254 bits (650), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 158/537 (29%), Positives = 264/537 (49%), Gaps = 37/537 (6%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           D      ++KR+LK RH+ M                +             +   G+ +  
Sbjct: 62  DGSYHSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVG 121

Query: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146
               LGE+    PV  +F  ++ R L P+       +Y   W     +EL      +QFW
Sbjct: 122 TIHGLGEITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFW 181

Query: 147 TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVT 206
           T  V    W++I +V++   NLF V+++GE EF  + VKV+                   
Sbjct: 182 TTKVDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICG---G 238

Query: 207 GP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQ 262
           GP    +G  YW +PG    G          F G  S  + A+++  G+E+V + + E  
Sbjct: 239 GPDHRFIGTEYWHHPGALANG----------FKGVASVFVTASYSLGGSEMVCLCSAETD 288

Query: 263 EPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGT 322
              K +P AIK+V +RI+ F++ SL ++G LVPY +  L    S V++SPF+I I+ +G 
Sbjct: 289 P--KELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSS-VNNSPFVIAIKLSGI 345

Query: 323 KILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTS 382
           ++LP I NAVILI+I+S GNS ++  SR L  +A     P+ F    +AG P V ++  S
Sbjct: 346 RVLPSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNS 405

Query: 383 MFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYK 442
           +FG LA++  +      F WL+ I G+A    WL I+ SHIRF  A+K +  S ++L +K
Sbjct: 406 LFGLLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFK 465

Query: 443 AMLMPWLAYYAVFFMVIIIVIQGFTSFAP-------KFKVANFFAAYISVFLFIIFWVAF 495
           + +  + + Y+    ++I++ Q + S  P       + +  +FF  Y+   + +  +V  
Sbjct: 466 SSVGVYGSIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVFVTH 525

Query: 496 QIWFKCRL-VW----KLQDVDLDTDRRDIEEEVWSDDVEDK-----NKNWWDRFWNY 542
           +I+FKC    W     L ++DL+TDR++I+ E+   +V ++     +K W+ RF+N+
Sbjct: 526 KIYFKCSTGKWFDFKPLAEIDLETDRKNIDIEIVKQEVREREMYLASKPWYIRFYNF 582

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  255 bits (652), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 152/475 (32%), Positives = 254/475 (53%), Gaps = 18/475 (3%)

Query: 79  FMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSV 138
            + T +F++  SLGE+ +  PV   F V+  RF+ P+FG A    Y   WA+   LEL+ 
Sbjct: 153 LISTCLFTIVNSLGELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAA 212

Query: 139 VGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXX 198
               I++W   +   AW++I +V + ++N+  V+ +GE EF ++ VK+L           
Sbjct: 213 ASITIKYWNNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAILGTV 272

Query: 199 XXXXXXVTGPVGF-RYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGIT 257
                   G     +YW +PG +       +   A+F G  S  + AAF++ GTELVG++
Sbjct: 273 LICGGGPVGGFIGAKYWHDPGAF-----VGDTPGAQFKGLCSVFVTAAFSYSGTELVGVS 327

Query: 258 AGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV--SSSPFII 315
           A E   PR T+P+A K+  + I   Y+  L + G LVP NDP+L +  S V  ++SP +I
Sbjct: 328 AAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAASPLVI 387

Query: 316 TIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPY 375
            I+N G + +P + NA+ILI IIS  NS+VY  SR +  +A+    PK F    + G P 
Sbjct: 388 AIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGRPL 447

Query: 376 VTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGIS 435
           V +L T +FG L+++  +   +  FTWL  + G++  F W  I+ SHIRF +A+  +  S
Sbjct: 448 VAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQRS 507

Query: 436 RNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKF----KVANFFAAYISVFLFIIF 491
            ++LPY ++     ++Y    ++ ++V+  +TS  P         +FF  Y+S  +F+I 
Sbjct: 508 LDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFFEGYLSFPIFLIC 567

Query: 492 WVAFQIWFKC-RLVWKLQDVDLDTDRR--DIE---EEVWSDDVEDKNKNWWDRFW 540
           +++ +++ +  RL      +D+D+ RR  DIE   E+   +  E   K ++ R+W
Sbjct: 568 YISHKLYKRDWRLFIPAGQIDVDSGRRALDIEELKEQKLREQAETAKKPFYVRWW 622

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  254 bits (650), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 166/564 (29%), Positives = 271/564 (48%), Gaps = 45/564 (7%)

Query: 2   KLNQPQVHSFQ--VDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXX 59
           K  +P  + FQ  +DS   P      +D      ++K+ LK RH+ M             
Sbjct: 57  KGTKPPRNIFQRAIDSFKPP------EDGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFI 110

Query: 60  XXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAA 119
              +             +   G+ +      LGE+    PV  +F  ++ RFL P+    
Sbjct: 111 GSGQALATGGPLAVIIGWAIAGSQIIGTIHGLGEITVRFPVVGAFANYSTRFLDPSISFV 170

Query: 120 NGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEF 179
              +Y   W     LE+      +Q+W  ++    W++I +V +   NLF VR +GE EF
Sbjct: 171 VSTIYVIQWFFVLPLEIISSAMTVQYWNESIDPVVWVAIFYVTIVSINLFGVRGFGEAEF 230

Query: 180 WIASVKVLXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFF 235
             +++KV+                   GP    VG RYW NPG    G          F 
Sbjct: 231 IFSTIKVITISGFILLCIILIAG---GGPDHVYVGSRYWHNPGCLANG----------FP 277

Query: 236 GWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVP 295
           G +S ++ A+++  GTE+  + +GE     K +P AIK+V +RIL F++ SL ++G LVP
Sbjct: 278 GVLSVMVVASYSLGGTEMTCLASGETDP--KELPSAIKQVFWRILFFFLVSLTLVGFLVP 335

Query: 296 YNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGL 355
           Y +  L    S V +SPF+I I+    K+LP I NAVILI+I+S GNS ++  SR L  +
Sbjct: 336 YTNENLLGGSS-VDNSPFVIAIKIHHIKVLPSIVNAVILISILSVGNSCIFASSRTLCSM 394

Query: 356 AKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAW 415
           A     P +F    +AG P V ++  S+FG LA++  +    + F WL+ I G+A    W
Sbjct: 395 AHQHLLPWWFGYIDRAGRPLVGIITNSLFGLLAFLVKSGSMSEVFDWLMAIAGLATCIVW 454

Query: 416 LLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP---- 471
           L I+ SHIRF  A+K +G S N+L + + +  W + Y+     +I+V Q + S  P    
Sbjct: 455 LSINVSHIRFRLAMKAQGRSLNELEFVSAVGIWGSVYSAIINCLILVAQFYISLWPIGGW 514

Query: 472 ---KFKVANFFAAYISVFLFIIFWVAFQI--WFKCRLVWK---LQDVDLDTDRRDIEEEV 523
              + +   FF +Y+   + +  W+  +I  W +   +W    L ++DLD  R++I+ +V
Sbjct: 515 KNSEDRAKKFFQSYLCALIMVCIWIGHKIYYWRQTGKIWAFTPLAEIDLDEGRKNIDLDV 574

Query: 524 WSDDVED-----KNKNWWDRFWNY 542
              ++ +     K++ W+ RF++Y
Sbjct: 575 LKQEIHERKMYLKSRPWYIRFYHY 598

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  254 bits (650), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 157/537 (29%), Positives = 264/537 (49%), Gaps = 19/537 (3%)

Query: 7   QVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXX 66
           ++     +++D    I +   D +    +K+ +K RH+ M                +   
Sbjct: 67  KIKPINENTSDLEDGIQSFTSDSK----LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLH 122

Query: 67  XXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYMYW 125
                     Y+ +  + + + Q+ GEM    P + A+F  ++  F+S  FG A  ++Y 
Sbjct: 123 YGGPAALVIGYVLVSFITYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYC 182

Query: 126 FSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVK 185
           F W     LEL      IQFW   +    +I I +V L   + F V+ YGE EF     K
Sbjct: 183 FQWTTVLPLELITASMTIQFWNDKINPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCK 242

Query: 186 VLXXXXXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINA 244
           +L                    G +G  YW  PG +     + + + ARF      L+ A
Sbjct: 243 ILMIAGFIVLSVVINCGGAGNDGYIGGAYWHKPGAF-----AGDTSIARFKNVCYILVTA 297

Query: 245 AFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL-QS 303
            F+F G EL  ++  E   PRK+ P A K+ ++RI+V Y+ ++++IG  VPYND +L  +
Sbjct: 298 YFSFGGMELFVLSVQEQTNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGA 357

Query: 304 NDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPK 363
             S   +SP+++     G +I+PHI NAVILI+++S  NS++Y G R++  LA+   APK
Sbjct: 358 GGSATHASPYVLAASIHGVRIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPK 417

Query: 364 FFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHI 423
           F     + G P   ++   + G +A++  ++  +  FTWL  I G++  F W  I  SH+
Sbjct: 418 FLDYVDREGRPLRALIVCCVIGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHL 477

Query: 424 RFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANF 478
           RF +A+K +G S N+L YKA    W + Y  FF +++ + Q + + AP     K     F
Sbjct: 478 RFRQAMKVQGRSLNELGYKATTGIWGSIYGSFFNILVFIAQFWVALAPLGNGGKCNAEAF 537

Query: 479 FAAYISVFLFIIFWVAFQIWFK-CRLVWKLQDVDLDTDRRDIEEEVW-SDDVEDKNK 533
           F +Y++  +++IF++ + I+ +   L+  L  +DLD  RR  + E+   +D E+K K
Sbjct: 538 FESYLAAPIWLIFYIGYMIYNRDFTLLNPLDKIDLDFHRRVYDPELMRQEDEENKEK 594

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  254 bits (649), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 153/537 (28%), Positives = 266/537 (49%), Gaps = 18/537 (3%)

Query: 15  SNDTPTTISTLDDDQEKQQDVK-----RELKKRHISMXXXXXXXXXXXXXXXXRXXXXXX 69
           +ND  ++     DD  +Q+D+      +EL  RH+                         
Sbjct: 61  TNDITSSGRFHSDDDVQQEDINNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGG 120

Query: 70  XXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWA 129
                  ++ + T +F+V  SLGE+    PV   F V++ RF+ P+F  A    Y   W 
Sbjct: 121 PASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWL 180

Query: 130 MTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXX 189
           +   LEL      I++W   +   AW++I +  + ++N+  V+ +GE EF ++ +K+L  
Sbjct: 181 VLLPLELVAASITIKYWNDKINSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAI 240

Query: 190 XX-XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTF 248
                             G +G +YW +PG +       + +  +F G  S  + AAF++
Sbjct: 241 IGFTILGIVLSCGGGPHGGYIGGKYWNDPGAF-----VGHDSGTKFKGLCSVFVTAAFSY 295

Query: 249 QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV 308
            G E+  ++A E + PR+T+PKA K+  + I + Y+  L +IG LVP NDP+L +  S V
Sbjct: 296 SGIEMTAVSAAESKNPRETIPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSV 355

Query: 309 --SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFT 366
             +SSP +I I+N   K LP + NA+ILI ++S  NS VY  SR +  +A     PKF  
Sbjct: 356 DAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLR 415

Query: 367 NTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFM 426
              K G P   ++ T  FG L+++  +    + FTWL  + G++  F W+ I+ SHIRF 
Sbjct: 416 RVDKRGRPINAIVLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFR 475

Query: 427 KALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAY 482
           +A+K +  S ++LP+ +    W + Y    + ++++   +TS  P         +FF  Y
Sbjct: 476 QAMKFQERSLDELPFISQTGVWGSIYGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGY 535

Query: 483 ISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDR 538
           +S  + I+ +   +I+ +  RL+ KL+D+DLDT R+ ++  +   +++ + +    R
Sbjct: 536 LSFPILIVCYFGHKIYTRDWRLLVKLEDMDLDTGRKQVDLNLRRQEMKIEQETLAKR 592

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  254 bits (648), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 152/503 (30%), Positives = 258/503 (51%), Gaps = 15/503 (2%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           +  ++  ++ R+L  RH+                                +  + T +F+
Sbjct: 63  NTTKRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFT 122

Query: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146
           +  +LGE+    PV   F V+  R + P+ G A    Y   WA+   LEL      I++W
Sbjct: 123 IVNALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRYW 182

Query: 147 TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXX-V 205
             +V   AW+++ +V + +++L  V+ +GE EF ++ VK+L                   
Sbjct: 183 NNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLICGGGPK 242

Query: 206 TGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPR 265
            G +G +YW +PG +      S     +F G  S  + AAF++ GTELVG++A E   PR
Sbjct: 243 NGYIGAKYWNDPGSFVGASPGS-----QFKGLCSVFVTAAFSYSGTELVGVSAAESANPR 297

Query: 266 KTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV--SSSPFIITIQNAGTK 323
            T+PKA K+  + I + Y+  L +IG LV ++DPKL S  S V  ++SP +I I+N G +
Sbjct: 298 YTLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAASPLVIAIENGGIQ 357

Query: 324 ILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSM 383
            LP + NA+ILI IIS  NS+VY  SR +  +A+    P+ FT     G P V ++FT +
Sbjct: 358 GLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLV 417

Query: 384 FGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKA 443
           FG L+++  +   ++ F WL  + G++  F WL I+ SHIRF +AL  +G S ++LPY +
Sbjct: 418 FGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLDELPYLS 477

Query: 444 MLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVA----NFFAAYISVFLFIIFWVAFQIWF 499
           M     ++Y    ++++++   +TS  P         +FF  Y+S+ +F+  +V  ++ +
Sbjct: 478 MTGVIGSWYGCVVIILVLIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFVGHKL-Y 536

Query: 500 KCRLVWKLQD--VDLDTDRRDIE 520
           K    W ++   +D++T RR I+
Sbjct: 537 KRNWSWMIRSNKIDVNTGRRMID 559

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  253 bits (647), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 160/538 (29%), Positives = 263/538 (48%), Gaps = 29/538 (5%)

Query: 26  DDDQEKQQDVKRELK------KRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLF 79
           D D E Q    RE K       RH+ M                +             Y  
Sbjct: 64  DVDAEGQPVAPRETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAI 123

Query: 80  MGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSV 138
           MG+ ++ + Q+ GEM  ++  ++ +F  +    + PA G +  ++Y   W     LEL  
Sbjct: 124 MGSCIYCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVT 183

Query: 139 VGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXX 198
               I++WT AV    ++ I +VL  + NLF  R Y E EF+  + KVL           
Sbjct: 184 ATITIKYWTTAVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGII 243

Query: 199 XXXXXXVT-GPVGFRYWKNPGP-WGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGI 256
                    G +G +YW +PG  +G   I        F G +++++ AAF F  TE + +
Sbjct: 244 VNCGGAGNDGYLGGKYWHDPGALYGTKPIH------HFKGIIATMVTAAFAFGATEFIAL 297

Query: 257 TAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN-DPKLQSNDSYVSSSPFII 315
           TA E   PR+ +P A KK+V+R+L+ ++  ++++G LVPYN D  + S  S   +SP++I
Sbjct: 298 TAAEQANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVI 357

Query: 316 TIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPY 375
            I + G K++PH  NAVIL++++S GNS  Y  SR+L  L++   AP +     + G P 
Sbjct: 358 AIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPI 417

Query: 376 VTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGIS 435
             +L + +FG +A++  +   +  FTWLL I G++  F W+ I  SHIRF KAL  +G S
Sbjct: 418 RAMLVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKS 477

Query: 436 RNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIF 491
             +L YK+      +YYA   M  ++  Q + + AP    K    NFF  Y+++ + I  
Sbjct: 478 LGELGYKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIAL 537

Query: 492 WVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVED-----KNKNWWDR---FW 540
           +  +++W +  +L   L+ +DL + R+  +E++   +  +     +N  W  R   FW
Sbjct: 538 YFGYRVWKRDWKLYIPLEQIDLVSHRKVFDEDLLKQEDAEYEESIRNSGWLSRVAHFW 595

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  253 bits (647), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 162/544 (29%), Positives = 266/544 (48%), Gaps = 24/544 (4%)

Query: 8   VHSFQVDSNDTPTTISTLDDDQ--------EKQQDVKRELKKRHISMXXXXXXXXXXXXX 59
           VH F VDS     +    DD+              +K+ +K RH+ M             
Sbjct: 52  VHRF-VDSFRRAESQRLEDDNDLEDGTRSMRSNNHLKKSMKSRHVVMMSLGTGIGTGLLV 110

Query: 60  XXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEM-CTFIPVTASFTVFAQRFLSPAFGA 118
              +             Y+ +  V + + Q+ GEM  T+  +  +F  +   F+S +FG 
Sbjct: 111 ANAKGLKLAGPGSLVIGYVLVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFVSKSFGF 170

Query: 119 ANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIE 178
           A  +++   W     LEL      I++W   +    +I+I +V L   + F V+ YGE E
Sbjct: 171 ATTWLFCIQWLTVLPLELITSSMTIKYWNDTINADVFIAIFYVFLLFIHFFGVKAYGETE 230

Query: 179 FWIASVKVLXXXX-XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGW 237
           F   S K+L                  V G +G  YW+NPG +  G      +  RF G 
Sbjct: 231 FIFNSCKILMIAGFIILSVIINCGGAGVDGYIGGEYWRNPGSFADG-----SSATRFKGI 285

Query: 238 VSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPY- 296
              L+ A F+F G EL  ++  E   PRK+ P A K+ ++RIL+ Y+ ++++IG  VP+ 
Sbjct: 286 CFILVTAYFSFGGIELFVLSINEQANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVPHD 345

Query: 297 NDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLA 356
           ND  + S  S   +SP+++     G K++PHI NAVILI++IS  NS +Y   R++  LA
Sbjct: 346 NDQLMGSGSSATHASPYVLAASIHGVKVIPHIINAVILISVISVANSALYAAPRLMCSLA 405

Query: 357 KNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWL 416
           +   APKF     + G P   ++  S  G + ++  ++  ++AFTWL  I G++  F W 
Sbjct: 406 QQGYAPKFLNYIDREGRPLRALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWS 465

Query: 417 LISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----- 471
            I  SHIRF KA+K +G S +++ YK+    W +YY V F +++ + Q + + +P     
Sbjct: 466 GIMLSHIRFRKAMKVQGRSLDEVGYKSNTGIWGSYYGVIFNILVFMAQFWVALSPPGSDG 525

Query: 472 KFKVANFFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVW-SDDVE 529
           K  V +FF +Y++  L+I  ++ + I+ K   L+  L  +DLD  RR  + E+   +D E
Sbjct: 526 KCDVESFFQSYLAAPLWIFMYLGYMIYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEE 585

Query: 530 DKNK 533
           +K +
Sbjct: 586 NKER 589

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  253 bits (646), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 150/498 (30%), Positives = 253/498 (50%), Gaps = 14/498 (2%)

Query: 29  QEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVT 88
            + QQ +K  +K RH++M                +             YL   T+++ V 
Sbjct: 65  NKTQQKLKHNIKTRHLTMISLGTGIGTGLLVASGKALHYGGPGGLLIGYLTTSTMLYCVV 124

Query: 89  QSLGEM-CTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWT 147
           Q+  E+   +  +  ++  +    +   FG A   +Y   WA+   LEL      I++WT
Sbjct: 125 QACCELGVAYATLPGNYNAYPTFLVDRGFGFAVALVYGLQWAIVLPLELVTASMTIKYWT 184

Query: 148 MAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTG 207
            +V    +++I ++ +   + F  R Y E EF   ++KVL                   G
Sbjct: 185 ESVNPDVFVAIFYLFIVFIHFFGSRGYAESEFIFNTLKVLLMAGFIIMGISLNCGASKLG 244

Query: 208 PVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKT 267
            +G +YW NPG +       ++N  +  G  S  + +AF + G+E + +TA E   PR++
Sbjct: 245 YIGAKYWSNPGTFAG---ERSINHLK--GICSVWVQSAFAYGGSEFIALTAAEQANPRES 299

Query: 268 VPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL--QSNDSYVSSSPFIITIQNAGTKIL 325
           VP A K+ ++R++V ++  + +I  LVPY   +L   S  S   +SPF+I     G KI+
Sbjct: 300 VPSATKRWLYRVVVVFLIPIALICFLVPYTSDQLLSSSGASASHASPFVIAAAYHGVKIV 359

Query: 326 PHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFG 385
           PHI NA+IL ++IS GNS +Y   RIL  LA+N   PK FT   +AG P  T+LF  +FG
Sbjct: 360 PHIINAIILTSVISVGNSGMYSAPRILLSLAENGLCPKIFTYVDRAGRPLATLLFVCVFG 419

Query: 386 SLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAML 445
            L+++  +   +  FTWL  I G++  F W  I+ SHIRF  A+K +G S  +L Y +  
Sbjct: 420 LLSFVAASKNQESVFTWLTAIAGLSQLFTWTSIALSHIRFRAAMKVQGRSLGELGYTSTT 479

Query: 446 MPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISVFLFIIFWVAFQIWFK 500
               +YYAVFF ++++V Q + + AP     +    +FF  Y++  + ++F+V ++IW++
Sbjct: 480 GAIGSYYAVFFNIVVLVAQFWIAIAPIDKHGELDAESFFKNYLAFAVLVLFYVGYKIWYR 539

Query: 501 -CRLVWKLQDVDLDTDRR 517
             +L+  +  +DL+T R+
Sbjct: 540 EVQLLIPVDKIDLETHRQ 557

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  253 bits (645), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 155/549 (28%), Positives = 266/549 (48%), Gaps = 21/549 (3%)

Query: 8   VHSFQVDSNDTPTTISTLDDDQEK---QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRX 64
           V+SF+          S L++D +       +K+ +K RH+ M                + 
Sbjct: 45  VNSFKRAEQPPLKQDSDLEEDTDTIVTDTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQG 104

Query: 65  XXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYM 123
                       Y  +  V + + Q+ GEM    P +  +F  +   F+S  FG A  ++
Sbjct: 105 LHKAGPAPLVIAYGMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFISKPFGFATVWL 164

Query: 124 YWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIAS 183
           ++  W     LEL      +Q+W  ++    ++ I +V L   + F V+ YGE EF    
Sbjct: 165 FFIQWLTVLPLELITAAMTVQYWNDSINADVYVVIFYVFLLFIHFFGVKAYGETEFIFNL 224

Query: 184 VKVLXXXXXXX-XXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLI 242
            K+L                   +G +G +YW +PG +     +S+ N  RF G    L+
Sbjct: 225 CKILFVGGFIIFSIVVNVGGAGNSGYIGAKYWHDPGAF-----TSDTNAGRFKGVCYVLV 279

Query: 243 NAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ 302
            A F++ G EL  ++  E + PR++ P A K+ ++RI+V Y+ +++++G  VP N  +L 
Sbjct: 280 TAYFSYGGMELFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELM 339

Query: 303 -SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAA 361
            S  S   +SP+++     G K++PHI NAVILI++IS GNS +Y   R++  LA+   A
Sbjct: 340 GSGGSVTHASPYVLAASIHGVKVVPHIVNAVILISLISVGNSALYAAPRLMCALAQQGFA 399

Query: 362 PKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCS 421
           PKF     + G P   ++  S+FG + ++  ++  ++ F WL  I G+A  F W  I  S
Sbjct: 400 PKFMDYVDREGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMIS 459

Query: 422 HIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVAN 477
           HIRF +A+K +  S +++ YK+    + +Y+ VFF +++ V Q + + AP    +     
Sbjct: 460 HIRFRQAMKLQNKSLDEVGYKSPFGVYGSYFGVFFNLLVFVAQFWVALAPPMYTEMSADT 519

Query: 478 FFAAYISVFLFIIFWVAFQIWFK-CRLVWKLQDVDLDTDRRDIEEEVWSDDVED-----K 531
           FF +Y++  +F  F+  + IW +   L   L+ VDLD  RR  + E+   + E+     K
Sbjct: 520 FFESYLAFPIFFAFYFGYMIWKRDFTLFSDLESVDLDYHRRIYDPELVKQEDEEKKEMLK 579

Query: 532 NKNWWDRFW 540
           N   W R +
Sbjct: 580 NSPMWKRMY 588

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  252 bits (644), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 159/550 (28%), Positives = 269/550 (48%), Gaps = 22/550 (4%)

Query: 8   VHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXX 67
           V SF+ +       +   + +      +++ ++ RH+ M                     
Sbjct: 36  VDSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHY 95

Query: 68  XXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYMYWF 126
                    YL +  V + +  + GEM    P +  +F  ++  F+S  FG A  +++  
Sbjct: 96  GGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCL 155

Query: 127 SWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKV 186
            W   F LEL     +I++W ++V    ++ I ++ +   + F  R YGE EF     KV
Sbjct: 156 QWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKV 215

Query: 187 LXXXX-XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAA 245
           L                   TG +G RYW+NPG +      S     +  G    L+ A 
Sbjct: 216 LMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSF-----VSGTPLDKLKGTAYVLVTAY 270

Query: 246 FTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ--- 302
           F+F G EL  ++  E+  P+  +P A KK V+RIL+ Y+ ++++IG LVP++  +L    
Sbjct: 271 FSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSG 330

Query: 303 SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAP 362
           SND  V  SP+++ I+  G K+LPHI NAVILI++IS GNS +Y   R+L  LA+   AP
Sbjct: 331 SND--VHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAP 388

Query: 363 KFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSH 422
           K      + G P ++++  ++FG +A+   +   +K F WL  I G++  F W  I  SH
Sbjct: 389 KQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSH 448

Query: 423 IRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANF 478
            RF +A+K +G S   L Y+A+   W + YAVFF +++ + Q + +  P    K  V +F
Sbjct: 449 FRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSF 508

Query: 479 FAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRR--DIE---EEVWSDDVEDKN 532
           F  Y++  L++I ++ + ++ +   L+  L  +DLDT RR  D+E   +E +      +N
Sbjct: 509 FQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRN 568

Query: 533 KNWWDRFWNY 542
             W+ +  N+
Sbjct: 569 SPWYVKVLNF 578

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  251 bits (641), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 164/530 (30%), Positives = 253/530 (47%), Gaps = 30/530 (5%)

Query: 5   QPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRX 64
           +P++   ++   +T +      ++ +    VKR LK RHIS+                  
Sbjct: 17  EPKIAEVELQRLETDSL-----NEFDPHSGVKRALKNRHISLLALGGIIGPGCLIGAGNA 71

Query: 65  XXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMY 124
                       +  +G V FS+ +S+GE+ T  P    F   A+RF S    A +GY Y
Sbjct: 72  LNKGGPLALLLGFGIIGLVCFSIMESIGELVTLYPSGGGFITLARRFHSEGLSAVSGYAY 131

Query: 125 WFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASV 184
              +    A E + +  I+QFW   VP+  +  I W    +  L  V  +GE E+W+A  
Sbjct: 132 IVVFFAVLANEYNTISSILQFWGPQVPIYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWF 191

Query: 185 KVLXXXXXXXXXXXXXXXXXVTG--PVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLI 242
           K+L                 + G  P+GF+YWKNPG    G          F G     +
Sbjct: 192 KILGLVAFYIFSIVYMSGG-IPGKPPIGFQYWKNPGALSHG----------FRGIAVVFV 240

Query: 243 NAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ 302
             +  + GTE V + A E + PRK VP A+++  +RIL+ Y+G     G+ VPYNDP L 
Sbjct: 241 FCSTFYSGTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYNDPTLG 300

Query: 303 SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAP 362
           +    + S P  I +  AG     H+ NA IL+T ISA NS++YIGSR L  LA    AP
Sbjct: 301 AQTKSLKS-PISIALSRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAP 359

Query: 363 KFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSH 422
           +    T K GVP   ++  +  G ++ M  + G   A+ +++N+ GV  F  W  IS +H
Sbjct: 360 RILAWTDKRGVPVPALIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITH 419

Query: 423 IRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAY 482
           +RF KA   +G S ++LPY+A+  PW   +++   + + +IQG+TS  P F   +F  AY
Sbjct: 420 LRFRKAWVAQGRSLSELPYRALFYPWTTIFSLAANIFLALIQGWTSLVP-FVAKDFVDAY 478

Query: 483 ISVFLFIIFWVAFQIW----FKCRLVWKLQDVDLDT-DRRDIEEEVWSDD 527
           I +    + +V    W    FK      +  ++L+   RRD++E+  SDD
Sbjct: 479 ILLPAAGLLYVGINFWKNRNFKTV---NIHGINLEEGQRRDLDED--SDD 523

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  253 bits (645), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 153/530 (28%), Positives = 265/530 (50%), Gaps = 19/530 (3%)

Query: 14  DSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXX 73
           +++D    I ++  D +    +K+ +K RH+ M                +          
Sbjct: 74  NTSDLEDGIESITSDSK----LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAAL 129

Query: 74  XXXYLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYMYWFSWAMTF 132
              Y+ +  V + + Q+ GEM    P + A+F  ++  F+S  FG A  ++Y F W    
Sbjct: 130 VIGYVLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVL 189

Query: 133 ALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX- 191
            LEL      IQ+W   +    +I I ++ L   ++F V+ YGE EF     K+L     
Sbjct: 190 PLELITASMTIQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGF 249

Query: 192 XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGT 251
                          G +G  YW NPG +     + + + ARF      L+   F+F G 
Sbjct: 250 IILSVVINCGGAGDDGYIGGAYWHNPGAF-----AGDTSIARFKNVCYILVTGYFSFGGM 304

Query: 252 ELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ-SNDSYVSS 310
           EL  ++  E   PRK+ P A K+ ++RI++ Y+ ++++IG  VPYND +L  +  S   +
Sbjct: 305 ELFALSVQEQSNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHA 364

Query: 311 SPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSK 370
           SP+++     G KI+PHI NAVILI+++S  NS++Y G R++  L++   APKF     +
Sbjct: 365 SPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDR 424

Query: 371 AGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALK 430
            G P   ++   +FG +A++  ++  +  FTWL  I G++  F W  I  SH+RF +A+K
Sbjct: 425 EGRPLRALIVCCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMK 484

Query: 431 QRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISV 485
            +G S ++L YKA    W + Y  FF +++ + Q + + AP     +  V +FF +Y++ 
Sbjct: 485 VQGRSLDELGYKATTGIWGSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESYLAA 544

Query: 486 FLFIIFWVAFQIWFK-CRLVWKLQDVDLDTDRRDIEEE-VWSDDVEDKNK 533
            +++ F+  + I+ +   L+  L  +DLD  RR  + E +  +D E++ K
Sbjct: 545 PIWLTFFFGYMIYNRDFTLLNPLDKIDLDFHRRIYDPELIRQEDQENEEK 594

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  252 bits (643), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 161/543 (29%), Positives = 260/543 (47%), Gaps = 26/543 (4%)

Query: 15  SNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXX 74
           SND+    S  +  Q    ++K+ LK  HI +                            
Sbjct: 32  SNDSEKNGSLPNKPQSGDHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLF 91

Query: 75  XXYLFMGTVVFSVTQSLGEMCTFIP-------VTASFTVFAQRFLSPAFGAANGYMYWFS 127
             Y  M T+++ V  +L EM  F+P          S +    R++  + G A G+ Y + 
Sbjct: 92  ISYCIMSTIIYPVMNALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVYC 151

Query: 128 WAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVL 187
           + +  A E +    ++ +WT AVP AAWI+I   ++ + N   V  YG  E    S+K+ 
Sbjct: 152 YVILVAAECTAASGVVTYWTTAVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIF 211

Query: 188 XXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLIN 243
                              GP    +GFR+WK+PG W   +  ++    R    ++ +I 
Sbjct: 212 CILGIIIVSIVLFFGG---GPNHDRLGFRFWKDPGAWAYHL--ADGGAGRLSDIITGVIR 266

Query: 244 AAFTF-QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDP--- 299
           A F F  G ELV +T+ E Q+ R+ + KA ++ V+R++ FY  S L  G++V  NDP   
Sbjct: 267 AGFAFILGPELVVLTSTEAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLL 326

Query: 300 -KLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKN 358
             L        SSPF+I IQNAG K+LPHI N  IL +  S+GNS +Y  +R L  L++ 
Sbjct: 327 NALSQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQE 386

Query: 359 KAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLI 418
             APK F   ++ GVPY  V F + F  LAY+  ++     F W  NI  ++GF  W+  
Sbjct: 387 GYAPKIFNRVNRWGVPYTGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICS 446

Query: 419 SCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANF 478
             +++RF KA+    +  + LP+K    P+  ++ +  + II +I G+ SF   +   +F
Sbjct: 447 GVAYLRFRKAVFFNNL-YDRLPFKTPFQPYFTWFYIILIAIICLINGYESFV-HWNYKDF 504

Query: 479 FAAYISVFLFIIFWVAFQIWFKCRLVW--KLQDVDLDTDRRDIEEEVWSDDVED-KNKNW 535
            AAYI++ LF+I W+  + + +    W   + ++D+ T  R+IEEE    +      +N 
Sbjct: 505 IAAYITLPLFLILWLGHKAYTRTWSQWMISVSEIDVTTGLREIEEETKELNARRIPPRNL 564

Query: 536 WDR 538
           W++
Sbjct: 565 WEK 567

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  253 bits (645), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 154/542 (28%), Positives = 265/542 (48%), Gaps = 28/542 (5%)

Query: 2   KLNQPQVHSFQVDSNDTPTTISTLDD----------DQEKQQDVK-----RELKKRHISM 46
           +L      +F + S D+P    T +D          +  +Q+D+      ++L  RH+  
Sbjct: 38  ELTSKTDSAFPLSSKDSPGINQTTNDITSSDRFRRNEDTEQEDINNTNLSKDLSVRHLLT 97

Query: 47  XXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTV 106
                                         ++ + T +F+V  SLGE+    PV   F V
Sbjct: 98  LAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNV 157

Query: 107 FAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTIS 166
           ++ RF+ P+F  A    Y   W +   LEL      I++W   +   AW++I +  + ++
Sbjct: 158 YSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALA 217

Query: 167 NLFPVRIYGEIEFWIASVKVLXXXX-XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGII 225
           N+  V+ +GE EF ++ +K+L                    G +G +YW +PG +     
Sbjct: 218 NMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAF----- 272

Query: 226 SSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIG 285
             + +  +F G  S  + AAF++ G E+  ++A E + PR+T+PKA K+  + I   Y+ 
Sbjct: 273 VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVT 332

Query: 286 SLLVIGLLVPYNDPKLQSNDSYV--SSSPFIITIQNAGTKILPHIFNAVILITIISAGNS 343
            L +IG LVP NDP+L +  S V  +SSP +I I+N G K LP + NA+ILI ++S  NS
Sbjct: 333 ILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANS 392

Query: 344 NVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWL 403
            VY  SR +  +A     PKF     K G P   +L T  FG L+++  +    + FTWL
Sbjct: 393 AVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWL 452

Query: 404 LNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVI 463
             + G++  F W+ I+ SHIRF +A+K +  S ++LP+ +      ++Y    + ++++ 
Sbjct: 453 SALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIA 512

Query: 464 QGFTSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRD 518
             +TS  P         +FF  Y+S  + I+ +V  +++ +   L+ KL+D+DLDT R+ 
Sbjct: 513 SFWTSLFPLGGSGASAESFFEGYLSFPILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQ 572

Query: 519 IE 520
           ++
Sbjct: 573 VD 574

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  252 bits (643), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 151/552 (27%), Positives = 269/552 (48%), Gaps = 26/552 (4%)

Query: 5   QPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRX 64
           + +V+   +D  D   +I + D+       +K+ +K RH+ M                + 
Sbjct: 54  RAEVNHNGIDLEDGTNSIQSDDN-------LKKAMKSRHVIMMSLGTGIGTGLLVANAKG 106

Query: 65  XXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYM 123
                       Y  +  + + V Q+ GEM    P +   F  +A  F+S  FG A  ++
Sbjct: 107 LYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWL 166

Query: 124 YWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIAS 183
           +   W     LEL      I++W   +    ++ I++V L   + F VR YGE EF   S
Sbjct: 167 FCIQWLTVLPLELITASMTIKYWNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNS 226

Query: 184 VKVLXXXX-XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLI 242
            K+L                  V G +G +YW++PG +     +S+   +RF G    L+
Sbjct: 227 CKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLV 281

Query: 243 NAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ 302
            A F++ G EL  ++  E + PR++ P A K+ ++RIL+ Y+ ++++IG  VP+N  +L 
Sbjct: 282 TAYFSYGGVELFALSVNEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLM 341

Query: 303 -SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAA 361
            +  S   +SP+++ +   G K++PHI NAVILI++ S  NS +Y   R+L  LA+   A
Sbjct: 342 GAGGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYA 401

Query: 362 PKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCS 421
           PK+F    + G P   ++  S+FG +A+   +   +  FTWL  I G++  F W  I  S
Sbjct: 402 PKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLS 461

Query: 422 HIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPK-----FKVA 476
           H+RF  A+K +G S N+L Y ++   W + Y  FF V++ + Q + + +P      +   
Sbjct: 462 HVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAE 521

Query: 477 NFFAAYISVFLFIIFWVAFQIWFK-CRLVWKLQDVDLDTDRRDIEEEVWSDDVED----- 530
            FF +Y++  +++ F++ + ++ +    +  L+ +DLD  RR  + E+   + E+     
Sbjct: 522 AFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERI 581

Query: 531 KNKNWWDRFWNY 542
           +N  W  +  N+
Sbjct: 582 RNGGWTQKLLNF 593

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  253 bits (645), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 158/543 (29%), Positives = 277/543 (51%), Gaps = 24/543 (4%)

Query: 8   VHSFQ-VDSNDTPTTI-STLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXX 65
           V SF+ VD   T + + S L +   +  D+K+ +KKRH+ +                +  
Sbjct: 88  VDSFKRVDEKQTTSDLESGLGEVPGENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVL 147

Query: 66  XXXXXXXXXXXYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMY 124
                      Y  MG+ ++ + Q+ GE+   +  + ++F ++    +  AFG A  ++Y
Sbjct: 148 RDAGPGGLVIGYSIMGSCLYCIIQACGELAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVY 207

Query: 125 WFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASV 184
              W     LEL      I++WT +V    ++SI +VL+ + N F  R Y E EF+  S 
Sbjct: 208 CLQWLCVCPLELVTASMTIKYWTTSVNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSC 267

Query: 185 KVLXXXXX-XXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLIN 243
           KVL                   +G +G +YW +PG +     + N     F G +++   
Sbjct: 268 KVLMMAGFFILGIIITCGGAGTSGYIGAKYWHSPGAF-----NGNRPIDHFKGVMATFTT 322

Query: 244 AAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL-Q 302
           AAF F  +E + +TA E   PRK +PKA K +++RIL  ++ S+ +IG LVPYN P L  
Sbjct: 323 AAFAFGASEFISLTAAEQSNPRKAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLG 382

Query: 303 SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAP 362
           S      +SP+++ + + G +++PH  NAVIL++++S GNS  Y  SR+L  LA+   AP
Sbjct: 383 SGSDATKASPYVVAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAP 442

Query: 363 KFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSH 422
           K FT   K G P V ++ +++F ++A+   +   ++ FTWLL I G++  F W+ I  SH
Sbjct: 443 KMFTYIDKRGRPLVAMVCSTLFMTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISH 502

Query: 423 IRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANF 478
           +RF +ALK +G S  ++ +K+ +  + + YA   +++ ++ Q + + AP         NF
Sbjct: 503 LRFRRALKVQGHSLGEIGFKSQVGIYGSLYAATMLILALIAQFWVALAPIGGNGLDARNF 562

Query: 479 FAAYISVFLFIIFWVAFQIWFKCRLVWKL----QDVDLDTDRRDIEEEVWSDDV---EDK 531
           F  Y+++ + ++ +  ++I    +  WK       +DL + R+  +E++   +V   E +
Sbjct: 563 FQNYLAMPILLVLYFGYKIR---KRDWKFWIPAHRIDLVSHRKVFDEDILKQEVAEIEQE 619

Query: 532 NKN 534
            KN
Sbjct: 620 KKN 622

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  251 bits (642), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 147/478 (30%), Positives = 255/478 (53%), Gaps = 18/478 (3%)

Query: 77  YLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALEL 136
           ++ + T +F+V  +LGE+    PV   F V+  RF+ P+   A    Y   W +   LEL
Sbjct: 134 WVIISTCLFTVINALGELAAAYPVVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLEL 193

Query: 137 SVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXXX 195
                 I++W   +   AW++I + ++ ++N+  V+ +GE EF ++ VK+L         
Sbjct: 194 VAASITIKYWNDTINSDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFTILG 253

Query: 196 XXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVG 255
                      G +G  YW +PG +       +    +F G  S  + AAF++ G EL  
Sbjct: 254 IVLACGGGPQGGFLGGHYWHDPGSF-----VGDKPGTQFKGLCSVFVTAAFSYSGIELTA 308

Query: 256 ITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV--SSSPF 313
           ++A E ++PRKT+PKA K+  + +   Y+  L +IG LVP++DP+L +  S V  ++SP 
Sbjct: 309 VSAAESKDPRKTIPKATKRTFWLVTASYVTILTIIGCLVPFDDPRLLNGSSSVDAAASPL 368

Query: 314 IITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGV 373
           +I+I+NAG K L  + NA+ILI+I+S  NS VY  SR +  +A     PK  +   K G 
Sbjct: 369 VISIKNAGIKGLDSLMNAIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGR 428

Query: 374 PYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRG 433
           P   +L T  FG L+++  +    + FTWL  + G++  F W+ I+ SHIRF  A+K + 
Sbjct: 429 PVNAILSTLFFGLLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQN 488

Query: 434 ISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFI 489
            + ++LPY +      ++Y V  + +++V   +TS  P       V +FF  Y+S+ + I
Sbjct: 489 KTLDELPYLSQCGVIGSWYGVIVLFLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPILI 548

Query: 490 IFWVAFQIWFK-CRLVWKLQDVDLDTDRRDIE-----EEVWSDDVEDKNKNWWDRFWN 541
             +V  +++ +  +++ KL+D+DL+T R+ I+      E+ ++      K++  RFW+
Sbjct: 549 ACYVGHKLYVRNLQVLVKLEDMDLETGRKHIDAHEHRAEILAEKAALSQKSFIKRFWH 606

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  251 bits (641), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 157/521 (30%), Positives = 265/521 (50%), Gaps = 20/521 (3%)

Query: 35  VKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEM 94
           +KR LK RH+ M                +             +   GT+++ +  ++GE+
Sbjct: 77  LKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAMGEL 136

Query: 95  CTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW-TMAVPLA 153
               PV+  FT +A RF+  +FG AN + Y   W +   LE+      + +W T      
Sbjct: 137 AVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPKYRD 196

Query: 154 AWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGPVGFRY 213
            ++++ +V++   N+F V+ YGE EF  + +KV+                   G      
Sbjct: 197 GFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYIGGA 256

Query: 214 -WKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAI 272
            W NPG +       N    RF G  S  + AAF+F G+ELVG+ + E   PRK++P+A 
Sbjct: 257 NWHNPGAF-----VGNTAGKRFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLPRAA 311

Query: 273 KKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY-VSSSPFIITIQNAGTKILPHIFNA 331
           K+V +RI +FYI SL +IGLLVPYND +L    S   ++SPF++ I+N G K LP + N 
Sbjct: 312 KQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAASPFVLAIKNHGIKGLPSVVNV 371

Query: 332 VILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYME 391
           VILI ++S GNS V+  SR L  LA+    PK F    + G P V + FTS FG L+++ 
Sbjct: 372 VILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLLSFIA 431

Query: 392 TTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAY 451
            +    + F WLL + G++  F W+ I   H+RF +AL  +G S ++L + +    W + 
Sbjct: 432 ASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSPAGVWGSI 491

Query: 452 YAVFFMVIIIVIQGFTSFAP---KFKVANFFAAYISVFLFIIFWVAFQIWFKC-RLVWKL 507
           Y    +++I+  Q + +  P        +FF +Y+S+ + ++ ++  + + +  +L  + 
Sbjct: 492 YGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGHKCYKRNWKLFIRA 551

Query: 508 QDVDLDTDRRDIEEEVWSDDVEDK-----NKNWWDR---FW 540
           +++D+DT RR+++ E    ++ ++     +K+ W R   FW
Sbjct: 552 ENIDIDTGRREVDIEALKVELAEEKAVLASKSLWIRSYYFW 592

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  251 bits (642), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 158/538 (29%), Positives = 268/538 (49%), Gaps = 17/538 (3%)

Query: 9   HSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXX 68
           HS   D   +      + +D +    + ++L  RH+                        
Sbjct: 74  HSLTRDEAGS----GVMKEDVDGHPQMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSG 129

Query: 69  XXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSW 128
                   ++ + T +F+V  SLGE+    PV   F V+  RF+ P+FG A    Y   W
Sbjct: 130 GPASLVIDWVIISTCLFTVVNSLGELAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQW 189

Query: 129 AMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLX 188
            +   LEL      I++W   +   AW++I +  +  +N+  V+ +GE EF ++ +K+L 
Sbjct: 190 LVLLPLELVAASITIRYWNDKINSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILA 249

Query: 189 XXX-XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFT 247
                              G +G +YW +PG +         +  +F G  S  + AAF+
Sbjct: 250 IVGFTILGIVLSCGGGPKGGYIGGKYWHDPGAF-----VGETSGTKFKGLCSVFVTAAFS 304

Query: 248 FQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY 307
           + G EL  ++A E   PR+T+PKA K+  + I + Y+  L +IG LVPYN+PKL +  S 
Sbjct: 305 YSGMELTAVSAAESLNPRETIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSS 364

Query: 308 V--SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFF 365
           V  +SSP +I I+N G + LP + NA+ILI I+S  NS VY  SR +  +A+ +  P+F 
Sbjct: 365 VDAASSPLVIAIENGGIRGLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFL 424

Query: 366 TNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRF 425
               + G P    L T  FG L+++  +   ++ FTWL  + G++  FAW+ I+ SHIRF
Sbjct: 425 GRVDRKGRPLNATLLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRF 484

Query: 426 MKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAA 481
            +A+  +GIS ++LPY +M     ++Y V  + +++V   +TS  P         +FF  
Sbjct: 485 RQAMAHQGISLDELPYISMTGVSGSWYGVIVLFLVLVASFWTSLFPLGGKGADATSFFEG 544

Query: 482 YISVFLFIIFWVAFQIWF-KCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDR 538
           Y+S  + I+ +V  +++  K RL+  + D+DL +DR+ ++ EV  +++  + +    R
Sbjct: 545 YLSFPILIVCYVGHKLYIRKKRLLIDVADMDLVSDRKVVDVEVCREEMRIEKEQLAKR 602

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  251 bits (642), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 157/534 (29%), Positives = 259/534 (48%), Gaps = 24/534 (4%)

Query: 26  DDDQEK-------QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYL 78
           D+D E        +  +K+ +K RH+ M                              Y 
Sbjct: 85  DNDLESGTRSFISESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYG 144

Query: 79  FMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELS 137
            +  V + + Q+ GEM    P +  +F  +   F+S  FG A  +++   W     LEL 
Sbjct: 145 LVSFVTYFMIQAAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELI 204

Query: 138 VVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXX-XX 196
                I++W   +    ++ I +V L   + F V+ YGE EF   S K+L          
Sbjct: 205 TSSLTIKYWNDKINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSI 264

Query: 197 XXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGI 256
                     G +G +YW +PG +     +S+ N  RF G    L+ A F++ GTEL  +
Sbjct: 265 VVNCGGAGHDGYIGGKYWHDPGAF-----TSHTNIGRFKGICFILVTAYFSYGGTELYVL 319

Query: 257 TAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPY-NDPKLQSNDSYVSSSPFII 315
           +  E + PRK+ P+A K+ ++RI+V Y+ ++++IG  VP+ ND  + S+ S   +SP+++
Sbjct: 320 SVNEQENPRKSTPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHASPYVL 379

Query: 316 TIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPY 375
                G +I+PH  NAVILI++IS  NS++Y   R+L  LA+   APKF T   + G P 
Sbjct: 380 AASIHGVRIVPHFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPL 439

Query: 376 VTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGIS 435
             +   S+FG + +   +   ++ FTWL  I G++  F W  I  SH+RF +A+K +G  
Sbjct: 440 TALATCSLFGVIGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRD 499

Query: 436 RNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP---KFKVANFFAAYISVFLFIIFW 492
            N+L YKA+   W + Y VFF +++   Q + + AP   K    +FF +Y++  +F  F+
Sbjct: 500 LNELGYKAVSGVWGSVYGVFFNILVFFAQFWVALAPPGSKPTALSFFESYLAFPIFFTFY 559

Query: 493 VAFQIWFK-CRLVWKLQDVDLDTDRRDIEEEVWSDDVED-----KNKNWWDRFW 540
             + +W K    +  L+ +DLD  RR  + E    + E+     KN + W R +
Sbjct: 560 FGYMLWNKDFTFLIPLESIDLDFHRRVYDPEFIRQEREEKKIKLKNSSIWTRMY 613

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  251 bits (640), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 142/455 (31%), Positives = 241/455 (52%), Gaps = 13/455 (2%)

Query: 77  YLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALEL 136
           ++ + T +F+V  +LGEM    PV   F V+  RF+ P+ G A    Y   W +   LEL
Sbjct: 117 WIIISTCLFTVINALGEMAAAFPVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLEL 176

Query: 137 SVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXXX 195
                 I++W   +   AW++I + ++ ++N+  V+ +GE EF ++ +K+L         
Sbjct: 177 VAASMTIKYWNETINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILG 236

Query: 196 XXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVG 255
                      G +G +YW +PG +    +  N +  +F G  S  + AAF++ G E+  
Sbjct: 237 IVLACGGGPHGGFIGGKYWNHPGSF----VGHN-SGTKFKGLCSVFVTAAFSYSGIEMTA 291

Query: 256 ITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV--SSSPF 313
           ++A E ++PR T+PKA K+  + I   Y+  L +IG LVPY+DP+L S  S V  +SSP 
Sbjct: 292 VSAAESKDPRTTIPKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASSPL 351

Query: 314 IITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGV 373
           +I I+N G K LP + NA+ILI+IIS  NS VY  SR +  +A     P+        G 
Sbjct: 352 VIAIENDGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGR 411

Query: 374 PYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRG 433
           P   ++FT  FG L+++  +      FTWL  + G++  F W+ I+ SHIRF +++ ++ 
Sbjct: 412 PMNAIIFTLFFGLLSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQN 471

Query: 434 ISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFI 489
            S ++LP+ +    W ++Y    + +++V   +TS  P         +FF  Y+S  + +
Sbjct: 472 RSLDELPFLSQTGVWGSWYGTIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILL 531

Query: 490 IFWVAFQIWFKCR-LVWKLQDVDLDTDRRDIEEEV 523
             +   +++ + R  +  L D+DLDT RR ++ +V
Sbjct: 532 ACYFGHKLYVRKREFMVGLADMDLDTGRRQVDLDV 566

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  251 bits (640), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 158/555 (28%), Positives = 263/555 (47%), Gaps = 38/555 (6%)

Query: 2   KLNQPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXX 61
           + N   +    VDS   P       D      ++KR LK RH+ M               
Sbjct: 51  QYNNRNIFQRCVDSFKPPL------DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGS 104

Query: 62  XRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANG 121
            +             +   G+ +      LGE+    PV  +F  +  RFL P+      
Sbjct: 105 GKAIAEGGPLGVVLGWTIAGSQIIGTVHGLGEITVRFPVVGAFANYGTRFLDPSISFVVS 164

Query: 122 YMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWI 181
            +Y   W     LE+      +Q+W  ++    W++I + ++   NLF  R +GE EF  
Sbjct: 165 TIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGARGFGEAEFAF 224

Query: 182 ASVKVLXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGW 237
           ++VK +                   GP    +G +YW +PG    G          F G 
Sbjct: 225 STVKAITVGGFIILCIVLICG---GGPDHEFIGAKYWHDPGCLAHG----------FPGV 271

Query: 238 VSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN 297
           +S L+ A+++  G E+  + +GE     K +P AIK+V +RI+ F++ SL ++G LVPY 
Sbjct: 272 LSVLVVASYSLGGIEMTCLASGETDP--KGLPSAIKQVFWRIIFFFLVSLTLVGFLVPYT 329

Query: 298 DPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAK 357
           +  L    S V +SPF+I I+    K+LP I NAVILI+++S GNS ++  SR L  +A 
Sbjct: 330 NQNLLGGSS-VDNSPFVIAIKLHHIKVLPSIVNAVILISVLSVGNSCIFASSRTLCSMAH 388

Query: 358 NKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLL 417
               P +F    +AG P V ++  S+FG LA++  +    + F WL+ I G+A    WL 
Sbjct: 389 QGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLS 448

Query: 418 ISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP------ 471
           I+ SH+RF  A+K +G S ++L + + +  W + Y+     +I++ Q + S  P      
Sbjct: 449 INLSHVRFRLAMKAQGKSLDELEFVSAVGIWGSVYSALINCLILIAQFYCSLWPIGGWTS 508

Query: 472 -KFKVANFFAAYISVFLFIIFWVAFQIWFKCRL-----VWKLQDVDLDTDRRDIEEEVWS 525
            K +   FF  Y+   + +  +V  +I+++C++     V +L+D+DL+TDR+DI+ E+  
Sbjct: 509 SKERAKIFFQNYLCALIMVFIFVIHKIYYRCQMGKWWGVKELKDIDLETDRKDIDIEIVK 568

Query: 526 DDVEDKNKNWWDRFW 540
            ++ +K K    R W
Sbjct: 569 QEIAEKKKYLDSRPW 583

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  251 bits (641), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 163/543 (30%), Positives = 264/543 (48%), Gaps = 30/543 (5%)

Query: 23  STLDDDQEKQQD----------VKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXX 72
           S +D D E+  D          +K+ +K RH+ M                +         
Sbjct: 69  SEVDSDVERNGDAAYSVNTDTHLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAA 128

Query: 73  XXXXYLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYMYWFSWAMT 131
               Y  +  V + + Q+ GEM    P +  +F  +A  F+S  FG A  +++   W   
Sbjct: 129 LVIGYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTV 188

Query: 132 FALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX 191
             LEL     II++WT  V    ++ I +V L   +   V+ YGE EF     K+L    
Sbjct: 189 LPLELITASLIIKYWTEKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAG 248

Query: 192 XXX-XXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQG 250
                           G +G +YW +PG +      +N  E RF G    L++  F++ G
Sbjct: 249 FIIFSIVVNCGGAGHDGYIGGKYWHSPGAFA----GTNAAE-RFKGVCYVLVSGYFSYGG 303

Query: 251 TELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ-SNDSYVS 309
           TEL  ++  E + PRK+ P A K+ ++RILV Y+ ++++IG  VP+ND +L  +  S   
Sbjct: 304 TELYVLSVNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATH 363

Query: 310 SSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTS 369
           +SP+++     G +++PHI NAVILI +IS  NS++Y   R+L  LA+   APKF T   
Sbjct: 364 ASPYVLAASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVD 423

Query: 370 KAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKAL 429
           + G P   +L  ++FG +A+   +   ++ FTWL  I G++  F W  I  SH+RF +A+
Sbjct: 424 REGRPLYALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAM 483

Query: 430 KQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP---KFKVANFFAAYISVF 486
           K +G   N++ Y A    W + Y V F +++ + Q + + AP        +FF +Y++  
Sbjct: 484 KLQGRDLNEVGYIANTGYWGSVYGVVFNILVFIAQFWVALAPPKSPITAQSFFESYLAFP 543

Query: 487 LFIIFWVAFQIWFK-CRLVWKLQDVDLDTDRRDIEEEVW-SDDVEDK----NKNWWDR-- 538
           ++I F+  + IW K    +  L  +DLD  RR  + EV   +D+E+K    N N W +  
Sbjct: 544 IWIAFYFGYMIWNKDYTFLNPLDKIDLDHHRRIYDPEVLKQEDMENKERVRNGNIWTKLK 603

Query: 539 -FW 540
            FW
Sbjct: 604 WFW 606

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  253 bits (645), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 154/550 (28%), Positives = 270/550 (49%), Gaps = 26/550 (4%)

Query: 14  DSNDTPTTISTLDD----DQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXX 69
           + + TP  +    D    D  K  ++K+ +K RH+ M                       
Sbjct: 133 NEDGTPKPLPHHHDAQINDNSKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAG 192

Query: 70  XXXXXXXYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYWFSW 128
                  +  MG+ ++ + Q++GE+   +  +   F  +    +  AF  A  ++Y   W
Sbjct: 193 PAGLIIGFGIMGSCLYCIIQAVGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQW 252

Query: 129 AMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFP-VRIYGEIEFWIASVKVL 187
                LEL      I++WT  V    ++ I ++L+   NL      Y E EF   S K++
Sbjct: 253 LCVCPLELVTASMTIKYWTTKVDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIM 312

Query: 188 XXXXXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAF 246
                             T G +G +YW +PG      +  + +  RF G +++L+NAAF
Sbjct: 313 MMIGFFILGITVICGGAGTDGYIGAKYWHDPGA-----LRGDTSIQRFKGCMATLVNAAF 367

Query: 247 TFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN-DPKLQSND 305
            F  +E +G+TA E   PRK +P A KK+++RIL  ++ S+ ++G LVPYN D  L S  
Sbjct: 368 AFGMSEFIGVTASEQSNPRKAIPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTG 427

Query: 306 SYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFF 365
           S V +SP+++ I   G +++PH  NAVILI+++S  NS  Y  SR+L  LA+   APK +
Sbjct: 428 SGVKASPYVLAISTHGVRVVPHFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIY 487

Query: 366 TNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRF 425
           +   + G P V +   ++FG +A+  T+   D+ F WLL I G++  F W+ I  SHIRF
Sbjct: 488 SYIDREGRPLVGMATAAIFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRF 547

Query: 426 MKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-------KFKVANF 478
            +A+  +G S  +L +++ +  + + YA   M +I++ Q + +  P       K    NF
Sbjct: 548 RRAMHVQGRSIGELGFRSQVGWYGSAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNF 607

Query: 479 FAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNW-- 535
           F  Y+++ + + F+  ++IW K  +L  + +++DL + R   +EE+   + ++  +    
Sbjct: 608 FENYLAMPILLAFYFGYKIWKKDWKLFIRAKNIDLISHRNIFDEELIKQEEDEYRERLRT 667

Query: 536 ---WDRFWNY 542
              W R +++
Sbjct: 668 GPKWRRVYDF 677

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  251 bits (640), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 143/470 (30%), Positives = 248/470 (52%), Gaps = 13/470 (2%)

Query: 77  YLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALEL 136
           ++ + T +F+V  SLGE+    PV   F V++ RF+ P+F  A    Y   W +   LEL
Sbjct: 128 WVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLEL 187

Query: 137 SVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXXX 195
                 I++W   +   AW++I +  + ++N+  V+ +GE EF ++ +K+L         
Sbjct: 188 VAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILG 247

Query: 196 XXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVG 255
                      G +G +YW +PG +       + +  +F G  S  + AAF++ G E+  
Sbjct: 248 IVLSCGGGPHGGYIGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSYSGIEMTA 302

Query: 256 ITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV--SSSPF 313
           ++A E + PR+T+PKA K+  + I   Y+  L +IG LVP NDP+L +  S V  +SSP 
Sbjct: 303 VSAAESKNPRETIPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPL 362

Query: 314 IITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGV 373
           +I I+N G K LP + NA+ILI ++S  NS VY  SR +  +A     PKF     K G 
Sbjct: 363 VIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGR 422

Query: 374 PYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRG 433
           P   +L T  FG L+++  +    + FTWL  + G++  F W+ I+ SHIRF +A+K + 
Sbjct: 423 PMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQE 482

Query: 434 ISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFI 489
            S ++LP+ +      ++Y    + ++++   +TS  P         +FF  Y+S  + I
Sbjct: 483 RSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILI 542

Query: 490 IFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDR 538
           + +   +I+ +   L+ KL+D+DLDT R+ ++  +  ++++ + +    R
Sbjct: 543 VCYFGHKIYTRNWTLMVKLEDIDLDTGRKQVDLALRREEMKVERETLAKR 592

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  249 bits (636), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 169/512 (33%), Positives = 244/512 (47%), Gaps = 23/512 (4%)

Query: 25  LDDDQE-----KQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLF 79
           +D+D +      Q  VKR LK RHIS+                              +  
Sbjct: 34  IDEDPDVSRYDPQTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSI 93

Query: 80  MGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVV 139
           +G + FSV +S+GEM T  P    FT  A+RF S A  A  GY Y   +    A E + +
Sbjct: 94  IGIIAFSVMESIGEMITLYPSGGGFTTLARRFHSDALPAVCGYAYVVVFFAVLANEYNTL 153

Query: 140 GQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXX 199
             I+QFW   VPL  +I I W    I  L  V ++GE E+W+A +K++            
Sbjct: 154 SSILQFWGPQVPLYGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYYIFSIVY 213

Query: 200 XXXXXVTGPV-GFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITA 258
                   P  GF YW +PG    G          F G     +  +  + GTE V + A
Sbjct: 214 ISGDIRNRPAFGFHYWNSPGALSHG----------FKGIAIVFVFCSTFYSGTESVALAA 263

Query: 259 GEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQ 318
            E + P K VP A+++ ++RILV YIG  +  G  VP++DP L S  + V  SP  I I 
Sbjct: 264 TESKNPGKAVPLAVRQTLWRILVVYIGIAVFYGATVPFDDPNL-SASTKVLKSPIAIAIS 322

Query: 319 NAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTV 378
            AG     H+ NA ILIT ISA N ++YIGSR L  LA    APK    T + GVP   +
Sbjct: 323 RAGWAGGAHLVNAFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPAI 382

Query: 379 LFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRND 438
              +  G ++ M  + G   A+++++N+ GV  F  W +IS +H+R  KA   +G S  +
Sbjct: 383 TVFNALGLISLMNVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIEE 442

Query: 439 LPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIW 498
           LPY+A+  PW    ++   + + +IQG++ F P F   NF  AYI + + I+ ++   + 
Sbjct: 443 LPYEALFYPWTPVLSLAANIFLALIQGWSYFVP-FDAGNFVDAYILLPVGILLYIGICV- 500

Query: 499 FKC---RLVWKLQDVDLDTDRRDIEEEVWSDD 527
           FK    R V  L+ ++LD  RR   E   SD 
Sbjct: 501 FKSNHFRTV-DLRSINLDEGRRKDMEADLSDQ 531

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  249 bits (635), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 156/473 (32%), Positives = 243/473 (51%), Gaps = 11/473 (2%)

Query: 32  QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSL 91
           Q  +K  LK RH+ M                              +   GT+++++  +L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMAL 142

Query: 92  GEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW-TMAV 150
           GE+    P++  FT +A RF+  +FG AN + Y   W +   LE+      + FW T   
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXXXXXXXXXXXXVTGPV 209
               ++++ WV++ I N+F V+ YGE EF  + +KV+                    G +
Sbjct: 203 YRDGFVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYI 262

Query: 210 GFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVP 269
           G +YW +PG +     + +   A+F G  S  + +AF+F G+ELVG+ A E  EPRK+VP
Sbjct: 263 GGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSVP 317

Query: 270 KAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY-VSSSPFIITIQNAGTKILPHI 328
           KA K+V +RI +FYI SLL+IGLLVPYND  L    S   ++SPF+I I+  G K LP +
Sbjct: 318 KAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAASPFVIAIKTHGIKGLPSV 377

Query: 329 FNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLA 388
            N VILI ++S GNS +Y  SR +  LA+ +  P+ F    + G P V +  TS FG +A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGLIA 437

Query: 389 YMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPW 448
           ++  +      F WLL + G++  F W  I   HIRF KAL  +G   ++L +K+    W
Sbjct: 438 FVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVW 497

Query: 449 LAYYAVFFMVIIIVIQGFTSFAP---KFKVANFFAAYISVFLFIIFWVAFQIW 498
            +Y+ +F +VI+ + Q + +  P         FF AY+S  L +  ++  +I+
Sbjct: 498 GSYWGLFMVVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVMAMYIGHKIY 550

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  249 bits (635), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 158/543 (29%), Positives = 264/543 (48%), Gaps = 25/543 (4%)

Query: 14  DSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXX 73
           D  D   +I++ DDD      +K+ +K RH+ M                +          
Sbjct: 63  DLEDGSKSITS-DDDH-----MKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPL 116

Query: 74  XXXYLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYMYWFSWAMTF 132
              Y  +  V + + Q+ GEM    P + ASF  +A  F+S  FG A  +++   W    
Sbjct: 117 VLGYGLVSFVTYFMIQAAGEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVL 176

Query: 133 ALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX- 191
            LEL      I++W   +    +I I +V L   + F V+ YGE EF   S K+L     
Sbjct: 177 PLELITASMTIKYWNDTINPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGF 236

Query: 192 XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGT 251
                          G +G +YW NPG +     +S    ARF G    L+   F++ GT
Sbjct: 237 IILSIVINCGGAGRDGYIGNKYWINPGAF-----ASESPAARFKGVAYILVTGYFSYGGT 291

Query: 252 ELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ-SNDSYVSS 310
           EL  ++  E + PRK+ P A K+ ++RIL+ Y+ ++++IG  VP++  +L  +  S   +
Sbjct: 292 ELFSLSVNEQKNPRKSTPAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHA 351

Query: 311 SPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSK 370
           SP+++     G K++PH  NAVILI+++S  NS +Y   R++  LA+   APK+F    +
Sbjct: 352 SPYVLAASLHGVKVVPHFINAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDR 411

Query: 371 AGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALK 430
            G P   +    +FG + ++  +   ++AFTWL  I G++  F W  I  SHIRF  A+K
Sbjct: 412 EGRPLRALCICGLFGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMK 471

Query: 431 QRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISV 485
            +G S  +L Y+A    W + Y+VFF +++ + Q + + +P     K+    FF +Y++ 
Sbjct: 472 VQGKSLEELGYRATTGIWGSVYSVFFNMLVFIAQFWVALSPPKSNGKYDAEGFFESYLAA 531

Query: 486 FLFIIFWVAFQIWFK-CRLVWKLQDVDLDTDRRDIEEEVW-SDDVEDK----NKNWWDRF 539
            L+++F+  + I+ +    +  L  +DLD  RR  + E+   +D E K    N  W  R 
Sbjct: 532 PLWLVFYFGYMIYSRDFTFLTPLDKIDLDFHRRIYDPELLRQEDAETKERLRNSGWLARL 591

Query: 540 WNY 542
            ++
Sbjct: 592 RSF 594

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  248 bits (632), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 170/529 (32%), Positives = 266/529 (50%), Gaps = 33/529 (6%)

Query: 22  ISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMG 81
           + T+D +   ++D+ R LK RHI+M                              Y  +G
Sbjct: 37  VYTIDPEANIREDLTRALKPRHINMISIAGIIGTGLYLSTSTSLHKGGPASLFINYSLIG 96

Query: 82  TVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQ 141
            +V+     L EM T++P++ SF  +A++F S +F  A  + YWF+ A++ A +L+ +  
Sbjct: 97  GIVYLTLLCLAEMSTYMPISGSFCTYAKKFGSDSFAMALMWNYWFNDAVSVASDLTALQL 156

Query: 142 IIQFW---TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXX 198
           ++ +W   +   P  A   I W  +   N+  VR YGE E+W+A +KV+           
Sbjct: 157 VMDYWNTDSNHFPYWAASLIFWFFVLSLNVIHVRFYGEAEYWLAMLKVIAIIIFFIMSII 216

Query: 199 XXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFF----GWVSSLINAAFTFQGTELV 254
                     VG     NP    +G  +  V EA F     G+ S  ++A+F + GTE +
Sbjct: 217 VN--------VG----HNPQHEYIGFKNWTVGEAPFVDGFKGFASLFVSASFAYGGTESI 264

Query: 255 GITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFI 314
            +T+GE   P +  PK +K V +RIL FYIG+   I + VPYN P L S    V +SPF 
Sbjct: 265 TLTSGESDNPLRNTPKIVKTVFWRILFFYIGTTFFIAMNVPYNYPGLSSGS--VVTSPFT 322

Query: 315 ITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPK-FFTNTSKAGV 373
           I  + AGT       NAVI+ ++ISA N  ++ GSRI+Y +      PK   + T++  V
Sbjct: 323 IVFKMAGTAGAGSFMNAVIMTSVISACNHALFAGSRIMYNMGLEGYLPKSIVSRTNRYKV 382

Query: 374 PYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRG 433
           PYV VL T   G L +  +  G    +TWL NIVGV+   AWL I+ + IRF + L+ + 
Sbjct: 383 PYVAVLITWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQLAWLCIAITSIRFRQGLEAQN 442

Query: 434 ISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFL----FI 489
              ++L +K    P+  Y+ V  +  II++QG++SFAP + V+NFF+ YI +F+    FI
Sbjct: 443 -KTHELKFKNWTYPFGPYFLVVAVTFIILVQGWSSFAP-WNVSNFFSVYIELFVFPFCFI 500

Query: 490 IFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDR 538
           I+W+     +K     K +D+D  TD+    +E+   + +  N   W R
Sbjct: 501 IWWL-----YKRDPFVKCKDMDFVTDKYVPSQEIIELNEKLDNLKGWKR 544

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  248 bits (633), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 161/529 (30%), Positives = 274/529 (51%), Gaps = 24/529 (4%)

Query: 23  STLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGT 82
           ++ D +   ++D+KR+L  RHI+M                +             Y   G 
Sbjct: 56  ASFDPESNIREDLKRDLSPRHINMISIAGVIGTGLYLSTSKSLHVGGPASLFMNYSIFGG 115

Query: 83  VVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQI 142
           VV+     LGEM T++P++ SF  +A++F S +F  A  + YWF+ A++ A +L+ +  +
Sbjct: 116 VVYLTMMCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDLTALQLV 175

Query: 143 IQFWTMA---VPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXX 199
           + +W       P  A   + WV + + N+  VR+YGE E+W+A +KV+            
Sbjct: 176 LDYWKTKDHHFPYWAASLLFWVFVLLLNVISVRLYGEAEYWLALLKVIAIIIFFILS--- 232

Query: 200 XXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFF----GWVSSLINAAFTFQGTELVG 255
                +   VG     NP    +G  + N  +A F     G+ S  ++A+F + GTE + 
Sbjct: 233 -----IVVNVG----HNPEHKYIGFHNWNHGDAPFVNGFKGFASLFVSASFAYGGTESIT 283

Query: 256 ITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFII 315
           +T GE   P +  PK IK V +RIL+FY+ S   I + VPY+ P L +    V +SPF I
Sbjct: 284 LTNGEATNPVRNTPKVIKTVFWRILIFYVFSAFFIAMNVPYDYPGLATKS--VMTSPFTI 341

Query: 316 TIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPY 375
             Q AG+K      NAVI+ ++ISA N  ++ GSR++Y ++ +   PK+ T T++   PY
Sbjct: 342 VFQMAGSKGAGSFMNAVIMTSVISACNHALFAGSRVMYNMSLDGYLPKWVTKTNRYKAPY 401

Query: 376 VTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGIS 435
           V V  T   G L +  +  G    + WL NIVGV+   AWL I+ + IRF + L+ +G  
Sbjct: 402 VAVAITWAVGGLCFGASFIGAGTVWIWLQNIVGVSNQIAWLCIAITSIRFRRGLELQG-K 460

Query: 436 RNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAF 495
            ++L +K    PW  Y+ V F+  +I+IQG+++F P +  +NFF+ Y+ +F+F   ++ +
Sbjct: 461 THELKFKNWTYPWGPYFLVVFVSFVILIQGWSAFDP-WSTSNFFSVYLELFVFPACYLIW 519

Query: 496 QIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544
            ++ + + + K +D+D  TD+    ++V   +    N   W ++  Y++
Sbjct: 520 WLYKRDKFI-KYEDMDFVTDKYIPSKKVNELNERLDNLKGWPKWRQYMS 567

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  249 bits (635), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 157/474 (33%), Positives = 257/474 (54%), Gaps = 19/474 (4%)

Query: 82  TVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQ 141
           T+++S+  +LGE+    PV   FT +A RF+  +FG AN + Y   W +   LE+     
Sbjct: 150 TMIYSMVMALGELAVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASI 209

Query: 142 IIQFW-TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXX 200
            + +W T       ++++ W+++ I N+F V+ +GE EF  + +KV              
Sbjct: 210 TVNYWGTPTRYRDGFVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLV 269

Query: 201 XXXXVTGPVGF-RYWKNPGPW-GMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITA 258
                 G     +YW +PG + G G      + A+F G  S  + AAF+F G+EL+GITA
Sbjct: 270 CGGGPKGGFVGAKYWHDPGAFVGHG------SGAQFKGVCSVFVTAAFSFAGSELIGITA 323

Query: 259 GEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY-VSSSPFIITI 317
            E   PRK++P A K+VV+RI++FY+G+L +IGLLVPYND +L    S   ++SPF+I I
Sbjct: 324 AEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAASPFVIAI 383

Query: 318 QNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVT 377
              G K LP + N VILI ++S GNS ++  SR +  L+     PK F    ++G P V 
Sbjct: 384 VTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVG 443

Query: 378 VLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRN 437
           +  TS FG LA++  +    + F WLL + G++  F W  I   HIRF  ALK +G   N
Sbjct: 444 IAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTN 503

Query: 438 DLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP---KFKVANFFAAYISVFLFIIFWVA 494
           +L + +      +Y+ +F +V++ + Q + +  P   K     FF +Y+S  + +  +  
Sbjct: 504 ELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFPPGGKPDAEVFFQSYLSFPIVVATYFG 563

Query: 495 FQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDV-EDK----NKNWWDRFWNY 542
            +I+ +  +L   L+D+D+DT RR+ + E+   ++ E+K    +K W+ R + +
Sbjct: 564 HKIYKRNWKLFIPLEDMDIDTGRRETDMELLKQEIMEEKAILASKPWYIRAYAF 617

>KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {ON}
           similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W Lysine permease; one of three amino acid
           permeases (Alp1p, Can1p, Lyp1p) responsible for uptake
           of cationic amino acids
          Length = 543

 Score =  247 bits (630), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 175/550 (31%), Positives = 273/550 (49%), Gaps = 34/550 (6%)

Query: 1   MKLNQPQVHSFQVDSNDTPTTISTLDDDQEK--------QQDVKRELKKRHISMXXXXXX 52
           M L   Q    +V+     T+ S   D Q+         ++++ R L  RHI+M      
Sbjct: 1   MSLKNDQ----EVEVIGIATSQSLSSDTQDAGALNRGHVRENLNRSLTPRHINMISIAGV 56

Query: 53  XXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFL 112
                     +             Y  +G VV+ +   LGEM TF+P++ SF  +A++F 
Sbjct: 57  IGTGLYLGTGKALANGGPASLLINYGIIGLVVYLIMLCLGEMSTFMPISGSFCSYAKKFG 116

Query: 113 SPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW---TMAVPLAAWISIVWVLLTISNLF 169
           S +        YWF+ A++ A +L+ +  I+ +W       P  A   I W  L + N+ 
Sbjct: 117 SGSLAFTLMCNYWFNDAVSVASDLTALQLILDYWKNPNSHFPYWAASLIFWFALLLLNVV 176

Query: 170 PVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGP-VGFRYWK-NPGPWGMGIISS 227
            VR+YGE E+W+A +KV+                      +GF+ W     P+  G    
Sbjct: 177 HVRVYGEAEYWLALLKVIAIIMFFIISIIVNAGHNSDHAYIGFKNWGVGDAPFVNG---- 232

Query: 228 NVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSL 287
                 F G+ S  ++++F F GTE + +TAGE   P +  PK IK V +RIL+FY+ + 
Sbjct: 233 ------FKGFASLFVSSSFAFGGTESITLTAGEAVNPVRNTPKIIKTVFWRILIFYVFTA 286

Query: 288 LVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYI 347
             IG+ VPYN P L  ++  V +SPF I  Q  G++      NAVIL ++ISAGN  ++ 
Sbjct: 287 FFIGMNVPYNYPNL--SEKSVMTSPFTIVFQMVGSRGAGSFMNAVILTSVISAGNHALFA 344

Query: 348 GSRILYGLA-KNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNI 406
           GSR+L+ +  +    P F T T++  VPYV VL T   G L +  +  G    +TWL NI
Sbjct: 345 GSRVLFNIGLEGYFFPSFITKTNRYQVPYVAVLITWAAGGLCFGSSFIGAGTLWTWLQNI 404

Query: 407 VGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGF 466
           VGV+   AWL IS   IRF + L ++G   ++L +     P+  Y+ V F+  II +QG+
Sbjct: 405 VGVSNQLAWLCISVISIRFRRGLARQG-KTHELQFVNWTYPYGPYFLVVFVTFIIFVQGW 463

Query: 467 TSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRR-DIEEEVWS 525
           +SFAP + V++FF+ YI + +F+  +  + +W +   V K  ++D  TD+    EEEV  
Sbjct: 464 SSFAP-WSVSDFFSYYIELIVFVALYAFWWLWKRDSFV-KSDEMDFVTDKYVSPEEEVLL 521

Query: 526 DDVEDKNKNW 535
           ++  D  K W
Sbjct: 522 NERLDNLKGW 531

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  246 bits (629), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 155/519 (29%), Positives = 265/519 (51%), Gaps = 14/519 (2%)

Query: 8   VHSFQVDS----NDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXR 63
             +++ DS    N        L +D+ +   +K+ LK+RHI M                 
Sbjct: 22  CETYEADSVEPQNANEPEEGVLYNDRTR---LKQGLKERHIKMLTLVGVFGTGLFLSSGG 78

Query: 64  XXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYM 123
                        Y+ +G VV     ++ E+ +F+P T +    A++F+  + G   G++
Sbjct: 79  TLKKAGPAGMFLAYVVVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVGFTFGWI 138

Query: 124 YWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIAS 183
             +S  M    ELS    ++++WT   P A WI+I  +L  ++N++ +R YGE+E++   
Sbjct: 139 STYSSLMPG--ELSATAVVMRYWTDINP-AVWITIFGILFVLTNIYTIRFYGEVEYFFGW 195

Query: 184 VKVLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLIN 243
           +K++                     +GF YW+ PGP+   I+   +   +F G+ ++L +
Sbjct: 196 MKIILIIILIVTGLVIDLGGAKQERLGFHYWREPGPFAEYIVKGEI--GKFVGFWAALSS 253

Query: 244 AAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQS 303
             +++ G + + I AGE +  R  +    + V  RI+V Y+ ++LV+ L+VPYND  + +
Sbjct: 254 VVYSYSGIQNIAILAGETKNSRHAIFHGARNVFLRIIVLYLIAVLVLTLIVPYNDKLIAT 313

Query: 304 NDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPK 363
                 SSP++I IQ A  KILPHI NA+IL +  SAGN  +  GSR L+ LA    APK
Sbjct: 314 GTGTAKSSPYVIAIQRANIKILPHIINAIILTSAWSAGNLAIVEGSRNLFALASKNQAPK 373

Query: 364 FFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHI 423
            F  T+K G+PYV + F S F  L+YM  ++     F+W   +V       W+LIS +HI
Sbjct: 374 IFLTTNKRGIPYVGIAFISAFLPLSYMSVSSSSANVFSWFQELVSSNTLLRWILISANHI 433

Query: 424 RFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAY 482
              +ALK +G SR+DLP+   L P+ A+++    +I ++  GF +F    F + +FF  Y
Sbjct: 434 HMDRALKAQGYSRSDLPHSTCLGPFAAWFSGIMSLIFLLTGGFYNFIHGHFDIESFFTRY 493

Query: 483 ISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEE 521
             + L II +  ++++ K + + +  +VDL++   DI +
Sbjct: 494 FIIPLAIILFTFWKLFKKTKYL-RPAEVDLESIFEDIRQ 531

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  248 bits (633), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 155/539 (28%), Positives = 264/539 (48%), Gaps = 18/539 (3%)

Query: 8   VHSFQVDSNDTPTTISTLDD---DQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRX 64
           V SF+   +      + L+D     +    +K+ +K RH+ M                + 
Sbjct: 56  VDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKG 115

Query: 65  XXXXXXXXXXXXYLFMGTVVFSVTQSLGEM-CTFIPVTASFTVFAQRFLSPAFGAANGYM 123
                       Y+ +  V + + Q+ GEM  T+  +  +F  +   F+S +FG A  ++
Sbjct: 116 LSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWL 175

Query: 124 YWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIAS 183
           +   W     LEL      +++W   +    +I I +V L   + F V+ YGE EF   S
Sbjct: 176 FCIQWLTVLPLELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNS 235

Query: 184 VKVLXXXX-XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLI 242
            K+L                  V G +G +YW++PG +  G         RF G    L+
Sbjct: 236 CKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG-----SGATRFKGICYILV 290

Query: 243 NAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ 302
           +A F+F G EL  ++  E   PRK+ P A K+ V+RIL+ Y+ ++++IG  VP+N+ +L 
Sbjct: 291 SAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLM 350

Query: 303 -SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAA 361
            S  S   +SP+++       +++PHI NAVILI++IS  NS +Y   R++  LA+   A
Sbjct: 351 GSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYA 410

Query: 362 PKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCS 421
           PKF     + G P   ++  S+ G + ++  +   ++AFTWL  I G++  F W  I  S
Sbjct: 411 PKFLNYIDREGRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLS 470

Query: 422 HIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVA 476
           HIRF KA+K +G S +++ YKA    W +YY VFF +++ + Q + + +P     K    
Sbjct: 471 HIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQ 530

Query: 477 NFFAAYISVFLFIIFWVAFQIWFK-CRLVWKLQDVDLDTDRRDIEEEVW-SDDVEDKNK 533
            FF +Y++  L+I  +V + ++ +    +  L  +DLD  RR  + E+   +D E+K +
Sbjct: 531 AFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKER 589

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  248 bits (632), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 158/544 (29%), Positives = 258/544 (47%), Gaps = 38/544 (6%)

Query: 13  VDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXX 72
           VDS  +P       D      ++KR LK RH+ M                +         
Sbjct: 62  VDSFKSPL------DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLG 115

Query: 73  XXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTF 132
               +   G+ +      LGE+    PV  +F  +  RFL P+       +Y   W    
Sbjct: 116 VVIGWAIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVL 175

Query: 133 ALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXX 192
            LE+      +Q+W  ++    W++I + ++   NLF VR +GE EF  +++K +     
Sbjct: 176 PLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGF 235

Query: 193 XXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTF 248
                         GP    +G +YW +PG    G          F G +S L+ A+++ 
Sbjct: 236 IILCVVLICG---GGPDHEFIGAKYWHDPGCLANG----------FPGVLSVLVVASYSL 282

Query: 249 QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV 308
            G E+  + +GE     K +P AIK+V +RIL F++ SL ++G LVPY +  L    S V
Sbjct: 283 GGIEMTCLASGETDP--KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSS-V 339

Query: 309 SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNT 368
            +SPF+I I+    K LP I NAVILI+++S GNS ++  SR L  +A     P +F   
Sbjct: 340 DNSPFVIAIKLHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYI 399

Query: 369 SKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKA 428
            +AG P V ++  S+FG LA++  +    + F WL+ I G+A    WL I+ SHIRF  A
Sbjct: 400 DRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLA 459

Query: 429 LKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-------KFKVANFFAA 481
           +K +G S ++L + + +  W + Y+     +I++ Q + S  P       K +   FF  
Sbjct: 460 MKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQN 519

Query: 482 YISVFLFIIFWVAFQIWFKCRL-----VWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWW 536
           Y+   + +  ++  +I++KC+      V  L+D+DL+TDR+DI+ E+   ++ +K     
Sbjct: 520 YLCALIMLFIFIVHKIYYKCQTGKWWGVKALKDIDLETDRKDIDIEIVKQEIAEKKMYLD 579

Query: 537 DRFW 540
            R W
Sbjct: 580 SRPW 583

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  249 bits (636), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 153/530 (28%), Positives = 265/530 (50%), Gaps = 21/530 (3%)

Query: 26  DDDQEK--QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTV 83
           D D+E     D+ ++L  RH+                                ++ + T 
Sbjct: 130 DKDEETLLATDMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTA 189

Query: 84  VFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQII 143
           +F+V  SLGE+    PV   F+V+  +F+ P+F  A    Y   W +   LEL      I
Sbjct: 190 LFTVINSLGELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITI 249

Query: 144 QFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXX 203
           ++W  ++   AW+SI +V + ++N+  V+ +GE EF ++ VK+L                
Sbjct: 250 RYWNSSINSDAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCG- 308

Query: 204 XVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAG 259
              GP    +G +YW +PG + +G  S     ++F G  S  + AAF+F G E+  ++A 
Sbjct: 309 --GGPSHEYIGGKYWHDPGAF-VGTTSG----SKFKGLCSVFVTAAFSFSGIEMTAVSAA 361

Query: 260 EVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV--SSSPFIITI 317
           E + PR+T+PKA K+  + I   Y+  L ++G LVPYNDP+L +  S V  +SSP +I I
Sbjct: 362 ESRNPRETIPKAAKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAI 421

Query: 318 QNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVT 377
           +N     LP + NA+ILI I+S  NS+VY  SR +  ++K +  PK F    + G P   
Sbjct: 422 ENGHIHGLPSLMNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPA 481

Query: 378 VLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRN 437
           + F   FG L+++  +    + FTWL  + G++  F W+ I+  HIRF + +  + IS +
Sbjct: 482 ICFVLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLD 541

Query: 438 DLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIFWV 493
           +LP+ +    W + Y +  + +++V   +TS  P    K    +FF  Y+S  + +  ++
Sbjct: 542 ELPFLSQTGIWGSIYGIVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYI 601

Query: 494 AFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNY 542
           A +++FK  R       +DL + R+ ++ EV  +++  + ++   R + Y
Sbjct: 602 AHKVYFKNWRWYIPASKMDLHSGRKQVDLEVVREELRLEKEHLAQRSFFY 651

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  247 bits (630), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 152/530 (28%), Positives = 253/530 (47%), Gaps = 32/530 (6%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           D      ++KR LK RH+ M                +             +   G+ +  
Sbjct: 71  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIG 130

Query: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146
               LGE+    PV  +F  +  RFL P+       +Y   W     LE+      +Q+W
Sbjct: 131 TIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 190

Query: 147 TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVT 206
             ++    W++I + ++   NLF  R +GE EF  ++VK +                   
Sbjct: 191 NSSIDPVIWVAIFYAVIVCINLFGARGFGEAEFAFSTVKAITVCGFIILSIVLICG---G 247

Query: 207 GP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQ 262
           GP    +G +YW +PG    G          F G ++ L+ A+++  G E+  + +GE  
Sbjct: 248 GPDHEFIGAKYWHDPGCLANG----------FPGVLAVLVVASYSLGGIEMTCLASGETD 297

Query: 263 EPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGT 322
              K +P AIK+V +RIL F++ SL ++G LVPY +  L    S V +SPF+I ++    
Sbjct: 298 P--KGLPGAIKQVFWRILFFFLASLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAMKLHHI 354

Query: 323 KILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTS 382
           K+LP I NAVILI+++S GNS ++  SR L  +A     P +F    +AG P V ++  S
Sbjct: 355 KVLPTIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANS 414

Query: 383 MFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYK 442
           +FG LA++  +      F WL+ I G+A    WL I+ SHIRF  A+K +G S ++L + 
Sbjct: 415 LFGLLAFLVKSGSMADVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFV 474

Query: 443 AMLMPWLAYYAVFFMVIIIVIQGFTSFAP-------KFKVANFFAAYISVFLFIIFWVAF 495
           + +  W + Y+     +I++ Q + S  P       K +   FF  Y+   + +  +V  
Sbjct: 475 SAVGIWGSAYSALINCLILIAQFYCSLWPIGGWSSGKERAKLFFQNYLCALIMLFIFVVH 534

Query: 496 QIWFKCRL-----VWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFW 540
           +I++KC+      V  L+D+DL+TDR+DI+ E+   ++ ++  +   R W
Sbjct: 535 KIYYKCQTGKWWGVKSLKDIDLETDRKDIDIEIIKQEIMERKMHLDSRPW 584

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  247 bits (630), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 155/539 (28%), Positives = 263/539 (48%), Gaps = 18/539 (3%)

Query: 8   VHSFQVDSNDTPTTISTLDDD---QEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRX 64
           V SF+   +      + L+D     +    +K+ +K RH+ M                + 
Sbjct: 56  VDSFRRAESQCLEENNDLEDGTRPMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKG 115

Query: 65  XXXXXXXXXXXXYLFMGTVVFSVTQSLGEM-CTFIPVTASFTVFAQRFLSPAFGAANGYM 123
                       Y+ +  + + + Q+ GEM   +  +  +F  +   F+S +FG A  ++
Sbjct: 116 LKLAGPGSLVIGYVLVSFITYFMVQAAGEMGVAYATLPGNFNAYNSIFISKSFGFATTWL 175

Query: 124 YWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIAS 183
           +   W     LEL      I++W  ++    +I I +V L   + F V+ YGE EF   S
Sbjct: 176 FCIQWLTVLPLELITSSMTIKYWNDSINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNS 235

Query: 184 VKVLXXXX-XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLI 242
            K+L                  V G +G +YW++PG +  G      N  RF G    L+
Sbjct: 236 CKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFADG-----SNATRFKGICFILV 290

Query: 243 NAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ 302
            A F+F G EL  ++  E    RK+ P A K+ V+RIL+ Y+ ++++IG  VP+N+ +L 
Sbjct: 291 TAYFSFGGIELFVLSINEQSNARKSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLM 350

Query: 303 SNDSYVS-SSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAA 361
            + S  + +SP+++       +++PHI NAVILI++IS  NS +Y   R++  LA+   A
Sbjct: 351 GSGSAATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYA 410

Query: 362 PKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCS 421
           P+F     + G P   +   ++ G + ++  +   ++AFTWL  I G++  F W  I  S
Sbjct: 411 PRFLNYIDREGRPLRALAVCALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLS 470

Query: 422 HIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVA 476
           HIRF KA+K +G S  +L YKA    W +YY VFF +++ + Q + + +P     K  V 
Sbjct: 471 HIRFRKAMKVQGRSLGELGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCDVQ 530

Query: 477 NFFAAYISVFLFIIFWVAFQIWFK-CRLVWKLQDVDLDTDRRDIEEEVW-SDDVEDKNK 533
            FF  Y++  L+I  ++ + ++ K   L+  L  +DLD  RR  + E+   +D E+K K
Sbjct: 531 AFFEGYLAAPLWIFMYLGYMLYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEENKEK 589

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  245 bits (626), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 155/533 (29%), Positives = 265/533 (49%), Gaps = 16/533 (3%)

Query: 21  TISTLDDDQEKQQD--VKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYL 78
           TI +L+      ++   +R+L  R +SM                              + 
Sbjct: 29  TIRSLEGQAPSLEERIARRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFC 88

Query: 79  FMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSV 138
               V   ++Q +  M T++PVT SF  F +RF+  + G + G+ Y+   A     E++ 
Sbjct: 89  LWSVVFIGLSQCMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITA 148

Query: 139 VGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXX 198
           V  +++FWT  +P AA ISI+  L    NLF V I+GE EF+++  KV+           
Sbjct: 149 VCLVVEFWTDKIPKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIV 208

Query: 199 XXXXXXVTGPV-GFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGIT 257
                     V GF+ W NPG +   I  S  +  +F G++S LI A + F G + +G  
Sbjct: 209 VMAGGNPQHKVLGFKNWSNPGAFAEYI--SKGSAGKFHGFMSCLIFALYVFWGVDYLGNA 266

Query: 258 AGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY----VSSSPF 313
           A E   PRK +P + +KV  R+++FYIG  + +G+LVP+ND  +    S       +SP+
Sbjct: 267 ASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPY 326

Query: 314 IITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGV 373
           +  ++  G  +LPHI N +IL +IISAGNS++Y  SR+L+ LA    APK F  T K GV
Sbjct: 327 VSAMKTLGIGVLPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLFKIT-KRGV 385

Query: 374 PYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRG 433
           P    +   +   LAY+  +   +   TW LN+   A    ++ I  S+++F K  K + 
Sbjct: 386 PIYCCVAVLLVCGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQN 445

Query: 434 ISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAYISVFLFIIFW 492
           I    LPY +  +P+L ++++F++V+++ + G+  F    + + +F  +Y  +  FI+ +
Sbjct: 446 IDLKTLPYSSSFLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLF 505

Query: 493 VAFQIWFKCRLVWKLQDVDLDTDRRDIEEE--VWSDDVEDKNKNWWDRFWNYV 543
              +++ K R V K  ++DL +   ++ EE   W ++      N  D+ + ++
Sbjct: 506 AGHKLYKKTRFV-KPVEMDLFSGIAELAEEDAYWEEN--PPKMNLLDKAFGFI 555

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  246 bits (627), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 152/529 (28%), Positives = 260/529 (49%), Gaps = 24/529 (4%)

Query: 9   HSFQVDSNDTPTTIST---LDDDQ--------EKQQDVKRELKKRHISMXXXXXXXXXXX 57
           H     S D+   IST   +D D         E  +++ ++L  RH+             
Sbjct: 41  HDLGQSSKDSGYKISTGSAIDSDSLHGNNVAFEYGENLNKDLDIRHLLTLAIGGSIGTGL 100

Query: 58  XXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFG 117
                              ++ + + +F+V  +LGE+    P+   F V+  RF+ P+F 
Sbjct: 101 FVNSGTSLNTGGPASLIIGWVIISSALFTVINALGELAATFPIVGGFNVYMTRFVDPSFA 160

Query: 118 AANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEI 177
            A    Y   W ++  LEL      I++W   +   AW++I +V + + N+  V+ + E 
Sbjct: 161 FAVNLNYLILWIVSLPLELVAASITIRYWNREINSDAWVTIFFVFIALLNMMDVKFFSEA 220

Query: 178 EFWIASVKVLXXXXX-XXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFG 236
           EF ++ +K+L                    G +G +YW +PG +       +   +RF G
Sbjct: 221 EFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIGGKYWNDPGAF-----HGDSAGSRFKG 275

Query: 237 WVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPY 296
             S  + AAF++ G E+  ++A E + PRKT+PKA K+  + I   YI  L +IG+LVPY
Sbjct: 276 LCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKATKRTFWVITFSYISILTLIGILVPY 335

Query: 297 NDPKLQSNDSYV--SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYG 354
           ND +L S  S V  S+SP +I I+NAG K LP + NA+ILI ++S  NS VY+ SR++  
Sbjct: 336 NDKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMNAIILIALLSVANSCVYVCSRVMVS 395

Query: 355 LAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFA 414
           +A     PK F+   K G P  ++  T   G L+++  +   ++ FTWL  I G++  F 
Sbjct: 396 MALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFIAASDKQEEVFTWLSAICGLSTIFC 455

Query: 415 WLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP--- 471
           W+ I+ +HIRF  ALK +  S ++L Y +    W ++Y V  +V++++   + S  P   
Sbjct: 456 WIGINLAHIRFRAALKFQNRSLDELAYISQSGIWGSWYGVIILVLVLIASFWVSLFPVGE 515

Query: 472 -KFKVANFFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRD 518
                  FF  Y+S  + I  ++  +++ K  + V  L+++D+D  +++
Sbjct: 516 SSADAEAFFEGYLSFPILIASYIGHKVYIKNWKWVIPLEEIDIDLGKKN 564

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  246 bits (629), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 157/557 (28%), Positives = 270/557 (48%), Gaps = 28/557 (5%)

Query: 8   VHSFQVDSNDTPTTISTLDDDQ--------EKQQDVKRELKKRHISMXXXXXXXXXXXXX 59
           VH F VDS     +    DD+         +    +K+ +K RH+ M             
Sbjct: 52  VHRF-VDSFKRAESQHLEDDNDLEDGTRSMKSNNRLKKSMKSRHVVMMSLGTGIGTGLLV 110

Query: 60  XXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEM-CTFIPVTASFTVFAQRFLSPAFGA 118
              +             Y+ +  V + + Q+ GEM  T+  +  +F  +   F+S +FG 
Sbjct: 111 ANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGF 170

Query: 119 ANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIE 178
           A  +++   W     LEL      I++W   +    +I I +V L   + F V+ YGE E
Sbjct: 171 ATTWIFCIQWLTVLPLELITSSMTIKYWNDKINSDVFIVIFYVFLLFIHFFGVKAYGETE 230

Query: 179 FWIASVKVLXXXX-XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGW 237
           F  +S K+L                  V G +G +YW++PG +  G         RF G 
Sbjct: 231 FIFSSCKILMIAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG-----NGATRFKGI 285

Query: 238 VSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN 297
              L+ A F+F G EL  ++  E   PRK+ P A K+ V+RIL+ Y+ ++++IG  VP+N
Sbjct: 286 CFILVTAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHN 345

Query: 298 DPKLQSNDSYVS-SSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLA 356
           + +L  + S  + +SP+++       +++PHI NAVILI++IS  NS +Y   R++  LA
Sbjct: 346 NDQLMGSGSAATHASPYVLAASIHKVRVVPHIINAVILISVISVANSALYAAPRLMCSLA 405

Query: 357 KNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWL 416
           +   APKF     + G P   +    + G + ++  +   ++AFTWL  I G++  F W 
Sbjct: 406 QQGYAPKFLDYIDREGRPLRALFVCCLVGVIGFVACSPQEEQAFTWLAAIAGLSELFTWS 465

Query: 417 LISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----- 471
            I  SHIRF KA+K +G S +++ YKA    W +YY VFF +++ + Q + + +P     
Sbjct: 466 GIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGG 525

Query: 472 KFKVANFFAAYISVFLFIIFWVAFQIWFK-CRLVWKLQDVDLDTDRRDIEEEVWSDDVED 530
           K     FF +Y++  L++  ++ + ++ +    +  L  +DLD  RR  + E+   + E+
Sbjct: 526 KCNAQAFFESYLAAPLWLCMYLGYMLYERDFTFLNPLDKIDLDYHRRVYDPEIIRQENEE 585

Query: 531 -----KNKNWWDRFWNY 542
                KN +++ R +N+
Sbjct: 586 NKERLKNSSFFFRIYNF 602

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  246 bits (627), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 150/534 (28%), Positives = 261/534 (48%), Gaps = 31/534 (5%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           D      ++KR LK RH+ M                +             +   GT +  
Sbjct: 60  DGSFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVG 119

Query: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146
               LGE+    PV  +F  ++ RFL P+       +Y   W     LE+      ++FW
Sbjct: 120 TIHGLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFW 179

Query: 147 TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVT 206
           T +V    W+++ + L+   NLF VR +G+ +F  + +K++                  T
Sbjct: 180 TTSVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPT 239

Query: 207 GP-VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPR 265
              +G RYW +PG    G          F G  + ++ A+++  G+E+  + +GE     
Sbjct: 240 HEFIGARYWHDPGALANG----------FKGVAAVMVTASYSLGGSEMTCLASGETDP-- 287

Query: 266 KTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKIL 325
           K +P AIK++ +RI+ F++ SL ++G LVPY + +L    S V++SPF+I I+    ++L
Sbjct: 288 KEIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLGG-SNVNNSPFVIAIKMHNIRVL 346

Query: 326 PHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFG 385
           PHI N VIL++I+S GNS ++  SR L  +A     P+ F    +AG P   +L  S+FG
Sbjct: 347 PHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFG 406

Query: 386 SLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAML 445
            LA++  ++     FTWL+ + G+A    WL I+ SHIRF  A+K +G S ++L + + +
Sbjct: 407 LLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAV 466

Query: 446 MPWLAYYAVFFMVIIIVIQGFTSF-------APKFKVANFFAAYISVFLFIIFWVAFQIW 498
             W + Y+    V+++V Q + S         P+ +   FF  Y+   + +  +VA +I+
Sbjct: 467 GMWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAHKIY 526

Query: 499 FKCRLV--WK---LQDVDLDTDRRDIEEEVWSDDVEDKNK-----NWWDRFWNY 542
           ++      WK   L ++DL++ R++I+ EV   +V  + K      W+ R+++Y
Sbjct: 527 YRSTTGQWWKILPLAEIDLESGRKNIDIEVVKHEVAARKKYISEQRWYIRYYHY 580

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score =  245 bits (625), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 160/522 (30%), Positives = 271/522 (51%), Gaps = 33/522 (6%)

Query: 13  VDSNDTPTTISTLDDDQEKQQDVKRE-----LKKRHISMXXXXXXXXXXXXXXXXRXXXX 67
           VD+N++      + DD E Q  V RE     L  RH++M                +    
Sbjct: 41  VDTNNS------VSDDPESQDAVIRERLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNA 94

Query: 68  XXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFS 127
                    Y+ MG V++    SLGEM TF+P++ S+  ++++F+S ++  A     W+S
Sbjct: 95  GGPGSLLINYVIMGGVIYLTMLSLGEMSTFMPISGSYCAYSRKFVSESYCFALMCNMWYS 154

Query: 128 WAMTFALELSVVGQIIQFW---TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASV 184
            A++ A +L+ +  ++ +W   T   P  A   + W L+   N+  V++YGE E+W+A +
Sbjct: 155 DAVSVASDLTALQLVLDYWKTNTHHFPYWAASLLFWFLILGLNVVHVKLYGEAEYWLAML 214

Query: 185 KVLXXXXXXXXXXXXXXXXXVTGP-VGFRYWKN-PGPWGMGIISSNVNEARFFGWVSSLI 242
           KV+                      +GF+ W +   P+  G          F G+V+  +
Sbjct: 215 KVVAVIIFFIMAIIANCGHNQQHEYIGFKNWSHGDAPFVQG----------FKGFVTIFV 264

Query: 243 NAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ 302
            ++F++ GTE V +T GE + P +  PK IK V +RILVFY+ ++  +G+ +PY+ P L+
Sbjct: 265 TSSFSYGGTETVTLTGGEAKNPVRNTPKVIKTVFWRILVFYVFTMFFVGMDIPYDYPNLK 324

Query: 303 SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAP 362
           +    V +SPF I  Q AGTK      NAVI+ + ISA N  ++ GSRILY +      P
Sbjct: 325 TKS--VLTSPFTIVFQMAGTKAAGSFMNAVIMTSAISACNHALFGGSRILYNMGLEGFLP 382

Query: 363 --KFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISC 420
             +FFT T++   PYV V+ T   G L +  +  G  + F+WL NIVGV+   +WL I+ 
Sbjct: 383 YSRFFTKTNRNKAPYVAVITTWAVGGLCFGASFIGAGELFSWLQNIVGVSNQISWLSIAV 442

Query: 421 SHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFA 480
             IRF K L+ +G   ++L ++    P+  ++ + F+ +II++QG+++F P +  ++FF+
Sbjct: 443 ISIRFRKGLEAQG-KVHELKFRNWTYPYGPWFCIIFISLIILVQGWSAFDP-WSTSSFFS 500

Query: 481 AYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEE 522
            Y+ + +F   W+ + +  + R   K +D+D  TD+    EE
Sbjct: 501 FYLELIVFPACWIFWWVIKRDRFK-KAKDMDFITDKYVQSEE 541

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  245 bits (626), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 160/534 (29%), Positives = 263/534 (49%), Gaps = 27/534 (5%)

Query: 12  QVDSNDTPTTISTLDDDQEK------QQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXX 65
           + D+ D    ++    D EK         +KR LK RH+ M                +  
Sbjct: 51  RADTQDLDPNLT----DAEKMAILTANAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKAL 106

Query: 66  XXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYW 125
                      +   GT+++ +  ++GE+    P+   FT +A RF+  +FG A   +Y 
Sbjct: 107 ATAGPAGILIGWALTGTMIYCMVMAMGELAVTFPIAGGFTTYASRFVDESFGFAFNTIYM 166

Query: 126 FSWAMTFALELSVVGQIIQFW-TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASV 184
             W +   LE+      + +W T       ++++ +V++   N F V+ YGE EF  + +
Sbjct: 167 LQWLVVLPLEIVAASITVNYWGTPDKYRDGFVALFYVVIVAINFFGVKGYGEAEFIFSFI 226

Query: 185 KVLXXXX-XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLIN 243
           KV+                    G +G R W NPG +  G          F G  S  + 
Sbjct: 227 KVITVIGYIILGVILVCGGGPQGGYIGGRLWHNPGAFANG----------FKGVCSVFVT 276

Query: 244 AAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQS 303
           AAF+F G+ELVG+ A E   PRK++P A K+V +RI +FYI +LL++GLLVPY   +L  
Sbjct: 277 AAFSFAGSELVGLAAAETANPRKSLPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIG 336

Query: 304 NDSY-VSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAP 362
             S   ++SPF+I+IQNAG K LP + N VILI ++S GNS V+  SR +  LA   + P
Sbjct: 337 QSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNSAVFACSRSMAALANQGSLP 396

Query: 363 KFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSH 422
           K F    + G P V ++ T +FG L+++  +    + F WLL + G++  F W  I   H
Sbjct: 397 KIFGYIDRTGRPLVGIIVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCH 456

Query: 423 IRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP---KFKVANFF 479
           IR  +AL  +  +  +L + A    W + Y    +++I++ Q + +  P   K   + FF
Sbjct: 457 IRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVLIILILMAQFWIALFPIGDKPSASAFF 516

Query: 480 AAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVEDKN 532
            AY+S  + I F++  +IW K  +L  + +++D+DT RR+ + E    ++ ++ 
Sbjct: 517 EAYLSFPILIAFYIGHKIWKKNWKLFIRAKNIDIDTGRRETDIEALKQEIAEEK 570

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  245 bits (626), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 160/505 (31%), Positives = 260/505 (51%), Gaps = 17/505 (3%)

Query: 35  VKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEM 94
           +KR LK RH+ M                +             +   GT+++ +  ++GE+
Sbjct: 76  LKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 95  CTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW-TMAVPLA 153
               PV   +T +A RF+  +FG A   +Y   W +T  LE+      + +W T A    
Sbjct: 136 AVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRD 195

Query: 154 AWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXXXXXXXXXXXXVTGPVGFR 212
           A++++ +V++   NLF V+ YGE EF  + +KV+                    G +G R
Sbjct: 196 AFVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGR 255

Query: 213 YWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAI 272
            W NPG +  G          F G  S  + AAF+F G+ELVG+ A E   PRK++P A 
Sbjct: 256 LWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAA 305

Query: 273 KKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY-VSSSPFIITIQNAGTKILPHIFNA 331
           K+V +RI +FYI +LL++GLLVPY   +L    S   ++SPF+I+IQNAG K LP + N 
Sbjct: 306 KQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINV 365

Query: 332 VILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYME 391
           VILI ++S GN  V+  SR +  LA   + PK F    + G P V ++ T +FG L+++ 
Sbjct: 366 VILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIA 425

Query: 392 TTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAY 451
            +    + F WLL + G++  F W  I   HIR  +AL  +  +  +L + A    W + 
Sbjct: 426 ASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSV 485

Query: 452 YAVFFMVIIIVIQGFTSFAP---KFKVANFFAAYISVFLFIIFWVAFQIWFKC-RLVWKL 507
           Y++  +++I++ Q + +  P   K   A FF AY+S  ++I+F++  +IW K  +L  K 
Sbjct: 486 YSLILIILILIAQFWIALFPIGGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLFIKA 545

Query: 508 QDVDLDTDRRDIEEEVWSDDVEDKN 532
            D+D+D+ RR+ + E    ++ ++ 
Sbjct: 546 SDIDIDSGRRETDIEALKQEIAEEK 570

>Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C
           (ALP1) - Basic amino acid permease [contig 55] FULL
          Length = 544

 Score =  244 bits (623), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 178/550 (32%), Positives = 276/550 (50%), Gaps = 38/550 (6%)

Query: 2   KLNQPQVHSFQVDSNDTPTTISTLDDDQEKQQ------DVKRELKKRHISMXXXXXXXXX 55
           K +   +H  +V      T+ S +  D E Q+       + R L  RHI+M         
Sbjct: 5   KNDSSSIHVLKV----ARTSSSDVQYDSEGQEADHVREHLNRSLTPRHINMISIAGVIGT 60

Query: 56  XXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPA 115
                  +             Y  +G VV+     LGEM TF+P++ SF  +A++F S +
Sbjct: 61  GLYLGTGKALAKGGPASLVINYSIIGLVVYLTMLCLGEMSTFMPISGSFCSYAKKFGSGS 120

Query: 116 FGAANGYMYWFSWAMTFALELSVVGQIIQFWTMA---VPLAAWISIVWVLLTISNLFPVR 172
                   YWF+ A++ A +L+ +  I+ FW  +    P  A   I W +L + N+  VR
Sbjct: 121 LAFTLMCNYWFNDAVSVASDLTALQLILDFWKTSDAHFPYWAASLIFWFVLLLLNVVHVR 180

Query: 173 IYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGP-VGFRYWKNPGPWGMGIISSNVNE 231
           +YGE E+W+A +KV+                      +GF+ W             +V E
Sbjct: 181 VYGEAEYWLAMLKVIAIIIFFIISIVVNAGHNQDHSYIGFKNW-------------SVGE 227

Query: 232 ARFF----GWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSL 287
           A F     G+ S  ++++F + GTE + +TAGE + P +  PK IK V +RIL+FY+ + 
Sbjct: 228 APFVNGFKGFASLFVSSSFAYGGTESITLTAGEAKNPIRNTPKIIKTVFWRILIFYVFTT 287

Query: 288 LVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYI 347
             IG+ VPYN PKL  ++  V +SPF I  Q  GTK      NAVIL ++ISAGN  ++ 
Sbjct: 288 FFIGMNVPYNYPKL--SEKSVMTSPFTIVFQMVGTKAAASFMNAVILTSVISAGNHALFA 345

Query: 348 GSRILYGLA-KNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNI 406
           GSR+L+ L  +    P   T T++  +PYV VL T   G L +  +  G    +TWL NI
Sbjct: 346 GSRVLFNLGLEGYFFPSIITKTNRYQIPYVAVLITWAAGGLCFGSSFVGAGTLWTWLQNI 405

Query: 407 VGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGF 466
           VGV+   AWL IS   IRF + L ++G   ++L +     P+  Y+ V F+  II++QG+
Sbjct: 406 VGVSNQIAWLCISIVSIRFRRGLAKQG-KTHELQFSNWTYPYGPYFLVLFVSFIILVQGW 464

Query: 467 TSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRR-DIEEEVWS 525
           +SFAP + V +FF+ YI + +F+  +V + +W +   V + +D+D  TD+     EEV  
Sbjct: 465 SSFAP-WNVTDFFSYYIELIVFVALYVFWWLWKRDAFV-RSEDMDFVTDKYISPHEEVLL 522

Query: 526 DDVEDKNKNW 535
           ++  D  K W
Sbjct: 523 NEELDNLKGW 532

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  244 bits (624), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 153/534 (28%), Positives = 253/534 (47%), Gaps = 31/534 (5%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           D      ++KR LK RH+ M                +             +   GT +  
Sbjct: 70  DGSFDPSNMKRALKSRHLIMIAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIG 129

Query: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146
               LGE+   +PV  +F  ++ RFL P+       +Y   W     LE+      ++FW
Sbjct: 130 TIHGLGELTVRLPVVGAFADYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIASCITMRFW 189

Query: 147 TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVT 206
           T +V    W+++ + ++   NL  VR +GE EF  +SVKV+                  T
Sbjct: 190 TQSVDPIIWVALFYTMIVSINLLGVRGFGEAEFIFSSVKVITICGFIILCIVLILGGGPT 249

Query: 207 GP-VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPR 265
              VG RYW +PGP   G          F G  + ++ A+++  G+E+  + +GE     
Sbjct: 250 HQYVGSRYWHDPGPLANG----------FKGVAAVMVTASYSLGGSEMTCLASGETDP-- 297

Query: 266 KTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKIL 325
           K +P AIK++ +RIL F++ SL ++G LVPY +  L    S   +SPF++ +     K++
Sbjct: 298 KELPHAIKQIFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-AENSPFVLALYLHHVKVV 356

Query: 326 PHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFG 385
           PHI N VIL++I+S GNS ++  SR L  +A     P  F    + G P V +L  S+FG
Sbjct: 357 PHIVNGVILVSILSVGNSCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFG 416

Query: 386 SLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAML 445
            LA++   +     F+WL+ I G+A    WL I+ SH+RF  A+K +  S ++L + + +
Sbjct: 417 LLAFLVKFSSISNVFSWLMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLDELQFVSSV 476

Query: 446 MPWLAYYAVFFMVIIIVIQGFTSFAP-------KFKVANFFAAYISVFLFIIFWVAFQIW 498
             W + YA     + +V Q + +  P       K +   FF  Y+   + I  + A + +
Sbjct: 477 GVWGSVYAGVLNFLTLVAQFYIALWPVEGWKDSKSRAEAFFKNYLCALILIAMFAAHKCY 536

Query: 499 FKCRL-----VWKLQDVDLDTDRRDIEEEVWSDDVED-----KNKNWWDRFWNY 542
           F+        + KL +VDLDT R +I+ E+  ++V +     +NK W+ R++ Y
Sbjct: 537 FRITTGKWWGIKKLSEVDLDTGRVNIDIEIIKEEVAERKKFLRNKAWYTRYYYY 590

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  244 bits (623), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 150/513 (29%), Positives = 248/513 (48%), Gaps = 22/513 (4%)

Query: 26  DDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVF 85
           D     + D+ + ++ RH+ M                              Y+    +VF
Sbjct: 75  DSTAGDENDLNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIVSSLMVF 134

Query: 86  SVTQSLGEM-CTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQ 144
            + Q+ GE+   +  V  +FT +    + PAFG A  ++Y   W +   L+L      IQ
Sbjct: 135 LIIQAAGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVTAAMTIQ 194

Query: 145 FWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXX 204
           FW + V L  ++   +V++ + NL   R Y E EF+    K++                 
Sbjct: 195 FWNVGVNLDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVILGIIITAGGI 254

Query: 205 VTGP---VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEV 261
             GP   +G +YW+NPG +  G          F G  S    AAF++ G E + ++A E 
Sbjct: 255 PNGPDGYIGGKYWRNPGLFANG----------FKGVCSVFCYAAFSYGGVETLVLSAAEQ 304

Query: 262 QEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSS-PFIITIQNA 320
           + P K++P A KKV++RIL  Y+ SL+++  LVPY  P L  +    S S PF+I I + 
Sbjct: 305 KNPLKSIPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGSHSSPFVIAIASH 364

Query: 321 GTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLF 380
           G  ++PH+ NAVILI+++S  NS +Y+  R+L  LA+  +APKF     K G P    L 
Sbjct: 365 GVSVVPHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDKRGRPTTCTLV 424

Query: 381 TSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLP 440
             +FG + ++  +   +  FTWLL+I G+   F W+ I  SHIRF  A++ +G    ++ 
Sbjct: 425 VVLFGMIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMRVQGHPLTEIA 484

Query: 441 YKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISVFLFIIFWVAF 495
           YKA    W +Y A+   + ++V Q + + AP     K    NFF  Y++  + +  ++ F
Sbjct: 485 YKAQTGYWGSYVAIALALFVLVCQFWVAIAPVGAHGKLDATNFFQNYLAFPVVLCAYLGF 544

Query: 496 QIWFKC-RLVWKLQDVDLDTDRRD-IEEEVWSD 526
           ++++K  +L+     ++LD +R   + EE   D
Sbjct: 545 KVYYKQWQLLIPADKIELDNNRNVYVPEEALED 577

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  244 bits (623), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 152/543 (27%), Positives = 261/543 (48%), Gaps = 28/543 (5%)

Query: 17  DTPTTISTLDDD----QEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXX 72
           + P   S +D +    +   +++K  L+ RHI +                          
Sbjct: 34  EKPIIYSEVDIESGAKESSSRNLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAA 93

Query: 73  XXXXYLFMGTVVFSVTQSLGEMCTFIP-------VTASFTVFAQRFLSPAFGAANGYMYW 125
               Y+ + T+V+ +    GEM  ++P                 +++  + G A  + Y+
Sbjct: 94  LVISYIVISTIVYPIMNMFGEMVCYLPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYY 153

Query: 126 FSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVK 185
           + + +  A E +    I+++WT  +P A  I +   ++ + N  PV+ YGE EFW A +K
Sbjct: 154 YCFIVLVATECTAASSIVEYWTSKIPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIK 213

Query: 186 VLXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSL 241
           +                          VGF YWKNP  +   +  +N +   F    ++L
Sbjct: 214 IFCITGLIIVAFVIFCGGAPNNEDNSFVGFHYWKNPSSFRDYV--TNGSLGNFLDVYNAL 271

Query: 242 INAAFTF-QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPK 300
           I  AF F  G ELV +T+ E  + R+ + KA ++ V+R++ FYI   L I ++VPYNDP 
Sbjct: 272 IKGAFAFILGPELVSLTSSECVDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPT 331

Query: 301 LQS----NDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLA 356
           L +    N     SSPF+I IQNAG  ILPHI N  IL + +SAGN+ ++  +R L  + 
Sbjct: 332 LLNALALNKPGAGSSPFVIGIQNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMG 391

Query: 357 KNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWL 416
           KN +AP+ F+  ++ GVPYV +  + M   LA++  +    K F W  NI  ++GF  W 
Sbjct: 392 KNGSAPRIFSRINRHGVPYVALSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWF 451

Query: 417 LISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKF-KV 475
               +++RF + +   G+  + LP+K     +L +Y+  F+ I+I+  G+    PKF   
Sbjct: 452 TGCIAYLRFRRTIDYNGL-YDRLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNY 510

Query: 476 ANFFAAYISVFLFIIFWVAFQIW---FKCRLVWK-LQDVDLDTDRRDIEEEVWSDDVEDK 531
            +F AAYI++ +F++ +    I+   ++ R  WK + ++D+ T   +IE +    D E +
Sbjct: 511 QDFIAAYITLPVFLVLYFGHIIYSGRWRQRKWWKPVDEIDVVTGLEEIELKTKIADEERQ 570

Query: 532 NKN 534
             +
Sbjct: 571 GHS 573

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  244 bits (623), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 153/516 (29%), Positives = 264/516 (51%), Gaps = 14/516 (2%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           DD  K + +K+ +K RH+ M                +             Y  + T+++ 
Sbjct: 79  DDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYC 138

Query: 87  VTQSLGEMCT-FIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQF 145
           V QS  E+   +  ++  F  +    +  AF  +  ++Y   W     LEL      I++
Sbjct: 139 VIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKY 198

Query: 146 WTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXV 205
           W  ++   A++ I +V+L + N      Y E EF+  + KVL                  
Sbjct: 199 WNDSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAG 258

Query: 206 T-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEP 264
             G +G  YW +PG +       N    RF G V+ L+NAAF + G E   +TA E Q P
Sbjct: 259 NDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNP 313

Query: 265 RKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL-QSNDSYVSSSPFIITIQNAGTK 323
           +K++  A KK+V+RI+  Y+ +  ++G LVPYN P+L  S  +   +SPF+I I + G K
Sbjct: 314 QKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVK 373

Query: 324 ILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSM 383
           ++PHI NAVIL++++S  NS +Y  SRIL  L++   APK F    + G P   +L + +
Sbjct: 374 VVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLLVSCV 433

Query: 384 FGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKA 443
           FG L ++  +   +  FTWLL I G++  F W  IS SH+RF +++  +G S ++L Y++
Sbjct: 434 FGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQS 493

Query: 444 MLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWF 499
               W AYYA+  +++I++ Q + + +P    K    NFF  Y+++ + I  ++ +++W+
Sbjct: 494 WTGVWGAYYAMIMILLILIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWY 553

Query: 500 KC-RLVWKLQDVDLDTDRRDIEEEVW-SDDVEDKNK 533
           +  R++    +VDL + R+  + E+  S+ +E+K +
Sbjct: 554 RDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQ 589

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  244 bits (622), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 153/522 (29%), Positives = 250/522 (47%), Gaps = 32/522 (6%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           D      ++K+ LK RH+ M                +             +   GT +  
Sbjct: 65  DGSFHSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALIIGWTVAGTQMVG 124

Query: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146
               LGE+    PV  +F  +  RFL P+       +Y   W     LE+      +++W
Sbjct: 125 TIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYW 184

Query: 147 TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVT 206
             +VP  AW++I +  + + NL  VR +GE EF  + +KVL                   
Sbjct: 185 GSSVPPVAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCVVLICG---G 241

Query: 207 GP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQ 262
           GP    VG +YW +PGP   G          F G  +  + A+++  GTE+  + +GE  
Sbjct: 242 GPKHEFVGAKYWSDPGPLANG----------FKGVAAVFVIASYSLGGTEMACLASGETD 291

Query: 263 EPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGT 322
              K +P AIK+V +RI+ F++ SL ++G LVPY +  L    S V +SPF+I I+  G 
Sbjct: 292 P--KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLMGGSS-VDNSPFVIAIRLHGI 348

Query: 323 KILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTS 382
           K LP + NAVIL++++S GNS ++  SR L  +A     P+ F    +AG P V +L   
Sbjct: 349 KALPSVVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLVGILTNL 408

Query: 383 MFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYK 442
            FG LA++  ++  D  FTWL+ I G+A    WL I+ SHIRF  A+K +G+S ++L + 
Sbjct: 409 AFGLLAFLVKSSSSDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSLDELEFV 468

Query: 443 AMLMPWLAYYAVFFMVIIIVIQGFTSF-------APKFKVANFFAAYISVFLFIIFWVAF 495
           + +  + + Y+    V+I+V Q + S        +P  +  NFF  Y+   + ++ +   
Sbjct: 469 SAVGVYGSVYSATINVLILVAQFYVSLWPVGGWSSPSTRTENFFQNYLCSLILLLLFAGH 528

Query: 496 QIWFKCRL-VW----KLQDVDLDTDRRDIEEEVWSDDVEDKN 532
           +I+++     W     L+D+DL TD R  + E+   ++ +K 
Sbjct: 529 KIYYRISTGKWWGFKALRDIDLLTDMRVTDTELSKHELHEKR 570

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  243 bits (621), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 152/555 (27%), Positives = 269/555 (48%), Gaps = 27/555 (4%)

Query: 8   VHSFQVDSNDTPTTISTLDDDQEK-------QQDVKRELKKRHISMXXXXXXXXXXXXXX 60
           VH F VDS     +    ++D E        +  +K+ +K RH+ M              
Sbjct: 20  VHRF-VDSFRRAESPELEENDLEDGTRSIVTKTHLKKAMKSRHVVMMSIGTGIGTGLLVA 78

Query: 61  XXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAA 119
             +             Y+ +  V + + Q+ GEM    P +  SF  +   F+S  FG A
Sbjct: 79  NAKGLYFSGPASLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGSFNSYTSTFISKPFGFA 138

Query: 120 NGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEF 179
             ++++  W   F LEL      +++W   +    +I I +  L   + F V+ YGE EF
Sbjct: 139 TVWLFFIQWLTVFPLELITASLTVKYWNDKINADVFIIIFYAFLLFIHFFGVKAYGETEF 198

Query: 180 WIASVKVLXXXXXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWV 238
              S KVL                  T G +G +YW +PG +  G   +     RF G  
Sbjct: 199 IFNSCKVLMVAGFIILSIVINCGGAGTDGYIGAKYWHDPGSFADGPPIT-----RFKGVC 253

Query: 239 SSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYND 298
             L++A F++ G EL  ++  E + PRK+ P A K+ ++RIL+ Y+ ++++IG  VP+N 
Sbjct: 254 FILVSAYFSYGGAELFSLSVNEQENPRKSTPAAAKQSIYRILIIYLATMILIGFNVPHNS 313

Query: 299 PKLQSNDSYVS-SSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAK 357
            +L    S  + +SP+++       K++PH  NAVILI++IS  NS +Y   R++  LA+
Sbjct: 314 DELMGAGSAATHASPYVLAASLHSVKVVPHFINAVILISVISVANSALYAAPRLMCSLAE 373

Query: 358 NKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLL 417
              APKF     + G P   ++  ++FG + ++  ++  ++ FTWL  I G++  F W  
Sbjct: 374 QGYAPKFLNYVDREGRPLRGLILCALFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSG 433

Query: 418 ISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----K 472
           I  SHIRF +A+K  G S +++ +KA+   W +YY   F +++ + Q + + +P     K
Sbjct: 434 IMLSHIRFRQAMKFNGKSTDEIGFKAVTGIWGSYYGCAFNILVFIAQFWVALSPPGSGGK 493

Query: 473 FKVANFFAAYISVFLFIIFWVAFQIWFK-CRLVWKLQDVDLDTDRRDIEEEVWSDDVED- 530
                FF +Y++  ++++F+  + I+ +   ++  L+ +DLD  RR  + +    + E+ 
Sbjct: 494 CDAEAFFQSYLAAPIWLVFYFGYMIYKRDFTILNPLEKIDLDFHRRIYDPDFIKQEDEEN 553

Query: 531 ----KNKNWWDRFWN 541
               KN + W R ++
Sbjct: 554 KERLKNSSIWARIYH 568

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  245 bits (626), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 154/530 (29%), Positives = 254/530 (47%), Gaps = 21/530 (3%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           + Q++   +K+ +K RH+ M                              Y  MGT ++ 
Sbjct: 142 EQQDENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYC 201

Query: 87  VTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQF 145
           + Q+ GE+   +  V  SF  F    + P F  A  ++Y   W     LEL      I++
Sbjct: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261

Query: 146 WTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXV 205
           WT  V    ++ I +VL+ + N F  + Y E EF+    KV+                  
Sbjct: 262 WTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAG 321

Query: 206 T-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEP 264
           T G +G +YW +PG +            RF G + + + AAF F  TE + +TA E   P
Sbjct: 322 TDGYIGAKYWNDPGAF-----RGQTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQSNP 376

Query: 265 RKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN-DPKLQSNDSYVSSSPFIITIQNAGTK 323
           RK +P A KKV +RIL+ ++ S+++IG LVPYN D  + S+    S+SP+++     G  
Sbjct: 377 RKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSASPYVLAASLHGVH 436

Query: 324 ILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSM 383
           ++ H  NAVIL++++S  NS  Y  SR+L GLA+   APK+F    + G P  ++L  ++
Sbjct: 437 VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAI 496

Query: 384 FGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKA 443
              +A+  T+      FTWLL I G++  F W  I  SHIRF + ++ +G S  +L ++A
Sbjct: 497 IAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRA 556

Query: 444 MLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWF 499
                 +YYA   + + +V Q + +  P         NFF  Y+++ + +  +V F++W 
Sbjct: 557 QTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWR 616

Query: 500 KC-RLVWKLQDVDLDTDRRDIEEEVWSDDVED-----KNKNWWDR---FW 540
           +  RL  + +++DL + R   +EE+   + E+     +N   W R   FW
Sbjct: 617 RDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFW 666

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  243 bits (620), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 153/537 (28%), Positives = 257/537 (47%), Gaps = 37/537 (6%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           D      ++KR LK RH+ M                +             +   G+ +  
Sbjct: 70  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIG 129

Query: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146
               LGE+    PV  +F  +  RFL P+       +Y   W     LE+      +Q+W
Sbjct: 130 TIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 189

Query: 147 TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVT 206
             ++    W++I +V++   NLF VR +GE EF  +++K +                   
Sbjct: 190 NSSIDPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCIVLIFG---G 246

Query: 207 GP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQ 262
           GP    VG +YW +PG    G          F G +S L+ A+++  G E+  + +GE  
Sbjct: 247 GPDHEYVGAKYWYDPGCLANG----------FPGILSVLVVASYSLGGIEMTCLASGETD 296

Query: 263 EPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGT 322
              K +P AIK+V +RIL F++ SL ++G LVPY +  L    S V +SPF+I I+    
Sbjct: 297 P--KGLPSAIKQVFWRILFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHI 353

Query: 323 KILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTS 382
           K+LP I N VILI+++S GNS ++  SR L  +A     P +F    +AG P V ++  S
Sbjct: 354 KVLPSIVNVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANS 413

Query: 383 MFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYK 442
           +FG LA++  +      F WL+ I G+A    WL I+ SHIRF  A+K +G   ++L + 
Sbjct: 414 LFGLLAFLVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQGKKLDELEFV 473

Query: 443 AMLMPWLAYYAVFFMVIIIVIQGFTSFAP-------KFKVANFFAAYISVFLFIIFWVAF 495
           + +  W + Y+     +I++ Q + S  P         +   FF  Y+   + +  ++A 
Sbjct: 474 SAVGIWGSAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCALIVLFIFIAH 533

Query: 496 QIWFKCRL-----VWKLQDVDLDTDRRDIEEEVWSDDVEDK-----NKNWWDRFWNY 542
           +I++KC+      +  L+D+DL+TDR++I+ E+   ++ +K     +  W+ R ++Y
Sbjct: 534 KIYYKCQTGQWWGIKALKDIDLETDRKNIDIEIVKQEIAEKKMYLDSCPWYVRHFHY 590

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  243 bits (620), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 146/524 (27%), Positives = 257/524 (49%), Gaps = 13/524 (2%)

Query: 12  QVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXX 71
            ++    P   + L  +     ++ ++L  RH+                           
Sbjct: 66  NINGTSNPNDSNMLSKEDIDGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPA 125

Query: 72  XXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMT 131
                ++ + T +F+V  SLGE+    PV   F+V+  RF+ P+   +    Y   W + 
Sbjct: 126 SLVIGWVIVSTALFTVINSLGELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVL 185

Query: 132 FALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX 191
             LEL      I++W   +   AW+SI + ++ + N+  V+ +GE EF ++ +K+L    
Sbjct: 186 LPLELVAASITIRYWNDKINSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIG 245

Query: 192 -XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQG 250
                         V G +G +YW +PG +       +   ++F G  S  + AAF++ G
Sbjct: 246 FTILGIVLSCGGGPVGGYIGGKYWHDPGAF-----VGHTAGSQFKGLCSVFVTAAFSYSG 300

Query: 251 TELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV-- 308
            E++ ++A E  +PRKT+P A K+  + I   Y+  L +IG LVPY+DP+L +  S V  
Sbjct: 301 IEMIAVSAAESIDPRKTIPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDV 360

Query: 309 SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNT 368
           +SSP +I I+N G K LP + NA+ILI ++S  NS VY  SR +  +A     PK     
Sbjct: 361 ASSPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRI 420

Query: 369 SKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKA 428
            K G P    L T  FG ++++  +    + FTWL  + G++  F W+ I+ SHIRF +A
Sbjct: 421 DKKGRPINATLVTLFFGLISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRA 480

Query: 429 LKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYIS 484
           +  +G S  ++PY + +  + ++Y    + ++++   +TS  P    +     FF  Y+S
Sbjct: 481 MDIQGRSLEEMPYLSQVGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLS 540

Query: 485 VFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDD 527
           + + +  +V  + +FK  RL     ++DLD+ +RDI+ E+  ++
Sbjct: 541 LPILLACYVGHKFYFKNWRLFTPYNEIDLDSGKRDIDLELLREE 584

>SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance"
          Length = 551

 Score =  241 bits (615), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 161/511 (31%), Positives = 260/511 (50%), Gaps = 25/511 (4%)

Query: 14  DSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXX 73
            S+    ++  L  D   ++ + R L  RH++M                R          
Sbjct: 26  SSDLEQPSLEGLTTDNNVREHLNRSLSPRHVNMIAIAGVIGTGLYLGTGRALHLGGPASL 85

Query: 74  XXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFA 133
              Y  +G +V++   SLGEM T++P++ SF  FA++F S +F  A    YWF+ A++ A
Sbjct: 86  LINYSIIGLIVYATLLSLGEMSTYMPISGSFCSFAKKFGSESFAFALMCNYWFNDAVSVA 145

Query: 134 LELSVVGQIIQFW-TMAVPLAAWIS--IVWVLLTISNLFPVRIYGEIEFWIASVKVLXXX 190
            +L+ +  ++ +W T       WI+  I WV L   N+  V+IYGE E+W+A +KV+   
Sbjct: 146 SDLTALQLVLDYWKTSESGFPYWIASLIFWVFLLFLNVIHVKIYGEAEYWLAMLKVIAII 205

Query: 191 XXXXXXXXXXXXXXVTGP-VGFRYW-KNPGPWGMGIISSNVNEARFFGWVSSLINAAFTF 248
                              +GFR W +   P+  G          F G+ +  ++A+F +
Sbjct: 206 IFFILSIVANVGHNEQHEYIGFRNWTRGDAPFVNG----------FRGFATLFVSASFAY 255

Query: 249 QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV 308
            GTE + +T+GE + P +  PK IK V +RIL+FYI ++  IG+ VPY+ P L  ++  V
Sbjct: 256 GGTESITLTSGETKNPVRNTPKVIKTVFWRILIFYIFTVFFIGMNVPYDYPNL--SEKSV 313

Query: 309 SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLA-KNKAAPKFFTN 367
            +SPF I  Q  G+K      NAVIL +++SA N  ++ GSRIL+ L  +    PK  T 
Sbjct: 314 MTSPFTIVFQMVGSKAAGSFMNAVILTSVVSACNHALFAGSRILFNLGLEGYFFPKLVTR 373

Query: 368 TSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMK 427
           T+   VPYV VL T   G L +  +  G    + WL N+VGV+   AWL I    IRF +
Sbjct: 374 TNWYQVPYVAVLVTWAVGGLCFGSSFIGAGTLWIWLQNLVGVSNQIAWLSIGVISIRFRR 433

Query: 428 ALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFL 487
            L ++G   ++L +     P+  Y+ +  +  II++QG++S +P   V +FF+ Y+ +F+
Sbjct: 434 GLSRQG-KTHELKFVNWTYPYGPYFVIISVSFIILVQGWSSSSP-MDVTSFFSYYVELFI 491

Query: 488 FIIFWVAFQIW--FKCRLVWKLQDVDLDTDR 516
           F+  W+   +W  FK     + +D+D  TD+
Sbjct: 492 FLACWL---VWWAFKRDGFVREKDMDFVTDK 519

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  241 bits (615), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 147/513 (28%), Positives = 257/513 (50%), Gaps = 23/513 (4%)

Query: 29  QEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVT 88
           Q K++ +++ ++ RH+ M                +             Y  +G ++    
Sbjct: 35  QGKKEVLRQSIRPRHVFMISMATGIGTGLLVGNGKSIACAGIGGTLIGYGIIGVMLVCCM 94

Query: 89  QSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWT 147
           QS+GE+    P ++  F  + +RF+ P+ G +  +++   W +   LEL      I++W 
Sbjct: 95  QSVGELVVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCLQWMIVLPLELVTGSMTIKYWN 154

Query: 148 MAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXXXXXXXXXXXXVT 206
            ++  + ++S+ + L+ + N F    Y E EF   S+KV+                   +
Sbjct: 155 ASLSPSLFVSVFYALICVVNSFGSGGYAEAEFIFNSLKVVVIIGFIILGVLIDTGCVGTS 214

Query: 207 GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPR- 265
           G +GFRY  +PG +       N N         +L+NAAF+  G E + ++A E      
Sbjct: 215 GTIGFRYLIDPGMF-------NKNYNIIKATAGTLVNAAFSCGGVEFLALSAAEQNRDNM 267

Query: 266 -KTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ-SNDSYVSSSPFIITIQNAGTK 323
            K++ +A  +V  RI VFY+ S+ V+GLLVP+N P L  S  + + SSP++  +   G  
Sbjct: 268 PKSIGRACNQVSIRIFVFYLLSISVVGLLVPHNSPILMGSGSNMIHSSPYVAAVAMNGIT 327

Query: 324 ILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSM 383
           ++PHI NAVILI +IS  NS +Y  SR L+ LA+   APK+FT  +K G P   +  +++
Sbjct: 328 VVPHIINAVILIAVISVANSAMYSSSRTLHSLAEQNFAPKYFTKLNKHGQPMRCLFISAL 387

Query: 384 FGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKA 443
           FG ++++      +  F WLL+I G++  F W  I  +HIRF  A+K RG S   L YK+
Sbjct: 388 FGLISFVAEYRDQEAIFIWLLSISGLSTIFTWTTICIAHIRFRDAIKSRGQSLETLGYKS 447

Query: 444 MLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISVFLFIIFWVAFQIW 498
           +     +Y A    ++I+V+Q + S  P     K  +  FF  Y++V + ++F++  +++
Sbjct: 448 ITGVAGSYIATVINLVILVVQFWVSLFPLESNGKPNIVQFFQNYMAVPVALLFYIGHKVY 507

Query: 499 FKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVED 530
            K   L+ +  +VD+ TDR     +++   +ED
Sbjct: 508 TKNWSLLIRASNVDITTDR-----DIYCPTIED 535

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  241 bits (615), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 153/558 (27%), Positives = 266/558 (47%), Gaps = 43/558 (7%)

Query: 2   KLNQPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXX 61
           K  +P ++   +DS   P      +D      ++K+ LK RH+ M               
Sbjct: 51  KEKKPPIYRRIIDSFKPP------EDGSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGS 104

Query: 62  XRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANG 121
            +             +   G+ +      LGE+    PV  +F  +  RFL P+      
Sbjct: 105 GQALATGGPLAVIIGWAVAGSQIVGTIHGLGEITVRFPVVGAFASYTTRFLDPSISFVVS 164

Query: 122 YMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWI 181
            +Y   W     LE+      +Q+W  ++    +++I + ++   NLF  R +GE EF  
Sbjct: 165 TIYVLQWFFVLPLEIIASAITVQYWNDSIDPVVFVAIFYCVIVSINLFGARGFGEAEFIF 224

Query: 182 ASVKVLXXXXXXXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGW 237
           ++VK++                   GP    +G +YW NPG    G          F G 
Sbjct: 225 STVKIITICGFIILCIVLIAG---GGPDHEYIGAKYWHNPGSLAHG----------FKGV 271

Query: 238 VSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN 297
           +S L+ A+++  GTE+  + +GE     K +P AIK+V +RIL F++ SL ++G LVPY 
Sbjct: 272 LSVLVVASYSLGGTEMTCLASGETDP--KELPSAIKQVFWRILFFFLVSLTLVGFLVPYT 329

Query: 298 DPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAK 357
           +P L    S V +SPF+I I+    K+LP I NAVIL++I+S GNS ++  SR L  +A 
Sbjct: 330 NPNLLGGSS-VDNSPFVIAIKIHNIKVLPSIVNAVILVSILSVGNSCIFASSRTLCSMAH 388

Query: 358 NKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLL 417
               P +F    +AG P   ++  S+FG LA++  ++   + F WL+ I G+A    WL 
Sbjct: 389 QHLIPWWFGYIDRAGRPLTGIIINSLFGLLAFLVKSSSVTEVFDWLMAIAGLATCIVWLS 448

Query: 418 ISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP------ 471
           I+  H+RF  A+K +  + ++L + + +  W + Y+     +I+V Q + +  P      
Sbjct: 449 INICHVRFRLAMKAQNRTLDELEFVSAVGIWGSVYSGIVNALILVAQFYIALWPIGGWTD 508

Query: 472 -KFKVANFFAAYISVFLFIIFWVAFQIWFKCRLV--WK---LQDVDLDTDRRDIEEEVWS 525
              +   FF  Y+   + I+ ++  +I+++      W+   L+D+DLDTDR++++ E+  
Sbjct: 509 SGTRAKKFFQNYLCALILIVLFIGHKIYYRVTTGHWWEYIALKDIDLDTDRKNVDIEIIK 568

Query: 526 DDVEDK-----NKNWWDR 538
            ++ +K     +K W+ R
Sbjct: 569 QEIHEKKMYLASKPWYVR 586

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  242 bits (617), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 154/567 (27%), Positives = 266/567 (46%), Gaps = 39/567 (6%)

Query: 8   VHSFQVDSNDTPTT-------ISTLDDDQEKQ----------QDVKRELKKRHISMXXXX 50
           V SF+   +D  T        +STL   + KQ            +++ ++ RH+ M    
Sbjct: 75  VDSFRRAEDDEETAEDLENELVSTLSPSKSKQLHGQKNGDDDAHLQKSIRPRHVLMMSLG 134

Query: 51  XXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQ 109
                                     Y  MG+ ++ + Q+ GEM   +  +  +F  +  
Sbjct: 135 TGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEMAVCYSGLPGNFNAYPS 194

Query: 110 RFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLF 169
             +         ++Y   W     LEL      I +WT  V    ++ I +VL+T+ N F
Sbjct: 195 FLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTKVNSDVFVVIFFVLITLINTF 254

Query: 170 PVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSN 228
             + Y E EF+  S KVL                    G +G +YW NPG +       +
Sbjct: 255 GAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF-----RGD 309

Query: 229 VNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLL 288
            +  RF   +S+   AAF F  +E + I A E   PR+ +P A K +++RIL  ++ S+ 
Sbjct: 310 KSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSIT 369

Query: 289 VIGLLVPYNDPKL--QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVY 346
           ++G LVPY+  +L      +   +SP++I + + G +++PH  NAVIL++++S  NS  Y
Sbjct: 370 LVGFLVPYDSTELLGSGGSASSQASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAYY 429

Query: 347 IGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNI 406
              RILY LA+   APK+F    + G P   +L T++FG +A+   +   +  F WLL+I
Sbjct: 430 SSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCSCSDKEEDVFAWLLSI 489

Query: 407 VGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGF 466
            G++  F W  I  SHIRF +A+K +G S +++ +K+ +  W + YA   M++ ++ + +
Sbjct: 490 AGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSGYAAIMMILALIAEFW 549

Query: 467 TSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEE 521
            S AP         NFF  Y+++ + I+ +  ++I+ K  +L  + +D+DL + R   + 
Sbjct: 550 VSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKKDWKLFIRAKDIDLISHRTIFDG 609

Query: 522 EVWSDDVED-----KNKNWWDR---FW 540
           E+   + E+     +N   W R   FW
Sbjct: 610 ELVRQEEEEYKEKLRNGPKWKRVVAFW 636

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  240 bits (612), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 154/474 (32%), Positives = 224/474 (47%), Gaps = 13/474 (2%)

Query: 26  DDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVF 85
           +D  +    VKR+LK RHIS+                              +  +G + F
Sbjct: 47  EDTFDPDSGVKRQLKDRHISLLALGGIIGPGCLIGAGNALAIGGPLALLLGFGIIGILAF 106

Query: 86  SVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQF 145
            + +S+GEM T  P    FT   +RF S A  A  GY Y   +    A E + +  I+QF
Sbjct: 107 IMMESIGEMITLYPSGGGFTTLTRRFHSDALSAVCGYAYAVVFFAVLANEYNTLSSIMQF 166

Query: 146 WTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXV 205
           W   VPL  +I I W    +  L  V  +GE E+W+A  K+L                  
Sbjct: 167 WGPQVPLYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSIVYISGGVK 226

Query: 206 TGPV-GFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEP 264
             P  GF+YW +PG    G          F G  +  +  +  + GTE V + A E + P
Sbjct: 227 NRPAFGFQYWNDPGALSNG----------FKGIANVFVFCSTFYSGTESVALAATESKNP 276

Query: 265 RKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKI 324
           R+ VP AI++  +RIL+ Y+G  +  G+ VPYND  L    + V  SP  I I  AG   
Sbjct: 277 RRAVPIAIRQTFWRILIVYLGISIFYGVTVPYNDENLNF-ATKVLKSPIAIAISRAGWPA 335

Query: 325 LPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMF 384
             H+ NA ILIT ISA N ++YIGSR L  LA    APK    T + GVP   +   +  
Sbjct: 336 GVHLVNAFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFNAL 395

Query: 385 GSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAM 444
           G ++ M  +     A+ +++N+ GV  F  W +IS +H+RF KA K +G +R++LPYKA 
Sbjct: 396 GLISLMNVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYKAK 455

Query: 445 LMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIW 498
           L P     ++   + + ++QG++ F P F   NF  AYI +   II ++    W
Sbjct: 456 LFPVFPIVSIIANIFLGLVQGWSYFKP-FDAKNFVDAYILIPAGIILYLGVSYW 508

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  241 bits (614), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 158/557 (28%), Positives = 268/557 (48%), Gaps = 30/557 (5%)

Query: 8   VHSFQ-VDSNDTPTTISTLDDDQEKQQDV------KRELKKRHISMXXXXXXXXXXXXXX 60
           V+SF+  + + TP   S  D +      V      KR +K RH++M              
Sbjct: 52  VNSFKRAEKHSTP---SNGDLEHATTHSVASSSPLKRSIKPRHVAMMSICTGIGTGLLVA 108

Query: 61  XXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAA 119
             +             Y  +  V + + Q+ GEM    P +  +F  ++ + +S  FG A
Sbjct: 109 NGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISRPFGFA 168

Query: 120 NGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEF 179
             ++Y   W     LEL      I++W  ++    +I+I +V +   + F  R YGE EF
Sbjct: 169 TVWLYCIQWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFGSRGYGESEF 228

Query: 180 WIASVKVLXXXXXXXXXXXXXXXXXVTGP-VGFRYWKNPGPWGMGIISSNVNEARFFGWV 238
                KVL                      +G +YW +PG + +G         +F G  
Sbjct: 229 IFGICKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAFAVG-----SGATKFKGVA 283

Query: 239 SSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYND 298
             L+   F++ GTEL  +T  E   PR+ +    K+ ++RIL+ Y+ ++++IG LVP+  
Sbjct: 284 YVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHTS 343

Query: 299 PKL--QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLA 356
            +L   S  S   +SP+++ +   G KI+PHI NAVILI +IS GNS +Y G RIL  LA
Sbjct: 344 SELMGSSGKSATHASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTLA 403

Query: 357 KNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWL 416
           +   AP+F     +AG P V ++  S+FG LA++  +   +  FTWL  I G++  F W 
Sbjct: 404 EQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTWS 463

Query: 417 LISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----- 471
            I  SH+RF +A++      ++L YKA      +   + F +++ + Q + S AP     
Sbjct: 464 AIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPFGKDG 523

Query: 472 KFKVANFFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEE-VWSDDVE 529
           K  V +FF +Y++  L+++ +  + I F+   ++  L+D+DLD  R   +++ ++ +D+E
Sbjct: 524 KLDVLSFFQSYLAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYDQDRLYQEDLE 583

Query: 530 DK----NKNWWDRFWNY 542
            K    N +W  +  N+
Sbjct: 584 HKILIQNSSWARKLHNF 600

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  240 bits (612), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 156/551 (28%), Positives = 271/551 (49%), Gaps = 28/551 (5%)

Query: 10  SFQVDSN-DTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXX 68
           ++QVD   D       L + QE Q  V R+LK RHI +                      
Sbjct: 43  AYQVDQIIDVEDASMELIEGQEHQ--VARKLKSRHIQLIALGGAIGTGLFIGSGGALSVC 100

Query: 69  XXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQR--FLSPAFGAANGYMYWF 126
                   Y+ M   V+ +   L EM   +P++   ++FA    +L+       G   ++
Sbjct: 101 GPAPLLISYMIMSFFVWCIMNFLTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINLFY 160

Query: 127 SWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKV 186
           + +M    E++    +IQ+WT A   A +ISI  V+     + PV  +GE EFW++ +K+
Sbjct: 161 AMSMIAPSEITATAILIQYWTDANS-AIFISIFIVVTVSLTMLPVHFFGESEFWVSIIKL 219

Query: 187 LXXXXXXXXXXXXXXXXXVTGP--VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINA 244
                                   +GF YWK+PG +   ++  N    +F    +++I +
Sbjct: 220 FCITGLVILGIVIFFGGAPNQDKVLGFHYWKHPGAFNPHLVPGNT--GKFLACWTAIIKS 277

Query: 245 AFTFQGT-ELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL-- 301
            F++    E+V   A E ++PR+ +P+  ++ V+R+ +FY+   L IG++V Y++ +L  
Sbjct: 278 GFSYVLVPEVVVSCAAEAKDPRRNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSRLLN 337

Query: 302 --QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNK 359
              + +S  ++SPF+I IQ  G ++LPHI NA IL +  S G S +Y  SR+L+ +A N 
Sbjct: 338 AIAAGESNAAASPFVIGIQEVGIRVLPHIINACILTSAYSCGTSVLYGASRVLHSMAVNG 397

Query: 360 AAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLIS 419
           A PK F  T++ G PY +    S+F  LAY+  +      FTWL NI  ++GF  W+L+ 
Sbjct: 398 AVPKIFATTNRFGTPYYSTAAASVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDWMLVC 457

Query: 420 CSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANF 478
             ++RF K ++   ++ + +P++   M  LAY +  F  I+ +  G+  F A  + V++F
Sbjct: 458 VVYLRFRKVIEHANLT-DKMPFRKRFMKPLAYLSCGFFAILSLTNGYAVFVADNWNVSDF 516

Query: 479 FAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKN------ 532
           FA Y ++ L  + ++   I++K     KL+  DLD    +I  ++   D E+K       
Sbjct: 517 FACYTTLGLAAVLYIGAAIYYK---TIKLR--DLDEVAAEIIPKIAMADEEEKGEVPIVP 571

Query: 533 KNWWDRFWNYV 543
           KNW ++ W ++
Sbjct: 572 KNWLEKVWYFL 582

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  240 bits (612), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 161/554 (29%), Positives = 266/554 (48%), Gaps = 23/554 (4%)

Query: 3   LNQPQVHSFQVDSNDTPTTISTLDDDQ---EKQQDVKRELKKRHISMXXXXXXXXXXXXX 59
           L Q  V SF+    +   + S L+D +        +K+ +K RH+ +             
Sbjct: 37  LFQRIVDSFKRVEGEVRNS-SDLEDGEVTSAHSTKLKQNMKTRHVVLMSLGTGIGTGLLV 95

Query: 60  XXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGA 118
                            Y F+  + + + Q+ GEM    P +  +F  ++  F+S  FG 
Sbjct: 96  ANASSLHFGGPGGLLIGYFFVSIISYIMMQAAGEMAVAYPTLPGNFNAYSSIFISKPFGF 155

Query: 119 ANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIE 178
           A  +++   W     LEL     ++++WT  +    ++ I ++ +   +    R YGE E
Sbjct: 156 ATVWLFCIQWTTILPLELITSSIVVKYWTTKINADIFVLIFYLFILCIHFCGARGYGETE 215

Query: 179 FWIASVKVLXXXX-XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGW 237
           F   S KVL                    G +G +YW  PG +  G   S ++  RF G 
Sbjct: 216 FIFNSCKVLMVAGFIIVGILINCGAVGDDGYIGGKYWHEPGAFAAG---SGID--RFKGI 270

Query: 238 VSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN 297
              L+ A F++ G EL  ++  E+  PRK +P A  K V+RIL+ Y+ ++++IG LVP++
Sbjct: 271 AYVLVTAYFSYGGMELYALSVNELPNPRKAIPSACAKGVYRILIIYMLTMVIIGFLVPHD 330

Query: 298 DPKL-QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLA 356
             KL  S  S V  SP+++ +   G KI+PHI NAVILI++IS GNS +Y G R+L  LA
Sbjct: 331 SNKLLGSGSSGVHPSPYVLALSLHGIKIVPHIINAVILISVISVGNSAMYSGPRLLCSLA 390

Query: 357 KNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWL 416
           +   APK      + G P + ++  S+FG +A++  +   +  F WL  I G++  F W 
Sbjct: 391 QQGYAPKILDYVDRQGRPLMALIICSVFGLIAFVAASKYEEDIFGWLAAISGLSELFTWT 450

Query: 417 LISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----- 471
            I  SH RF +A+K +G S   L Y++    W + YAV F V +++ Q + +  P     
Sbjct: 451 AICLSHFRFRRAMKLQGRSLETLGYRSTTGEWGSLYAVVFNVFVLIAQLWVAMIPMDNGG 510

Query: 472 KFKVANFFAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEVW-SDDVE 529
           KF V + F + +++ L++   V + I  K   ++  L  + +D+ RR  + EV   +D+E
Sbjct: 511 KFSVKSLFKSCLALPLWLSMAVGYMIVTKNWTILNPLSSISVDSHRRSYDVEVMKQEDLE 570

Query: 530 DKNK----NWWDRF 539
            K K     W+ R 
Sbjct: 571 YKQKMKRSKWYVRM 584

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  239 bits (610), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 159/515 (30%), Positives = 235/515 (45%), Gaps = 26/515 (5%)

Query: 14  DSNDTPTTISTLDDDQ------EKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXX 67
            S  TP  I T +         + +  VKR LK RHIS+                     
Sbjct: 24  SSGITPDQIETGEGKNHNASLYDPKTGVKRALKDRHISLLALGGIIGPGCLVGAGNALAK 83

Query: 68  XXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFS 127
                    +  +G + F++ +S+GEM T  P    FT  A+RF S +  A  GY Y   
Sbjct: 84  GGPLALLLGFSIIGIIAFTIMESIGEMITLYPSGGGFTTLARRFHSDSLSAVCGYAYIVV 143

Query: 128 WAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVL 187
           +    A E + +  I QFW   VPL  +I I W       +  V  +GEIE+W++  K+L
Sbjct: 144 FFAVMANEYNTLSSIFQFWGPQVPLYGYILIFWAAFQAFQMAGVGAFGEIEYWLSWFKIL 203

Query: 188 XXXXXXXXXXXXXXXXXVTGPV-GFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAF 246
                               P  GF YW NPG    G          F G     +  + 
Sbjct: 204 GLVAFYIFSTIYISGGIKDRPAFGFHYWNNPGALSHG----------FKGIAEVFVFCST 253

Query: 247 TFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDS 306
            + GTE V  +A E + P + +P AI++  +RILV YIG     G+ VPYND  L +   
Sbjct: 254 FYSGTESVAYSASESKNPNRAIPLAIRQTFWRILVVYIGIGFFYGVTVPYNDHNLNAGTK 313

Query: 307 YVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFT 366
            + S P  I I  AG +   H+ NA IL+T ISA N +++IGSR +  LA    APKF  
Sbjct: 314 ALKS-PISIAITRAGWEGGTHLVNAFILVTCISAINGSLFIGSRTITNLAHEGLAPKFLA 372

Query: 367 NTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFM 426
            T + GVP   +   +  G ++ M  + G   A+++++N+ GV  F  W  I  +H+RF 
Sbjct: 373 WTDRRGVPIPAITLFNALGLVSLMNVSVGASTAYSYIVNLSGVGVFIVWGTIGLTHLRFR 432

Query: 427 KALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVF 486
           KA  ++G +  +LPYKA+  P+     +   + + +IQG+TSF P FK  +F  AY+ + 
Sbjct: 433 KAWIKQGRTVKELPYKALFYPYTQIIGIAANIFLALIQGWTSFVP-FKAGDFVDAYVLLP 491

Query: 487 LFIIFWVAFQIW----FKCRLVWKLQDVDLDTDRR 517
              + ++   +     FK      L  +DLD  RR
Sbjct: 492 AAAVLYIGISLLKTHSFKTV---DLLTIDLDEGRR 523

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  240 bits (612), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 151/554 (27%), Positives = 271/554 (48%), Gaps = 25/554 (4%)

Query: 8   VHSFQVDS--NDTPTTISTLDDDQEKQQD---VKRELKKRHISMXXXXXXXXXXXXXXXX 62
           VH F VDS      +T + L+D  +   D   +K+ +K RH+ M                
Sbjct: 44  VHRF-VDSFKRAQDSTENDLEDGTKPLGDASHLKKAMKSRHVIMMCVGTGIGTGLLVANA 102

Query: 63  RXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANG 121
                         Y+ +  V + + Q+ GEM    P +  +F  +   F+S  FG A  
Sbjct: 103 SGLSYGGPGSLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMFISKPFGFATV 162

Query: 122 YMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWI 181
           ++++  W   F LEL      I++W   +    +I I +V L   + F V+ YGE EF  
Sbjct: 163 WLFFIQWLTVFPLELITASLTIKYWNDKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIF 222

Query: 182 ASVKVLXXXX-XXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSS 240
            S KVL                    G +G +YW++PG +  G      +  +F G    
Sbjct: 223 NSCKVLMIAGFIILSIVINCGGAGKDGYIGAKYWRDPGSFAEGD-----SVEKFKGICYI 277

Query: 241 LINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPK 300
           L+ A F++ G EL  ++  E + PRK+ P+A K+ ++RIL+ Y+ ++++IG  VP+N+ +
Sbjct: 278 LVTAYFSYGGAELFSLSVNEQENPRKSTPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQ 337

Query: 301 LQ-SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNK 359
           L  S  S   +SP+++     G K++PH  NAVILI++IS  NS +Y   R++  LA+  
Sbjct: 338 LMGSGGSATHASPYVLAASIHGVKVVPHFINAVILISVISVANSALYASPRLMCSLAEQG 397

Query: 360 AAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLIS 419
            APKF     + G P   ++  ++FG + ++  ++  ++ FTWL  I G++  F W  I 
Sbjct: 398 YAPKFLDYVDREGRPLRALILCAVFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIM 457

Query: 420 CSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFK 474
            SH+RF + +K  G S  ++ ++A+   W + Y + F +++ + Q + + AP     K  
Sbjct: 458 LSHVRFRQCMKLHGRSEEEIGFRAVTGIWGSMYGISFNMLVFIAQFWVALAPPSLHGKVD 517

Query: 475 VANFFAAYISVFLFIIFWVAFQIWFK-CRLVWKLQDVDLDTDRRDIEEEVWSDDVED--- 530
             +FF +Y++  +++ F+  + ++ +    +  L  +DL+  RR  + E+   + E+   
Sbjct: 518 AESFFQSYLAAPIWLFFYFGYMLYKRDFTFLVPLDKIDLNFHRRIYDPELIRQEDEENKE 577

Query: 531 --KNKNWWDRFWNY 542
             KN + W R +++
Sbjct: 578 KIKNSSVWVRMFHF 591

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  239 bits (610), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 156/542 (28%), Positives = 264/542 (48%), Gaps = 32/542 (5%)

Query: 26  DDDQEKQQDVK---------RELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXX 76
           D DQ    D++         R LK RHI +                              
Sbjct: 37  DSDQGSYSDIENFKPPQKIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIA 96

Query: 77  YLFMGTVVFSVTQSLGEMCTFIPV--TASFTVFAQRFLSPAFGAANGYMYWFSWAMTFAL 134
           Y+ +   V+S+   + EM   IP+   AS    A+ +L+       G+  +++ AM    
Sbjct: 97  YIIISFFVWSIMNQMTEMVCLIPLPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPA 156

Query: 135 ELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXX 194
           E++    ++Q+WT A   A +ISI  V+  +  + PV+++GE EFW++S+K+L       
Sbjct: 157 EITACALLVQYWTDANS-AIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLII 215

Query: 195 XXXXXXXXXXVTGP-----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQ 249
                       GP     +GF YWKNPG +   +   N    RF    +++I + F+F 
Sbjct: 216 VGIVIFFG---GGPAQDHVLGFHYWKNPGAFNPHLAEGNT--GRFLAVWTAIIKSGFSFV 270

Query: 250 GT-ELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL----QSN 304
              E V   + E   PR+ +PKA ++ ++R+ +FYI   LV+G++V +N+ +L    QS 
Sbjct: 271 LVPETVTSCSAECIAPRRNMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSG 330

Query: 305 DSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKF 364
            S  ++SPF+I IQ AG KILPHI NA IL +  S G   +Y  SR LY +A    APK 
Sbjct: 331 KSDAAASPFVIGIQEAGIKILPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKI 390

Query: 365 FTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIR 424
           F   ++ G PY +    S+F  LAY+  +      F WL NI  ++GF +W+ +S ++IR
Sbjct: 391 FAKVNRFGTPYYSTGLASLFSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIR 450

Query: 425 FMKALKQRGISRND-LPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-KFKVANFFAAY 482
           F K +    +  ND +P++      LAY    F  I+ +  G+  F    + V++FFA+Y
Sbjct: 451 FRKVIN--ALDLNDRVPFRRPFQVPLAYLTCGFFFILSLTNGYAVFVKGNWNVSDFFASY 508

Query: 483 ISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDT-DRRDIEEEVWSDDVEDKNKNWWDRFWN 541
           +++   I  ++    ++K       ++++++   + DI +E   +DV    +N+ ++ W 
Sbjct: 509 VTIGFVIFLYLVGSFYYKQWTFRDFKEIEVEILPKIDIADEEERNDVIPVPRNFMEKVWY 568

Query: 542 YV 543
           ++
Sbjct: 569 FI 570

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  240 bits (612), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 156/547 (28%), Positives = 265/547 (48%), Gaps = 21/547 (3%)

Query: 2   KLNQPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXX 61
           + +  Q+H+ +  S D    I+++  D +     K+ L  RH+ M               
Sbjct: 50  RADPSQLHNAR--SEDVEDGIASIRSDTQ----FKKSLSSRHVIMMSLGTGIGTGLLVAN 103

Query: 62  XRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAAN 120
            +             Y+ +  V + + Q+ GEM    P +  +F  +   F+S ++G A 
Sbjct: 104 AKGLYYGGPGSLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKSWGFAT 163

Query: 121 GYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFP-VRIYGEIEF 179
            +++   W     LEL      I++W   +    ++ I +V L   +L   +R YGE EF
Sbjct: 164 VWLFCIQWLTVLPLELITSSLTIKYWNDKINADIFVMIFYVFLVAIHLVGGIRAYGETEF 223

Query: 180 WIASVKVLXXXXXXXXXXXXXXXXXVT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWV 238
              S K+L                    G +G +YW  PG +  G  +S     RF G  
Sbjct: 224 LFNSCKILMVIGFIILSIVINAGGAGNDGYIGGKYWHEPGSFAEGDATS-----RFKGIC 278

Query: 239 SSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYND 298
             L++  F++ GTEL  ++  E  EPRK  P A KK ++RIL+ Y+ ++++IG  VP+N+
Sbjct: 279 LVLVSGYFSYGGTELYVLSVNEQAEPRKATPAAAKKSIYRILIIYLLTMILIGFNVPHNN 338

Query: 299 PKLQ-SNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAK 357
            +L  +  S   +SP+++     G KI+PH  NAVILI++IS  NS+++ G R+L  LA 
Sbjct: 339 DQLMGAGGSATHASPYVLAATIHGVKIVPHFINAVILISVISVANSSLFAGPRLLSSLAT 398

Query: 358 NKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLL 417
              APK  +   + G P V +  + + G +A++  T+  ++ FTWL  I G++  F W  
Sbjct: 399 QGYAPKILSYVDREGRPLVALGISFLIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSG 458

Query: 418 ISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----K 472
           I  SH+RF  A+K +G   N+L YKA    W + Y  FF V++++ Q + + AP     K
Sbjct: 459 IMFSHVRFRAAMKVQGKDINELGYKANTGVWGSAYGAFFGVLVLIAQFWVALAPIGNGGK 518

Query: 473 FKVANFFAAYISVFLFIIFWVAFQIWFK-CRLVWKLQDVDLDTDRRDIEEEVWSDDVEDK 531
                FF +Y++  +++  +  + I+ K   L+  L  +DLD+ RR  + E+   + E+ 
Sbjct: 519 CDAEAFFESYLAFPIWVACYFGYMIYNKDFTLLSPLDKIDLDSYRRIYDPELIKQEDEEN 578

Query: 532 NKNWWDR 538
            +N   R
Sbjct: 579 KENLKSR 585

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  240 bits (612), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 140/456 (30%), Positives = 241/456 (52%), Gaps = 13/456 (2%)

Query: 82  TVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQ 141
           T +F+V  SLGE+    PV   F V+  RF+ P+F  +    Y   W +   LEL     
Sbjct: 133 TALFTVINSLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASL 192

Query: 142 IIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXX-XXXXXXXX 200
            I++W   +   AW++I + L+ I+NL  V+ +GE EF ++ VK+L              
Sbjct: 193 TIRYWDDTINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTC 252

Query: 201 XXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGE 260
                 G +G +YW +PG +       +    +F G  S  + AAF++ G E++ ++A E
Sbjct: 253 GGGPKGGYIGGKYWHDPGAF-----VGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAE 307

Query: 261 VQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV--SSSPFIITIQ 318
            Q PRKT+P A K+  + I   YI  L ++G LV YND +L +  S V  ++SP +I I+
Sbjct: 308 SQNPRKTIPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIE 367

Query: 319 NAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTV 378
           N G K LP + NA+ILI I+S  NS VY  SR +  +A     PK  +   K G P   +
Sbjct: 368 NGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAI 427

Query: 379 LFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRND 438
             T  FG L+++  +   ++ FTWL  + G++  F W+ I+ +HIRF +A+  +  S ++
Sbjct: 428 FTTLFFGLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDE 487

Query: 439 LPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIFWVA 494
           +PY +    + +YY    + ++++   +TS  P          FF  Y+S  + I  ++ 
Sbjct: 488 MPYLSQTGIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIG 547

Query: 495 FQIWFKC-RLVWKLQDVDLDTDRRDIEEEVWSDDVE 529
            +++FK  R++  L+++DL T R++++ ++  ++++
Sbjct: 548 HKLYFKNWRIMTPLEEIDLLTGRKEVDIDILKEELK 583

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  240 bits (612), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 158/529 (29%), Positives = 264/529 (49%), Gaps = 18/529 (3%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           +   K + +K+ ++ RH+ M                +             Y  + ++++ 
Sbjct: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132

Query: 87  VTQSLGEMCT-FIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQF 145
           V QS  E+   +  +   F  +    +  AFG +  ++Y   W     LEL      I++
Sbjct: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192

Query: 146 WTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXV 205
           W   +   A+++I +V+L   N      Y E EF+    KVL                  
Sbjct: 193 WNQTINPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGGAG 252

Query: 206 T-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEP 264
             G +G RYW +PG +     S ++N  RF G V+ L+NAAF + G E   +TA E Q P
Sbjct: 253 NDGYLGARYWHDPGAFRG---SDSIN--RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNP 307

Query: 265 RKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN-DPKLQSNDSYVSSSPFIITIQNAGTK 323
           +K++  A KK+V+RIL  YI + +++G LVP+N D  L S  S   +SPF+I + + G +
Sbjct: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVR 367

Query: 324 ILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSM 383
           ++PH  NAVIL++++S  NS +Y  SRIL  L++   AP+F     + G P + +L + +
Sbjct: 368 VVPHFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVSCV 427

Query: 384 FGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKA 443
           FG L+++  +   +  FTWLL I G++  F W  IS SH+R  +A+  +G S ++L Y A
Sbjct: 428 FGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVA 487

Query: 444 MLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWF 499
               W AYYA+  +V I+V Q + + +P    K    NFF  Y+++ + I  ++ ++IW 
Sbjct: 488 WTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWT 547

Query: 500 KC-RLVWKLQDVDLDTDRRDIEEEVW-SDDVEDKNK----NWWDRFWNY 542
           +  RL+    +VDL   R+  + EV   + +E+K +     W  R  N+
Sbjct: 548 RDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANF 596

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  237 bits (604), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 145/469 (30%), Positives = 236/469 (50%), Gaps = 9/469 (1%)

Query: 2   KLNQPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXX 61
           K+ +  V   +++          L +D+ +   +K+ LK+RHI M               
Sbjct: 18  KICETNVDEQELECGSETAKQGVLYNDRTR---LKQGLKERHIKMLTLVGVFGTGLFLSS 74

Query: 62  XRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANG 121
                          YLF+G VV     ++ E+ +F+P T +    A++F+  + G   G
Sbjct: 75  GGTLKKIGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVGFTFG 134

Query: 122 YMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWI 181
           ++  +S  M    ELS    I+++WT   P A +I++  VL   +N++ +R YGEIE+  
Sbjct: 135 WISTYSSLMPG--ELSATAVIMKYWTDVSP-AVFITVFGVLFVATNIYTIRFYGEIEYVF 191

Query: 182 ASVK-VLXXXXXXXXXXXXXXXXXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSS 240
             +K VL                     +GF YW++PGP+   +++ ++   +F G+ ++
Sbjct: 192 GWLKLVLIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFANYLVAGHI--GKFVGFWAA 249

Query: 241 LINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPK 300
           + +  +++ G + + I AGE +  R  +    K V  RI+V Y+ ++ V+ L+VPYND  
Sbjct: 250 ISSVVYSYSGIQNIAILAGETKNSRYAIFHGAKNVFLRIIVLYLVTVFVLTLIVPYNDKL 309

Query: 301 LQSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKA 360
           + +      SSPF+I +  AG K+LPHI NA+IL +  SAGN  +  GSR L+ LA    
Sbjct: 310 IATGTGTAKSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQ 369

Query: 361 APKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISC 420
           AP+ F  TSK G+PYV V+F S F  LAYM  +      F W   +V       W+LIS 
Sbjct: 370 APQIFLKTSKRGIPYVGVIFISSFLPLAYMSCSESSATVFGWFQELVSSNTLLRWILISA 429

Query: 421 SHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF 469
           +HI   +ALK +G SR+DLP    + P+ A+++    VI +   GF +F
Sbjct: 430 NHIHMDRALKAQGYSRSDLPCSTRIAPFAAWFSGIMSVIFLFTGGFYNF 478

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score =  239 bits (611), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 148/528 (28%), Positives = 258/528 (48%), Gaps = 31/528 (5%)

Query: 33  QDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLG 92
            ++KR LK RH+ M                +             +   G+ +      LG
Sbjct: 74  SNLKRSLKSRHLIMIAIGGSIGTGLFIGSGQALANGGPLALVLGWSIAGSQIVGTIHGLG 133

Query: 93  EMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPL 152
           E+    PV  +F  +  RFL P+       +Y   W     LE+      +Q+W   +  
Sbjct: 134 EITVRFPVVGAFANYQTRFLDPSLSFVISTIYVLQWFFVLPLEILSSAITVQYWNDTIDP 193

Query: 153 AAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXXVTGP-VGF 211
             +++I +  +   NLF VR +GE EF  +++KV+                  T   +G 
Sbjct: 194 VVFVAIFYCAIVSINLFGVRGFGEAEFVFSTIKVITVTGFIILCIILICGGGPTHEFIGA 253

Query: 212 RYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKA 271
           +YW +PG    G          F G++S LI A+++  GTE+  + +GE     K +P A
Sbjct: 254 KYWHDPGCLANG----------FRGFLSVLITASYSLGGTEMTCLASGETDP--KELPSA 301

Query: 272 IKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFNA 331
           IK+V +RIL F++ SL ++G LVPY +  L    S V +SPF+I I+    K+LP I NA
Sbjct: 302 IKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-VDNSPFVIAIKLHNIKVLPSIVNA 360

Query: 332 VILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYME 391
           VILI+I+S GNS ++  SR L  +A     P +F    +AG P   ++  S+FG LA++ 
Sbjct: 361 VILISILSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLTGIVINSLFGLLAFLV 420

Query: 392 TTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAY 451
            ++   + F WL+ I G+A    WL I+  HIRF  A+K +  + ++L + + +  W + 
Sbjct: 421 KSSSVSEVFDWLMAIAGLATCIVWLSINICHIRFRLAMKAQNKTIDELEFVSAVGVWGSV 480

Query: 452 YAVFFMVIIIVIQGFTSFAP-------KFKVANFFAAYISVFLFIIFWVAFQIWFKCRL- 503
           Y+     +I+++Q + S  P       K +   FF  Y+   + +IF++  +++F+ +  
Sbjct: 481 YSAIINSLILIVQFYVSLWPIGGWTDSKDRAGKFFQNYLCAIVSLIFFICHKLYFRYKTK 540

Query: 504 ----VWKLQDVDLDTDRRDIEEEVWSDDVEDKN-----KNWWDRFWNY 542
               +  L+D+DLDT R++I+ ++  ++++++      K W+ R  ++
Sbjct: 541 KWWEIIPLKDIDLDTGRKNIDIDIVKEEIKERKQYLATKPWYIRLMHH 588

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  238 bits (606), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 155/552 (28%), Positives = 259/552 (46%), Gaps = 46/552 (8%)

Query: 13  VDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXX 72
           VDS   P       D      ++KR LK RH+ M                +         
Sbjct: 47  VDSFKPPV------DGSFDTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLA 100

Query: 73  XXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTF 132
               +   G+ +      LGE+    PV  +F  ++ RFL P+       +Y   W    
Sbjct: 101 VIIGWTIAGSQIVGTIHGLGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVL 160

Query: 133 ALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXX 192
            LE+      IQ+W  ++    W++I + ++   NLF  R +GE EF  +++K +     
Sbjct: 161 PLEIIASAITIQYWNSSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGF 220

Query: 193 XXXXXXXXXXXXVTGP----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTF 248
                         GP    +G +YW +PG    G          F G +S L+ A+++ 
Sbjct: 221 IILCIVLICG---GGPDHEFIGAKYWHDPGALAHG----------FPGVLSVLVVASYSL 267

Query: 249 QGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV 308
            GTE+  + +GE     K +P AIK+V +RIL F++ SL ++G LVPY +  L    S V
Sbjct: 268 GGTEMTCLASGETDP--KELPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSS-V 324

Query: 309 SSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNT 368
            +SPF+I I+    K LP I NAVILI+I+S GNS ++  SR L  +A     P+FF   
Sbjct: 325 DNSPFVIAIKLHHIKALPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYI 384

Query: 369 SKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKA 428
            +AG P   ++  S+FG LA++  ++   + F WL+ I G+A    WL I+ SHIRF  A
Sbjct: 385 DRAGRPLAGIVTNSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLA 444

Query: 429 LKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-------KFKVANFFAA 481
           +K +  + ++L + + +  W + Y+    V+I++ Q + S  P         +   FF +
Sbjct: 445 MKAQNKTLDELEFVSAVGIWGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQS 504

Query: 482 YISVFLFIIFWVAFQIWFKCRL-----VWKLQDVDLDTDRRDIEEEVWSDDVED-----K 531
           Y+   + ++ +   +++++        V  L+D+DL+T R++++ +V   ++ +     K
Sbjct: 505 YLCALIMLLIFCIHKVYYRVSFGKWWDVKPLKDIDLETGRKNVDIDVIKAEIAERKMYLK 564

Query: 532 NKNW---WDRFW 540
            K W   W  FW
Sbjct: 565 KKPWIVRWYHFW 576

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  237 bits (605), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 157/548 (28%), Positives = 271/548 (49%), Gaps = 29/548 (5%)

Query: 11  FQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXX 70
           F + S     +  ++ D + ++  + R LK RH+ +                        
Sbjct: 27  FSIHSTGDEVSQGSVLDIESQKPGIVRGLKSRHVQLIALGSAIGTGLFIGSGGALSICGP 86

Query: 71  XXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFA--QRFLSPAFGAANGYMYWFSW 128
                 Y  M   V+SV   + EM T IP+    T+++  + +++       G+  +++ 
Sbjct: 87  APLLIAYAVMSLFVWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCGWNLFYAQ 146

Query: 129 AMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLX 188
           AM    E++    ++Q+WT A P A +ISI  VL     + PV+++GE EFW++S+K+L 
Sbjct: 147 AMIAPAEVTACALLVQYWTDANP-AIFISIFLVLSVAITMLPVKVFGESEFWVSSIKILT 205

Query: 189 XXXXXXXXXXXXXXXXVTGP-----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLIN 243
                             GP     +GF YWK PG +   ++       +F  + +++I 
Sbjct: 206 IVGLIIVGVVIFFG---GGPAQEHVLGFHYWKKPGAFKPYLVEGGT--GKFLAFWTAIIK 260

Query: 244 AAFTFQGT-ELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ 302
           + F+F    E+V   A E   PR+ +P+A K+ ++R+ +FY+  +LV+G++V Y++ +L 
Sbjct: 261 SGFSFVLVPEIVSSCAAEAVAPRRNMPRACKRFIYRLALFYVFGILVVGVIVGYDNDRLL 320

Query: 303 SNDSYVSSS----PFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKN 358
           +  +   SS    PF+I I+ AG ++LPHI NA IL +  S G   +Y  SR L+ +A  
Sbjct: 321 NAIASGQSSAAASPFVIGIKEAGIRVLPHIINAAILTSAYSCGTGLLYGASRTLHSMACK 380

Query: 359 KAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLI 418
             AP+  T  +K GVPY     TS+F  LAY+  +      F WL NI  ++GF +W+L+
Sbjct: 381 GDAPRILTTVNKYGVPYYCTGITSLFCLLAYLNCSNSSSVVFNWLSNIATISGFVSWVLV 440

Query: 419 SCSHIRFMKALKQRGISRND-LPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-KFKVA 476
           S ++IRF   +    +  ND +P++      LAY A+ F  I+ +  GF  F    +  +
Sbjct: 441 SIAYIRFRNVIDV--LKLNDRIPFRVPYQKPLAYLAMGFFSILTLTNGFAVFIKGNWDTS 498

Query: 477 NFFAAYISVFLFIIFWVAFQIWFK---CRLVWKL-QDVDLDTDRRDIEEEVWSDDVEDKN 532
           NFFAAYI++   ++ +V   I++K   CR + ++ QD+       + EE  +   V    
Sbjct: 499 NFFAAYITLGFVLVLFVGSTIYYKEWRCRDIAEIEQDILPKITLAEAEEYEYDIPVP--- 555

Query: 533 KNWWDRFW 540
           +NW ++ W
Sbjct: 556 RNWLEKIW 563

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  238 bits (607), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 155/532 (29%), Positives = 262/532 (49%), Gaps = 25/532 (4%)

Query: 19  PTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYL 78
           P+  S L+  QEK  ++ + +K RH+ M                +             Y 
Sbjct: 76  PSQNSELES-QEKN-NLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYG 133

Query: 79  FMGTVVFSVTQSLGEM-CTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELS 137
               +++ + Q+ GE+   +  +T ++T +    + P+ G A   +Y   W     L+L 
Sbjct: 134 VASIMLYCIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLV 193

Query: 138 VVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXX 197
                +++WT +V    ++++V++ + I NLF  R Y E EF     K+L          
Sbjct: 194 TAAMTVKYWT-SVNSDIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVIGFVILAI 252

Query: 198 XXXXXXXVTGP-VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGI 256
                       +G  YW NPGP+  G          F G  +    AAF++ G E++ +
Sbjct: 253 IINCGGAGDRKYIGTEYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLL 302

Query: 257 TAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN-DPKLQSNDSYVS-SSPFI 314
           +A E + P K++P A KKVV+RIL+ Y+ + +++  LVPYN D  L S+DS  S +SPF+
Sbjct: 303 SAAEQENPTKSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSDDSSGSHASPFV 362

Query: 315 ITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVP 374
           I + + G K++PH  NAVILI++IS  NS++Y G R+L  LA+    PK      + G P
Sbjct: 363 IAVASHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRP 422

Query: 375 YVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGI 434
            +  L +  FG + ++ T+   ++ FTWLL I  ++  F W+ +S SHIRF  A+ ++G 
Sbjct: 423 LLCFLVSLAFGCIGFVATSDAEEEVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGR 482

Query: 435 SRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISVFLFI 489
           S N++ YKA    W ++ AV   V  +V Q + + AP     K  V  FF  Y+++ + +
Sbjct: 483 SMNEVGYKAQTGYWGSWLAVLIAVFFLVCQFWVAIAPVNDHGKLNVKVFFQNYLAMPIVL 542

Query: 490 IFWVAFQIWFKCRLVWKLQD-VDLDTDRRDIEEEVWS--DDVEDKNKNWWDR 538
           + +   +I+FK    W   D +DL++ R        +  D  +D  K + ++
Sbjct: 543 VAYFGHKIYFKSWSFWIPADKIDLNSHRNIFVHSTLTEFDKADDDVKEYENQ 594

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  236 bits (602), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 141/532 (26%), Positives = 258/532 (48%), Gaps = 26/532 (4%)

Query: 26  DDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVF 85
           +++      +K+ +K RH+ M                +             Y     +++
Sbjct: 61  NEECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVASIMLY 120

Query: 86  SVTQSLGEM-CTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQ 144
            + Q+ GE+   +  +  ++T ++   + PA G +  ++Y   W     L+L      ++
Sbjct: 121 CIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAAMTVR 180

Query: 145 FWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXXXXXXXXXXX 203
           +WT A P   ++++ +V++ + N+F  + Y E EF     KVL                 
Sbjct: 181 YWTNANP-DIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIAINCGGA 239

Query: 204 XVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQE 263
             +G +G +YW +PG +  G          F G       AAF++ G E++ +TA E + 
Sbjct: 240 GTSGYIGAKYWHSPGSFAAG----------FKGVCYVFCYAAFSYGGIEVMVLTASEQEN 289

Query: 264 PRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL--QSNDSYVSSSPFIITIQNAG 321
           PRK++P A KKV++RIL+ Y+ + +++  LVPYN  +L   S +S   +SP +I + + G
Sbjct: 290 PRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHASPLVIAVASHG 349

Query: 322 TKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFT 381
            KI+PHI NAVILI++IS GNS++Y   R+L  L++   APKF     + G P +    T
Sbjct: 350 VKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLICFAIT 409

Query: 382 SMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPY 441
            +   +A++  +   +  F WLL I G++  F W  I  SH+RF  A+  +G+S   + Y
Sbjct: 410 LLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLSLGQIGY 469

Query: 442 KAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISVFLFIIFWVAFQ 496
           K+    W +++A+   V++++ Q + + AP     +     FF  Y++  + +  +  ++
Sbjct: 470 KSQTGYWGSWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLGAYFGYK 529

Query: 497 IWFKC-RLVWKLQDVDLDTDRRDIEEEVW-SDDVE----DKNKNWWDRFWNY 542
           ++ K  RL     +VDL + R   +EE+   +D E      N + W R  ++
Sbjct: 530 VYHKDWRLCIPASEVDLSSHRNISDEEILRQEDYEWNEKMSNSSIWVRLCHF 581

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  235 bits (599), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 156/536 (29%), Positives = 259/536 (48%), Gaps = 31/536 (5%)

Query: 27  DDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFS 86
           D  +   +V R LK RH+                                Y  M   V++
Sbjct: 56  DTIKPSTEVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAPLLISYSVMSFFVWA 115

Query: 87  VTQSLGEMCTFIPVT--ASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQ 144
           +   + EM   IP++  +S    A  +L+       G+  +++ +M    E++    +I+
Sbjct: 116 IMNQMTEMVVLIPLSGESSMASLAGTYLNRPSSFMCGWNCFYAMSMVVPTEITACALLIE 175

Query: 145 FWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXX 204
           +WT A   A +++I  +L T+ +L PV+I+GE EF ++ +K+L                 
Sbjct: 176 YWTDA-NAAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTILGLILVGVVIFFGG- 233

Query: 205 VTGP-----VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTF-QGTELVGITA 258
             GP     +GF YW  PG +   ++  +     F     ++I + F F    E+    +
Sbjct: 234 --GPAQHKVLGFHYWNTPGAFNSYLVKGSTGA--FLAVWKAIIKSGFAFVMIPEITSSCS 289

Query: 259 GEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQ----SNDSYVSSSPFI 314
            E   PRK +P+A ++ V+R+ VFY+   LVIG++V Y++  L     S  +  ++SPF+
Sbjct: 290 AEAAFPRKNMPRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISSGKANAAASPFV 349

Query: 315 ITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVP 374
           I IQ AG +ILPHI NA IL +  S   S +Y  SR+L+ LA    APKFF+  +K GVP
Sbjct: 350 IGIQEAGIRILPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAPKFFSKVNKYGVP 409

Query: 375 YVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGI 434
           Y +V  TS+FG LAY+  +      F WL NI  ++GF  W+ +S +++RF K      I
Sbjct: 410 YYSVAATSLFGVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYLRFRKITDYLKI 469

Query: 435 SRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAYISVFLFIIFWV 493
           + + +PY+      LAY +  F  ++ +  GF  F A  + V++FF  Y+++    + ++
Sbjct: 470 N-DRVPYRRRGQRALAYASAIFFALLAITNGFYVFIAGNWNVSDFFTCYVTIGFVGVLFI 528

Query: 494 AFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKN------KNWWDRFWNYV 543
              I++K    W  +  D+D   R+I  ++   D E+K       KNW +R W  V
Sbjct: 529 GSSIYYK---EWTFR--DMDVVGREIMPKIDQADQEEKEEYLPPPKNWVERVWRIV 579

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  234 bits (598), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 149/521 (28%), Positives = 255/521 (48%), Gaps = 25/521 (4%)

Query: 25  LDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVV 84
           L  +  +   +++ +K RH+ M                +             YL +G +V
Sbjct: 15  LSSEGSEPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGYLIIGVMV 74

Query: 85  FSVTQSLGEMCTFIP-VTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQII 143
               QS+GE+    P +   F  + ++F+ P+ G    +++   W +   LEL      I
Sbjct: 75  VCCMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLELVTASMTI 134

Query: 144 QFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXX-XXXXXXXXXXX 202
           ++W   +  + ++S  ++L+ I N F    Y E EF    VKV+                
Sbjct: 135 KYWNSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVLGIVIITGG 194

Query: 203 XXVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQ 262
              +GP+GF+Y K PG +       N N   F     +L+NAAF+  G E + ++A E  
Sbjct: 195 LGNSGPIGFQYLKTPGAF-------NTNYNVFKATAGTLVNAAFSCGGVEFLALSAAE-- 245

Query: 263 EPRKTVPKAIKK----VVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVS-SSPFIITI 317
           + R  +PK+I++    V  R+ VFY+ S+ V+GLLVPY+ P L  + S  + +SP++  I
Sbjct: 246 QNRDNMPKSIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSPYVAAI 305

Query: 318 QNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVT 377
              G +I+PHI NAVILI ++S  NS +Y  SR L+ LA+   AP++F   +K G P   
Sbjct: 306 ALHGVRIVPHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMRC 365

Query: 378 VLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRN 437
           ++ +++ G ++++      +  F WLL+I G++  F W  I  +HIRF  ALK +G S +
Sbjct: 366 LVVSAIVGLISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSLD 425

Query: 438 DLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISVFLFIIFW 492
            L Y++      +Y A    V++I++Q + S  P     K     FF  Y++V + ++ +
Sbjct: 426 TLGYRSNTGVIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLLY 485

Query: 493 VAFQIWFKCRLVW-KLQDVDLDTDRRDIEEEVWSDDVEDKN 532
           +  +++      W +   VD++TD RD+     SDD+  K 
Sbjct: 486 LGHKLYTNDWTPWIRTHCVDINTD-RDVYAP--SDDLSTKG 523

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  235 bits (599), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 141/508 (27%), Positives = 258/508 (50%), Gaps = 14/508 (2%)

Query: 31  KQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQS 90
           K++++KR++ +RH+                                Y  MGT V+ V Q+
Sbjct: 113 KKEELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQA 172

Query: 91  LGEM-CTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMA 149
            GE+  T+  +   F  +    ++P+F  + G++Y   W     LEL      I++WT  
Sbjct: 173 AGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTTK 232

Query: 150 VPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKV-LXXXXXXXXXXXXXXXXXVTGP 208
           V    ++ I ++L+ + N F  + Y E +F+   +K+ +                   G 
Sbjct: 233 VDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHDGY 292

Query: 209 VGFRYWKNPGPW-GMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKT 267
           +G +YW NPG + G   I        F G  S  + +AF F G+E V ++A E   PRK+
Sbjct: 293 LGGKYWHNPGAFRGEKAID------HFKGVSSVFVTSAFAFGGSEFVALSASEQANPRKS 346

Query: 268 VPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPH 327
           +P A K +++RI+  Y+ S+ ++G LVP++ P+LQ +     +SP+++ I   G K++PH
Sbjct: 347 IPSAAKLILYRIIWVYLTSITILGFLVPWDSPQLQPSSDGKKTSPYVVAIAMHGVKVVPH 406

Query: 328 IFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSL 387
           + NAVIL+ ++S  NS  +  SR+L  L++   APK+F    + G P   +L +++FG +
Sbjct: 407 LINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFGVI 466

Query: 388 AYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMP 447
            +  T+      F+WLL I G++  F +  I  SHIR   A+K +G S  +L +++ +  
Sbjct: 467 CFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQVGT 526

Query: 448 WLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWFKC-R 502
           + ++YA   +V+ ++ + + + AP    K    +FF  Y++  + I+F+  + IW K  R
Sbjct: 527 YGSFYACLLLVLSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGYMIWKKDFR 586

Query: 503 LVWKLQDVDLDTDRRDIEEEVWSDDVED 530
           +  + +D+DLD  R+  +E++   + E+
Sbjct: 587 IFIRSKDIDLDFKRQVFDEDLIKQEDEE 614

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  233 bits (594), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 150/529 (28%), Positives = 258/529 (48%), Gaps = 25/529 (4%)

Query: 26  DDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYLFMGTVVF 85
           D +      +K+ +K RH+ M                              Y+    +++
Sbjct: 56  DAEDGTTAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLY 115

Query: 86  SVTQSLGEM-CTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQ 144
            + ++ GE+   +  +T ++T ++   + PA G +  ++Y   W   F L+L     IIQ
Sbjct: 116 LIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQ 175

Query: 145 FWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXXXXXXXXX 204
           +WT   P   +++I++ ++   NLF  + Y E EF+    KVL                 
Sbjct: 176 YWTDINP-DIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGA 234

Query: 205 VT-GPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQE 263
            T G +G +YW  P P+  G          F G       AAF + G E++ ++A E + 
Sbjct: 235 GTSGYIGDKYWHEPRPFMNG----------FKGLCFVFCYAAFAYGGIEVMVLSASEQEN 284

Query: 264 PRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTK 323
           PRK++  A KKV++RI++ Y+ + +++  LVP + P L S  S   +SP +I +   G K
Sbjct: 285 PRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGS--RASPLVIAVSFHGVK 342

Query: 324 ILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSM 383
           I+PHI NAVILI ++S GNS++Y   R+L  LA+   APK FT   + G P        +
Sbjct: 343 IVPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMV 402

Query: 384 FGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKA 443
           FG LA++  +   D  F WLL I G++  F W+ I  SHIRF  A+K +G S  ++ YKA
Sbjct: 403 FGLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKA 462

Query: 444 MLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWF 499
               W ++ AV    +I++ Q + + +P         +FF +Y++  + ++ +  ++I+ 
Sbjct: 463 RTGYWGSWIAVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYH 522

Query: 500 KC-RLVWKLQDVDLDTDRRDI-EEEVWSDDVE----DKNKNWWDRFWNY 542
           K  R+     +VDL + R+   E+E+  +D+E     K+   W R +++
Sbjct: 523 KDWRICIPASEVDLISHRQVFDEDELKQEDLEWKLKLKSSPIWVRIYHF 571

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  233 bits (595), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 144/508 (28%), Positives = 252/508 (49%), Gaps = 22/508 (4%)

Query: 19  PTTISTLDDDQEKQQDVKRELKKRHISMXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXYL 78
           P+  ++  + QEK  ++++ +K RH+ M                +             Y 
Sbjct: 75  PSDQNSELESQEKN-NLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYG 133

Query: 79  FMGTVVFSVTQSLGEM-CTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELS 137
               +++ + Q+ GE+   +  +T ++T ++   + P+ G A   +Y   W     L+L 
Sbjct: 134 IASIMLYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLV 193

Query: 138 VVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLXXXXXXXXXX 197
                +++WT  V    ++++V++ + I NLF  R Y E EF     K+L          
Sbjct: 194 TAAMTVKYWT-NVNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAI 252

Query: 198 XXXXXXXVTGP-VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGI 256
                       +G  YW NPGP+  G          F G  +    AAF++ G E++ +
Sbjct: 253 VINCGGAGDRRYIGTEYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLL 302

Query: 257 TAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL--QSNDSYVSSSPFI 314
           +A E + P +++P A KKVV+RIL+ Y+ + ++IG LVPYN  +L    + S   +SPF+
Sbjct: 303 SAAEQENPTESIPNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHASPFV 362

Query: 315 ITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVP 374
           I + + G K++PH  NAVILI++IS  NS++Y G R+L  LA+    PK      + G P
Sbjct: 363 IAVSSHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRP 422

Query: 375 YVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGI 434
            +  L +  FG + ++ T+   ++ FTWLL I  ++  F W+ +  SHIRF  A+ ++G 
Sbjct: 423 LLCFLVSLAFGCIGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGR 482

Query: 435 SRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISVFLFI 489
           S +++ YKA    W ++ AV   V  +V Q + + AP     K  V  FF  Y+++ + +
Sbjct: 483 SMDEVGYKAQTGYWGSWIAVLIAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVL 542

Query: 490 IFWVAFQIWFKCRLVW-KLQDVDLDTDR 516
           + +   +++FK    W   + +DLD+ R
Sbjct: 543 LAYFGHKMYFKSWRFWIPAEKIDLDSHR 570

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score =  231 bits (590), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 152/550 (27%), Positives = 266/550 (48%), Gaps = 33/550 (6%)

Query: 8   VHSFQ--VDSNDTPTT-----ISTLDDDQEKQQDV-----KRELKKRHISMXXXXXXXXX 55
           +H F+     ND+P        S L ++++ Q D+     K+ L +RH++M         
Sbjct: 30  IHRFKNSFKRNDSPAIQEGLLYSELSEEEKIQWDLANQPYKKVLDQRHLTMIAIGGTLGT 89

Query: 56  XXXXXXXRXXXXXXXXXXXXXYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPA 115
                                +L +G  +  V Q   E+    PV+ S+ + A RF+ P+
Sbjct: 90  GLFIGLGESLASGPASLLIG-FLLVGASMLCVVQCGAELSCQYPVSGSYALHASRFIDPS 148

Query: 116 FGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYG 175
            G + G  Y   W +++  EL      I +W  +V  AAW++I +VL  + NLF  R + 
Sbjct: 149 VGFSIGINYLLMWLISYPSELVGCSLTISYWAPSVNPAAWVAIAFVLSMLLNLFGARGFA 208

Query: 176 EIEFWIASVKVLXXXXXXXXXXXXXXXXX--VTGPVGFRYWKNPGPWGMGIISSNVNEAR 233
           E EF+++  K++                    TG +G +YW +PG + + +  +  N   
Sbjct: 209 ESEFYMSIFKIVALFIFIIIGIVLIAGGGPDSTGYIGTKYWHDPGSFAVPVFKNLCN--- 265

Query: 234 FFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLL 293
                 + ++AA++F GTE+V +T+ E +    +V +A K   +RI++FYI ++++IG L
Sbjct: 266 ------TFVSAAYSFSGTEMVVLTSTEARSV-SSVSRAAKGTFWRIIIFYIVTVIIIGCL 318

Query: 294 VPYNDPKLQSNDSY--VSSSPFIITIQNAGT--KILPHIFNAVILITIISAGNSNVYIGS 349
           VPYNDP+L S  S   +++SPF+I + N G     + H  NAVILI + S  NS VY  S
Sbjct: 319 VPYNDPRLISGSSSEDITASPFVIALSNTGAMGTRVSHFMNAVILIAVFSVCNSCVYASS 378

Query: 350 RILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGV 409
           R++ GLA     PK      + G P V +     FG L ++  +      FTWL  +  +
Sbjct: 379 RLIQGLATAGQLPKICAYMDRNGRPLVGMAICGAFGLLGFLVVSKNQGTVFTWLFALCSI 438

Query: 410 AGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF 469
           + F  W  I    +RF  A+K +G S++D+ Y++ L  +   +     V++++ + + S 
Sbjct: 439 SFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSTLGIYGGIFGCILNVLLVIGEIYVSA 498

Query: 470 AP---KFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSD 526
           AP       ANFF   +S+ + I  ++  +I+ +    W ++ +D+D D     E+  + 
Sbjct: 499 APVGSPSSAANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKRMDIDLDSGHSLEDFEAT 558

Query: 527 DVE-DKNKNW 535
            +E D++K +
Sbjct: 559 KLERDEDKKY 568

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.139    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,530,102
Number of extensions: 2109720
Number of successful extensions: 10521
Number of sequences better than 10.0: 418
Number of HSP's gapped: 9086
Number of HSP's successfully gapped: 436
Length of query: 544
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 429
Effective length of database: 40,294,809
Effective search space: 17286473061
Effective search space used: 17286473061
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)