Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0A005901.82ON1946194685270.0
NDAI0F042201.82ON2022120731300.0
CAGL0J08206g1.82ON1898115727070.0
Suva_14.711.82ON194882425700.0
YNL271C (BNI1)1.82ON195390825570.0
Skud_14.691.82ON194682825320.0
Smik_14.661.82ON195282925310.0
Kpol_2000.661.82ON1930109624700.0
KAFR0D039501.82ON195782023870.0
TDEL0C061901.82ON187984722700.0
ZYRO0F16676g1.82ON199487922540.0
KNAG0F004701.82ON202883021550.0
TBLA0A054401.82ON217065020220.0
TPHA0B044901.82ON194062319830.0
Kwal_33.133921.82ON196862418980.0
SAKL0C02618g1.82ON198862518910.0
AFR669W1.82ON191859518700.0
KLTH0F02376g1.82ON197662718410.0
Ecym_10861.82ON209162718180.0
KLLA0C02321g1.82ON184258117440.0
NCAS0G001205.717ON13144207942e-85
SAKL0E15224g5.717ON13354187764e-83
Kpol_416.105.717ON14914267795e-83
CAGL0H06765g5.717ON12945047665e-82
Ecym_40045.717ON14544207492e-79
AFR301C5.717ON16554367333e-77
KNAG0L022505.717ON13674237275e-77
TDEL0F055605.717ON12924227212e-76
ZYRO0B16654g5.717ON14244207232e-76
Kwal_55.196205.717ON13894197195e-76
NDAI0F001605.717ON13494287151e-75
KLLA0F10912g5.717ON12834827061e-74
AGL364Cna 1ON12604097041e-74
Ecym_5679na 1ON13064167042e-74
Smik_9.95.717ON13744327001e-73
KLTH0E00704g5.717ON13894206991e-73
Skud_9.85.717ON13744316963e-73
TPHA0E001205.717ON16424276894e-72
YIL159W (BNR1)5.717ON13754316803e-71
Suva_9.265.717ON13754226679e-70
KAFR0D021205.717ON13244176552e-68
TBLA0E018105.717ON14514256511e-67
AFR354C1.476ON121060801.8
SAKL0G10296g5.302ON59373765.2
Ecym_72354.113ON94347757.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0A00590
         (1946 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {...  3289   0.0  
NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON}          1210   0.0  
CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} simi...  1047   0.0  
Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847...   994   0.0  
YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}...   989   0.0  
Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {...   979   0.0  
Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {...   979   0.0  
Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 193...   956   0.0  
KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1....   924   0.0  
TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_...   879   0.0  
ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} som...   872   0.0  
KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON}     834   0.0  
TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa]...   783   0.0  
TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_...   768   0.0  
Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] ...   735   0.0  
SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] ...   733   0.0  
AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic...   724   0.0  
KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] ...   713   0.0  
Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON...   704   0.0  
KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] ...   676   0.0  
NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717      310   2e-85
SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa...   303   4e-83
Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] ...   304   5e-83
CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] ...   299   5e-82
Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to ...   293   2e-79
AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON} ...   286   3e-77
KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] ...   284   5e-77
TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa]...   282   2e-76
ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa...   283   2e-76
Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W...   281   5e-76
NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717     280   1e-75
KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} som...   276   1e-74
AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON} Sy...   275   1e-74
Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} simila...   275   2e-74
Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   274   1e-73
KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some si...   273   1e-73
Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   272   3e-73
TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717 ...   270   4e-72
YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,...   266   3e-71
Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (R...   261   9e-70
KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5....   256   2e-68
TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {...   255   1e-67
AFR354C Chr6 complement(1078269..1081901) [3633 bp, 1210 aa] {ON...    35   1.8  
SAKL0G10296g Chr7 (876462..878243) [1782 bp, 593 aa] {ON} simila...    34   5.2  
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    33   7.7  

>NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {ON}
            Anc_1.82
          Length = 1946

 Score = 3289 bits (8527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1663/1946 (85%), Positives = 1663/1946 (85%)

Query: 1    MMVRXXXXXXXXXXXXXXXXXXXXIFQNLRRLTNPSSNHTNKXXXXXXXXXXXXXERDST 60
            MMVR                    IFQNLRRLTNPSSNHTNK             ERDST
Sbjct: 1    MMVRNSSSKSSTSNNNSSASTGSSIFQNLRRLTNPSSNHTNKSPSGSSPRTSYSPERDST 60

Query: 61   TTRESHTNSLKPLNKKTSLNTQNLSQYINDKHSPQHTRXXXXXXXXXXXXXXXXXXXXXX 120
            TTRESHTNSLKPLNKKTSLNTQNLSQYINDKHSPQHTR                      
Sbjct: 61   TTRESHTNSLKPLNKKTSLNTQNLSQYINDKHSPQHTRSASVQSSSKYSYSRRSSSQTLG 120

Query: 121  XXXNQIARQHTNQSSASILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRN 180
               NQIARQHTNQSSASILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRN
Sbjct: 121  STLNQIARQHTNQSSASILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRN 180

Query: 181  ILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMRLKXXXXXXXXXXXXXXXXXXXXX 240
            ILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMRLK                     
Sbjct: 181  ILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMRLKTNSTNTNNNNNNNRSSMSPEN 240

Query: 241  XXXINLNSPATMQMSPXXXXXXXXXXXXXXXXTPITISKRPTGPISNPIPNADMYXXXXX 300
               INLNSPATMQMSP                TPITISKRPTGPISNPIPNADMY     
Sbjct: 241  SSTINLNSPATMQMSPHHHIGSNSNSSINSHHTPITISKRPTGPISNPIPNADMYKLSMR 300

Query: 301  XXXXXXXXXXXXXPPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMA 360
                         PPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMA
Sbjct: 301  NTSSSSMSDKTNRPPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMA 360

Query: 361  NILMKSLYKTSSDGTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFS 420
            NILMKSLYKTSSDGTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFS
Sbjct: 361  NILMKSLYKTSSDGTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFS 420

Query: 421  ITLSTRRMATEIFVCMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHLTL 480
            ITLSTRRMATEIFVCMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHLTL
Sbjct: 421  ITLSTRRMATEIFVCMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHLTL 480

Query: 481  DSQLKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSC 540
            DSQLKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSC
Sbjct: 481  DSQLKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSC 540

Query: 541  SSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNA 600
            SSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNA
Sbjct: 541  SSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNA 600

Query: 601  NINLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDS 660
            NINLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDS
Sbjct: 601  NINLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDS 660

Query: 661  LVTNVSVSSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQK 720
            LVTNVSVSSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQK
Sbjct: 661  LVTNVSVSSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQK 720

Query: 721  LKNAEHGLVGQLQDELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLT 780
            LKNAEHGLVGQLQDELAQRDRILSKNQRVM                         RKMLT
Sbjct: 721  LKNAEHGLVGQLQDELAQRDRILSKNQRVMEQLQGELEELKKKHLLEKHEQEVELRKMLT 780

Query: 781  ILNARPEIVEGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTI 840
            ILNARPEIVEGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTI
Sbjct: 781  ILNARPEIVEGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTI 840

Query: 841  QPNKRLKLLRMQMEDIENEARELEMTNFTEYEKRXXXXXXXXXXXXXXXXXXXXDPSINK 900
            QPNKRLKLLRMQMEDIENEARELEMTNFTEYEKR                    DPSINK
Sbjct: 841  QPNKRLKLLRMQMEDIENEARELEMTNFTEYEKRKLEAPSKIKKPKKVATKKEIDPSINK 900

Query: 901  LNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNIDE 960
            LNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNIDE
Sbjct: 901  LNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNIDE 960

Query: 961  LVDSASKDENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNLXXXXX 1020
            LVDSASKDENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNL     
Sbjct: 961  LVDSASKDENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNLSSRRP 1020

Query: 1021 XXXXXXXXXXXXXXXXXXXXLIERQDTQSNFSGTSAGPGSFLEALTQKYATGQKSASPRD 1080
                                LIERQDTQSNFSGTSAGPGSFLEALTQKYATGQKSASPRD
Sbjct: 1021 SASSSSESASSSSDSDDGESLIERQDTQSNFSGTSAGPGSFLEALTQKYATGQKSASPRD 1080

Query: 1081 QSTRMKDNIFINRIKQTNVAPPFLDELTDKVAEAPPVEASLAEPDNNNTINESSKEETGE 1140
            QSTRMKDNIFINRIKQTNVAPPFLDELTDKVAEAPPVEASLAEPDNNNTINESSKEETGE
Sbjct: 1081 QSTRMKDNIFINRIKQTNVAPPFLDELTDKVAEAPPVEASLAEPDNNNTINESSKEETGE 1140

Query: 1141 ANLTSSDNEVVAQASLSNPEVSPKHDNNSVKDVNESDDKAEVSAKDTSADSQXXXXXXXX 1200
            ANLTSSDNEVVAQASLSNPEVSPKHDNNSVKDVNESDDKAEVSAKDTSADSQ        
Sbjct: 1141 ANLTSSDNEVVAQASLSNPEVSPKHDNNSVKDVNESDDKAEVSAKDTSADSQPPPPPPPP 1200

Query: 1201 XXDFFTNEQKNSSSETSIPLPSPPLPEKLFENAGAHPLKHLRQXXXXXXXXXXXXXXXXX 1260
              DFFTNEQKNSSSETSIPLPSPPLPEKLFENAGAHPLKHLRQ                 
Sbjct: 1201 LPDFFTNEQKNSSSETSIPLPSPPLPEKLFENAGAHPLKHLRQSASSPALNSALPPPPPP 1260

Query: 1261 XXXXXXXTDGPRKKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAE 1320
                   TDGPRKKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAE
Sbjct: 1261 PPPPPLPTDGPRKKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAE 1320

Query: 1321 KFADDLYEKGVLTDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLP 1380
            KFADDLYEKGVLTDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLP
Sbjct: 1321 KFADDLYEKGVLTDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLP 1380

Query: 1381 VDDVVKKILKCDRDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAP 1440
            VDDVVKKILKCDRDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAP
Sbjct: 1381 VDDVVKKILKCDRDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAP 1440

Query: 1441 EKDPNELQRADQLYLQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQ 1500
            EKDPNELQRADQLYLQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQ
Sbjct: 1441 EKDPNELQRADQLYLQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQ 1500

Query: 1501 ESENLKNVFNVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSN 1560
            ESENLKNVFNVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSN
Sbjct: 1501 ESENLKNVFNVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSN 1560

Query: 1561 YPSFNDFLTELEPVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRV 1620
            YPSFNDFLTELEPVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRV
Sbjct: 1561 YPSFNDFLTELEPVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRV 1620

Query: 1621 LAKVLPILPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEY 1680
            LAKVLPILPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSE               ITEY
Sbjct: 1621 LAKVLPILPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSEDKFAKNSFFKKFADFITEY 1680

Query: 1681 KKAQNQNIKAEEEEQVYERHKKMVEDQQKKLQEQXXXXXXXXXXXXXXXXXXXXRRAMMD 1740
            KKAQNQNIKAEEEEQVYERHKKMVEDQQKKLQEQ                    RRAMMD
Sbjct: 1681 KKAQNQNIKAEEEEQVYERHKKMVEDQQKKLQEQENGSNGSENGEEGSGDDSGDRRAMMD 1740

Query: 1741 KLLDQLKNAGPSKTDPSSARKRALVRKKLMTESTALLKDIETEDDSIIYSPEGKNPFVNP 1800
            KLLDQLKNAGPSKTDPSSARKRALVRKKLMTESTALLKDIETEDDSIIYSPEGKNPFVNP
Sbjct: 1741 KLLDQLKNAGPSKTDPSSARKRALVRKKLMTESTALLKDIETEDDSIIYSPEGKNPFVNP 1800

Query: 1801 VDLDTPHDESEMDVXXXXXXXXXXXXXNSTLLSDDQDEVTDRAKALLMELRGSNTPSKRN 1860
            VDLDTPHDESEMDV             NSTLLSDDQDEVTDRAKALLMELRGSNTPSKRN
Sbjct: 1801 VDLDTPHDESEMDVSSSPIQRSLSPSRNSTLLSDDQDEVTDRAKALLMELRGSNTPSKRN 1860

Query: 1861 SLLDEHKEKLRARRRKTNSDLHSGTRLQFVGETVPEKEVEPITGEPDGXXXXXXXXXXXX 1920
            SLLDEHKEKLRARRRKTNSDLHSGTRLQFVGETVPEKEVEPITGEPDG            
Sbjct: 1861 SLLDEHKEKLRARRRKTNSDLHSGTRLQFVGETVPEKEVEPITGEPDGTSTELEETSNLS 1920

Query: 1921 XXXQQKVDVESIEDEKADEPHTADST 1946
               QQKVDVESIEDEKADEPHTADST
Sbjct: 1921 SENQQKVDVESIEDEKADEPHTADST 1946

>NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON} 
          Length = 2022

 Score = 1210 bits (3130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 663/1207 (54%), Positives = 808/1207 (66%), Gaps = 50/1207 (4%)

Query: 25   IFQNLRRL-TNPSSNHTNKXXXXXXXXXXXXXERDS----TTTRESHTNSLKPLNKKTSL 79
            +FQNL+R  TN + +  N              +R+S    +T+    +N +KPL K T+L
Sbjct: 28   LFQNLKRFATNSTGSSNNTSPRTSNSSEPSQVKRESIPQGSTSSLHSSNEIKPLIKNTTL 87

Query: 80   NTQNLSQYINDKHSPQHTRXXXXXXXXXXXXXXXXXXXXXXXXXN--QIARQHTNQSSA- 136
            NTQNLSQYIN K+ P H+R                            ++ RQ+TNQSSA 
Sbjct: 88   NTQNLSQYINSKNIPDHSRSQSIQSSSKYSYSSRRASSQTNPSVTGYKLDRQYTNQSSAV 147

Query: 137  SILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRNILQSLPTDKQNELMSY 196
            S+LSQGS++NLSKF+  DGK+NLEMP DP+E+E L+++IM+KRNILQSLP  KQ+ELMSY
Sbjct: 148  SVLSQGSYSNLSKFMTHDGKLNLEMPTDPSEIEYLYQEIMIKRNILQSLPGTKQDELMSY 207

Query: 197  DLEKKWLIVKQDLQNEMKKMRLKXXXXXXXXXXXXXXXXXXXXXXXXINLNSPATMQ--M 254
            D+ KKWLIVKQDLQNE KK + K                        I L SP+     +
Sbjct: 208  DIGKKWLIVKQDLQNEWKKFKSKGAKASHSIGPDNNNNNNNNYNNHLI-LGSPSKSNNMI 266

Query: 255  SPXXXXXXXXXXXXXXXXTPITI-----------SKRPTGPISNPIPNADMYXXXXXXXX 303
            SP                +  T            SKR    IS P    ++Y        
Sbjct: 267  SPKSNLNNFESPSSSLSASTQTTTNNYKQYNNKPSKRSASNISQPKSTTEVYSNSHSNSS 326

Query: 304  XXXXXXXXXXPPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANIL 363
                       PI YVK+II+DT+TSEEMKDLWVTLRTEQ+DWVDAFIEHQGHIAMAN+L
Sbjct: 327  NTTLTDKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVL 386

Query: 364  MKSLYKTSSDGTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSITL 423
            MKS+YKT+ +     QLLEKEN+FFKCFRVLSMLSQGLREFT+HE+M+QT+ARGLFS TL
Sbjct: 387  MKSIYKTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTL 446

Query: 424  STRRMATEIFVCMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHLTLDSQ 483
            STR+MATEIFVCML KKNPERFKVILN LDQKFKIG N HM  N+K F +YF  LTLDS 
Sbjct: 447  STRKMATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSN 506

Query: 484  LKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCSSN 543
            LKVT+AWLFAVEH+LDGRGKMGS VGASDD+KNSGGENA LEYCQWSMIFINHLC CS N
Sbjct: 507  LKVTRAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDN 566

Query: 544  INQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNANIN 603
            INQRMLLR KLE CGI+RIMN++K+L Y+KVIEQID+YEN+KLDD+N LLE +NKNANIN
Sbjct: 567  INQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANIN 626

Query: 604  LQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDSLVT 663
            L DPTS+++NLWDACKGTENEKLLISL+QHLFLSSSQ IE+K+D  +LS+QLKL+DSLVT
Sbjct: 627  LHDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLVT 686

Query: 664  NVSVSSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKLKN 723
            NVSV+STDQE++MNMAIQRLYDAMQTDEVARRSILESRTLTKKLEE QAE DLLSQKLKN
Sbjct: 687  NVSVASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKN 746

Query: 724  AEHGLVGQLQDELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLTILN 783
            AEHGLVGQLQDEL QRDR+ +KNQR+                          RKMLTILN
Sbjct: 747  AEHGLVGQLQDELRQRDRMFAKNQRITEQLQAELEDLKKKHLLEKHEQEVELRKMLTILN 806

Query: 784  ARPEIVEGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTIQPN 843
            AR +  E    S K   + P + + SKKQ+IQ+ LQ+GL+RTKKD+++D+++FGMT+QPN
Sbjct: 807  ARSDKGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDSKSFGMTVQPN 866

Query: 844  KRLKLLRMQMEDIENEARELEMTNFTEYEKRXXX----XXXXXXXXXXXXXXXXXDPSIN 899
            KRLK LRMQMEDIENEARELEMTNF E+EK+                        D  I 
Sbjct: 867  KRLKALRMQMEDIENEARELEMTNFAEFEKKKLEPAPKIKKLKQKKQNKNEKKEEDDKIK 926

Query: 900  KLNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNID 959
            KLN+LRQTLA IQ ESNDISKFNV+ERVNELFN+KR TAL+RL++LETKYKDFGI+FNID
Sbjct: 927  KLNELRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETKYKDFGINFNID 986

Query: 960  ELVDSASKDENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNLXXXX 1019
            ++ +  +  +N  + +S +YSSLDP AYQ KLDELNR+T++LL  + K+N  + NL    
Sbjct: 987  DISEKTTGIDNSGD-KSTEYSSLDPNAYQIKLDELNRITEQLLDAQAKLN--EKNLKDSS 1043

Query: 1020 XXXXXXXXXXXXXXXXXXXXXL----------IERQDTQSNFSG--TSAGPGSFLEALTQ 1067
                                            I+ +D QS  S   TS+  GSFLEAL+Q
Sbjct: 1044 NKSTFSESSSSSSSSSSSSSSSSSSDEEEIDDIKSRDRQSEISAQSTSSAAGSFLEALSQ 1103

Query: 1068 KYATGQKS-ASP-RDQSTRMKDNIFINRIKQTNVAPPFLDELTDKVAEAPPVEASLAEPD 1125
            KYA GQ + +SP RD+  +     FINR+++ N+ P FL+EL+ KV    P  + L+   
Sbjct: 1104 KYAMGQNNPSSPQRDRPVKASQYDFINRVRKNNITPQFLEELSGKVV---PPSSGLSTTT 1160

Query: 1126 NNNTINESSKEETGEANLTSSDNEVVAQASLSNPEVS----PKHDNNSVKDVNESDDKAE 1181
                +    K ET   N+  +  E V + S  N  +S     + +N++V    E  +K  
Sbjct: 1161 KVVDVTSGGKSETATENVLENTTEPVTEHSFRNAVLSNDKIDREENDTVISTTEPTEKIG 1220

Query: 1182 VSAKDTS 1188
             +A++ S
Sbjct: 1221 FNAEEKS 1227

 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/629 (72%), Positives = 526/629 (83%), Gaps = 6/629 (0%)

Query: 1268 TDGPRKKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLY 1327
            T+GP KKV++SPLLPQS SLFENYPRP KKLKQLHWEK++ATDNSIW+ NKAE+FADDLY
Sbjct: 1327 TNGP-KKVLSSPLLPQSPSLFENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLY 1385

Query: 1328 EKGVLTDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKK 1387
            EKGVL++LE AFAAREIKSLASK+K+DL KI+FLS D+SQQFGINLHMYA+L V D++ K
Sbjct: 1386 EKGVLSELENAFAAREIKSLASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITK 1445

Query: 1388 ILKCDRDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNEL 1447
            ILKCDRDFL TPSVIEFLS+PEIV+VSVNLARNYAPY  DWEG+K+VEDAK PEK+PNEL
Sbjct: 1446 ILKCDRDFLQTPSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNEL 1505

Query: 1448 QRADQLYLQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKN 1507
            QRADQ+YLQL++NLQSYWGSRMRAL VITTF+KEYNELLTKLRKVD+AVSSLQESENLKN
Sbjct: 1506 QRADQIYLQLMVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKN 1565

Query: 1508 VFNVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDF 1567
            VF VILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTN+MTFLNYVEKIVR+NYP+FN F
Sbjct: 1566 VFGVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKF 1625

Query: 1568 LTELEPVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPI 1627
            L ELEPVLDVVKISIEQLV DCKEFSQSIVNVERS+E GNLSDSSKFHP DRVLAKVLP 
Sbjct: 1626 LVELEPVLDVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPS 1685

Query: 1628 LPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQN 1687
            LPDARKKGELLGDEVKLTIMEFLRLMQIYGEDS                ITEYKKAQ QN
Sbjct: 1686 LPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSGDKFAKNSFFKKFADFITEYKKAQTQN 1745

Query: 1688 IKAEEEEQVYERHKKMVEDQQKKLQE-QXXXXXXXXXXXXXXXXXXXXRRAMMDKLLDQL 1746
            ++ EEEE+VYERHKKMVE+QQ+K QE +                     RA+MD LL+QL
Sbjct: 1746 LRLEEEEKVYERHKKMVEEQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQL 1805

Query: 1747 KNAGPS-KTDPSSARKRALVRKKLMTESTA-LLKDIETEDDSIIYSPEGKNPFVNPVDLD 1804
            KN  P+ KTDPSSARKRALVRKKLM EST+ +LKDI+TEDDSIIYSP+ K P    VD+ 
Sbjct: 1806 KNVTPTNKTDPSSARKRALVRKKLMGESTSNILKDIDTEDDSIIYSPDAKKPMATTVDMA 1865

Query: 1805 TPHDESEMDVXXXXXXXXXXXXXNSTL-LSDDQDEVTDRAKALLMELRGSNTPSKRNSLL 1863
                ESE+DV               ++ + ++++E+ +RA+ALL++L GS++P+KR+SLL
Sbjct: 1866 NTTLESELDVSSPTRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTKRHSLL 1925

Query: 1864 DEHKEKLRARRRKTNSDLHSGTRLQFVGE 1892
            +EHKE+LRARRR+T ++  SG +LQFVGE
Sbjct: 1926 NEHKERLRARRRRTTNEFVSG-KLQFVGE 1953

>CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} similar
            to uniprot|P41832 Saccharomyces cerevisiae YNL271c BNI1
            regulator of budding
          Length = 1898

 Score = 1047 bits (2707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/1157 (49%), Positives = 746/1157 (64%), Gaps = 53/1157 (4%)

Query: 25   IFQNLRRLTNPSSNHTNKXXXXXXXXXXXXXERD--------STTTRESHTNSLKPLNKK 76
            +FQNLRRLT    ++ NK             +R         + ++R    +  +PLNKK
Sbjct: 21   LFQNLRRLTTKDRDNRNKSPKRTSLDNDNISQRSTKNINVSQAVSSRHGSIDQSRPLNKK 80

Query: 77   TSLNTQNLSQYINDKH--SPQ----HTRXXXXXXXXXXXXXXXXXXXXXXXXXN----QI 126
            ++LN+QNLSQY+N+    SP+    H R                         +     +
Sbjct: 81   STLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSGQVSMAPSSMGNINL 140

Query: 127  ARQHTNQS--SASILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRNILQS 184
             R +TN S  SAS+LS GS TNLS+F+ PDGKINL MP DP EVE LFEDIM KRNILQS
Sbjct: 141  TRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYKRNILQS 200

Query: 185  LPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMRLKXXXXXXXXXXXXXXXXXXXXXXXXI 244
            LP +KQNELMSY +EKKWLIVKQDLQNE K  R+K                         
Sbjct: 201  LPQEKQNELMSYSIEKKWLIVKQDLQNEFK--RIKASNKGDSRTGMSMPDLGSDPS---- 254

Query: 245  NLNSPATMQMSPXXXXXXXXXXXXXXXXTPITISKRPTGPISNPIP--NADMYXXXXXXX 302
              NS +                      +  + S +   PIS PI   + ++Y       
Sbjct: 255  --NSVSPPGPISSSGSSIFSSDVTSTAPSTYSRSGKKNIPISKPIAATSTELYHIAERNT 312

Query: 303  XXXXXXX-XXXXPPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMAN 361
                        PPIHYVK+I+ D ++ +EMKDLWVTLRTEQ+DWVDAF+E+QGHIAMAN
Sbjct: 313  SSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFLENQGHIAMAN 372

Query: 362  ILMKSLYKTSSDGTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSI 421
            ILMKS+YKT+     +  LL+KENAFFKCFRVL++LSQGL EFT H +M+ T+A+GLFS 
Sbjct: 373  ILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSLMTDTIAQGLFSG 432

Query: 422  TLSTRRMATEIFVCMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHLTLD 481
             L+TR+MATEIFV +LEKKN +RF+ +L++LD+ F IG N+HM ++ K  P YFTHLT +
Sbjct: 433  RLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHMNESYKKLPQYFTHLTSN 492

Query: 482  SQLKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCS 541
            S LKV QAWLFAVE TLDGRGKMGSLVGAS+D+KN+GGENAILEYCQW+M+FINHLCS S
Sbjct: 493  SNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINHLCSSS 552

Query: 542  SNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNAN 601
             NINQR LLR KLENCGILRIMNK+K LDY+KVI+QI+LYENNKLDD N LLESN KN N
Sbjct: 553  ENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNALLESNKKNIN 612

Query: 602  INLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDSL 661
            ++LQDP S+++NL DACKGTENEK L+SL+QH+FL +S+ ++EK+DP K+++QLKL+DSL
Sbjct: 613  VDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMDSL 672

Query: 662  VTNVSVSSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKL 721
            VTNVSV+ST++ +++NMAIQRLYD+MQTDEVARR+ILESRTLTKKLEE++AERD+L +KL
Sbjct: 673  VTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVEKL 732

Query: 722  KNAEHGLVGQLQDELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLTI 781
              AEHGLVGQL+ E+ +RDRIL+KNQRVM                         RKMLTI
Sbjct: 733  SKAEHGLVGQLEMEVKERDRILAKNQRVMKQLESELEELKKKHLLEKHEQEVELRKMLTI 792

Query: 782  LNARPEIVEGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTIQ 841
            LN+RP          K + K   +++ S+K+ +Q+ALQ GL + KKD+  D++ FGMTIQ
Sbjct: 793  LNSRP-------AKTKEQKKKIGSIEASEKEDLQRALQSGLQKAKKDFKDDSKKFGMTIQ 845

Query: 842  PNKRLKLLRMQMEDIENEARELEMTNFTEYEKRXXXXXXXXXXXXXXXXXXXXDPSINKL 901
            PN+RLK+LRMQME IENEAR+LEMTNF EYEK+                    +  I KL
Sbjct: 846  PNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPANVQKKSKPISELNKEQRIQKL 905

Query: 902  NDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNIDEL 961
            N+LR  L  IQMESND+SKFNVDERVNELFN K+ TAL+RL++LETKYK FGIDF +++ 
Sbjct: 906  NELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTALQRLKELETKYKGFGIDFKVEDF 965

Query: 962  VDSASKDENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNLXXXXXX 1021
               ++   N        YSSLDPK YQ KLDE+ ++++ELL+ KN++  +  +       
Sbjct: 966  THESTDSSNEG------YSSLDPKVYQDKLDEITKISEELLQQKNELETTQTSSSESNSD 1019

Query: 1022 XXXXXXXXXXXXXXXXXXXLIERQDTQSNFSGTSAGPGSFLEALTQKYATGQKS--ASPR 1079
                                I    T SN S  ++  GSFL+ LTQKY TGQ     SP 
Sbjct: 1020 SESSSDSDDSMEDALTNNKDI--NGTSSNVSDLAS--GSFLDTLTQKYGTGQAEPIQSPV 1075

Query: 1080 DQSTRMKDNIFINRIKQTNVAPPFLDELTDKVAEAPPVEASLAEPDNNNTINESSKEETG 1139
               +   +  F++R+K+ +  P +++EL+ K+      E    E D++   N+SS +   
Sbjct: 1076 GHYSNRNEKSFVDRMKRNSRVPSYVEELSKKMRGNKDHE---FEEDDHKNGNQSSDDFDS 1132

Query: 1140 EANLTSSDNEVVAQASL 1156
            E+      ++++A +++
Sbjct: 1133 ESKTNMDQDQLLATSAV 1149

>Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847 bp,
            1948 aa] {ON} YNL271C (REAL)
          Length = 1948

 Score =  994 bits (2570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/824 (62%), Positives = 611/824 (74%), Gaps = 29/824 (3%)

Query: 314  PPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSSD 373
            PPIHYV+RI+AD +T++EMKDLWVTLRTEQ+DWVDAFI+HQGHIAMAN+LM S+YKT+  
Sbjct: 340  PPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPR 399

Query: 374  GTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSITLSTRRMATEIF 433
                 +LLEKEN+FFKCFRVLSMLSQGL EF+ H +M+ TVA GLFS  L TR+MATEIF
Sbjct: 400  EHLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLVTRKMATEIF 459

Query: 434  VCMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHLTLDSQLKVTQAWLFA 493
            VCMLEKKN  RF+ +L ALD+KF+IG N HM QN K  P YF+HLTL+S LK+ QAWLFA
Sbjct: 460  VCMLEKKNKNRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFA 519

Query: 494  VEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCSSNINQRMLLRTK 553
            VE TLDGRGKMGSLVGASD+FKN GGENAILEYCQW+M+FINHLCSCS N+NQRMLLRTK
Sbjct: 520  VEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNVNQRMLLRTK 579

Query: 554  LENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNANINLQDPTSMLRN 613
            LENCGILRIMNK+K LDYDKVI+QI+LY+NNKLDD N  LE++NK  N++L+DP S+L+N
Sbjct: 580  LENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEASNKAFNVDLKDPLSLLKN 639

Query: 614  LWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDSLVTNVSVSST-DQ 672
            LW+ CKGT+NEKLL+SL+QHLFLSSS+ IEE ++P KLS+QLKL+DSLVTNVSV+ST D+
Sbjct: 640  LWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSKLSKQLKLMDSLVTNVSVASTADE 699

Query: 673  EASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKLKNAEHGLVGQL 732
            E++MNMAIQRLYDAMQTDEVARR+ILESRTLTKKLEE+QAERD LS+KL  AEHGLVGQL
Sbjct: 700  ESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAERDSLSEKLGKAEHGLVGQL 759

Query: 733  QDELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLTILNARPEIVEGN 792
            ++EL  RDRIL+KNQRVM                         RKMLTILN+RPE  E +
Sbjct: 760  ENELHGRDRILAKNQRVMQQLESELEELKKKHLLEKHQQEVELRKMLTILNSRPE--ESS 817

Query: 793  GTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTIQPNKRLKLLRMQ 852
              SK TK  NPS L+ S+K +IQ+ LQDGLSR KKDY  D++ FGMT+QPNKRLK+LRMQ
Sbjct: 818  DLSKGTKDINPS-LNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQ 876

Query: 853  MEDIENEARELEMTNFTEYEKRXXXXXXXXXXXXXXXXXXXXDPS--------INKLNDL 904
            ME+IENEAR+LEMTNF E+EK                       S        +NKLNDL
Sbjct: 877  MENIENEARQLEMTNFAEFEKERLEPPIEIKKPKIKHKKHKIKKSSVKTQGADMNKLNDL 936

Query: 905  RQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNIDELVDS 964
            R+ LAEIQMESNDISKFNV+ERVNELFN+K+  ALKRL++LETKYK FGIDFN++E +++
Sbjct: 937  RRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEEFIET 996

Query: 965  ASK---DENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNLXXXXXX 1021
              K   DE    +    Y SLDPKAYQ KLDE+NR+TDELL ++ +V             
Sbjct: 997  PKKFSVDE----ENDAAYPSLDPKAYQSKLDEINRITDELLDLQTQVKQETEEDEDEETK 1052

Query: 1022 XXXXXXXXXXXXXXXXXXXLIERQDTQSNFSGTSAGPGSFLEALTQKYATGQ---KSASP 1078
                                 ER+   S  S  S GPGSFL+AL+QKY TGQ    SA  
Sbjct: 1053 SSSSSSDADDDEIYQDASPSQERRGEYSELSAGS-GPGSFLDALSQKYGTGQNVTASAGL 1111

Query: 1079 RDQ--STRMKDNI---FINRI-KQTNVAPPFLDELTDKVAEAPP 1116
            RD   S  M  N+   FINR+ K T  + P+L+ELT KV +  P
Sbjct: 1112 RDNRGSGHMPSNVEKSFINRLRKSTASSAPYLEELTQKVNKVEP 1155

 Score =  863 bits (2230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/623 (67%), Positives = 500/623 (80%), Gaps = 11/623 (1%)

Query: 1273 KKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVL 1332
            K  + SPLLPQS SLFE YPRP KKLKQLHWEK+D+TDNSIW + KAEKFADDLYEKGVL
Sbjct: 1330 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVL 1389

Query: 1333 TDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCD 1392
             DLEKAFAAREIKSLA+K+KEDL K++FLSRDISQQFGINLHMY++L V D+VKKILKCD
Sbjct: 1390 ADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCD 1449

Query: 1393 RDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQ 1452
            RDFL TPSV+EFLSKPEI EVSVNLARNYAPYSTDWEG++ +EDAK PEKDPN+LQRADQ
Sbjct: 1450 RDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQ 1509

Query: 1453 LYLQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVI 1512
            +YLQL++NL+ YWGSRMRALTV+T+++KEYNELL KLRKVD+AV +LQES+NL+NVFNVI
Sbjct: 1510 IYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVI 1569

Query: 1513 LAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELE 1572
            LAVGN+MNDTSKQAQGFKL+TLQRLTFIKD+ NSMTFLNYVEKI+R NYPSFNDFL ELE
Sbjct: 1570 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELE 1629

Query: 1573 PVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDAR 1632
            PVLDVVK+SIEQLV+DCK+FSQSIVNVERSVE GNLSDSSKFHP D+VL K LP+LP+AR
Sbjct: 1630 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1689

Query: 1633 KKGELLGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEE 1692
            +KG+LL DEVKLTIMEF  LMQ YGEDS                + EYK+AQ+QN+ AEE
Sbjct: 1690 RKGDLLEDEVKLTIMEFESLMQTYGEDSGDKFAKISFFKKFADFVNEYKRAQSQNLAAEE 1749

Query: 1693 EEQVYERHKKMVEDQQKKLQEQXXXXXXXXXXXXXXXXXXXXRRAMMDKLLDQLKNAGPS 1752
            EE++YE+HKKMVE+QQK+ Q++                    RRA+MDKLL+QLKNAGP+
Sbjct: 1750 EERLYEKHKKMVEEQQKRAQDKEKHREHSALPEGNEEEETEDRRAVMDKLLEQLKNAGPA 1809

Query: 1753 KTDPSSARKRALVRKKLMTE---STALLKDIETEDDSIIYSPEGKNPFVNPVDLDTP-HD 1808
            K+DPSSARKRALVRKK +++   S  +L D+  E+ SI+YSPE   P     D DT  H 
Sbjct: 1810 KSDPSSARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTP-----DTDTVIHA 1864

Query: 1809 ESEMDVXXXXXXXXXXXXXNSTLLS--DDQDEVTDRAKALLMELRGSNTPSKRNSLLDEH 1866
            ES   +             + +  S  +DQ+E+TDRA+ LL ELRGS+ P K+NS+LDEH
Sbjct: 1865 ESPTPLATRGFMNTPEDLPSPSKASALEDQEEITDRARMLLKELRGSDAPVKQNSILDEH 1924

Query: 1867 KEKLRARRRKTNSDLHSGTRLQF 1889
             EKLRAR+ + N + ++G +L F
Sbjct: 1925 LEKLRARKERANGETNTGNKLSF 1947

 Score =  168 bits (425), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 100/155 (64%), Gaps = 2/155 (1%)

Query: 65  SHTNSLKPLNKKTSLNTQNLSQYINDKHSPQHTRXXXXXXXXXXXXXXXXXXXXXXXXXN 124
           S +   +PLNKK +LNTQNLSQY+N K S                              N
Sbjct: 77  STSTEARPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQSKYSYSKRTSSQASN 136

Query: 125 QIARQHTNQS--SASILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRNIL 182
           ++ RQHT QS  + S+LS GS TNLSKF  PDGKI+LEMP DP EVEVLFEDIM KRNI 
Sbjct: 137 KLTRQHTGQSHSATSLLSLGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIF 196

Query: 183 QSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMR 217
           QSL  DKQ ELMSY  EKKWLIVKQDLQNE+KK+R
Sbjct: 197 QSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKIR 231

>YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}
            BNI1Formin, nucleates the formation of linear actin
            filaments, involved in cell processes such as budding and
            mitotic spindle orientation which require the formation
            of polarized actin cables, functionally redundant with
            BNR1
          Length = 1953

 Score =  989 bits (2557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/908 (57%), Positives = 646/908 (71%), Gaps = 35/908 (3%)

Query: 314  PPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSSD 373
            PPIHYV+RI+AD +TS+EMKDLWVTLRTEQ+DWVDAFI+HQGHIAMAN+LM S+YKT+  
Sbjct: 337  PPIHYVQRILADKLTSDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPR 396

Query: 374  GTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSITLSTRRMATEIF 433
                 +LLEKEN+FFKCFRVLSMLSQGL EF+ H +M+ TVA GLFS  L+TR+MATEIF
Sbjct: 397  ENLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLATRKMATEIF 456

Query: 434  VCMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHLTLDSQLKVTQAWLFA 493
            VCMLEKKN  RF+ +L +LD+KF+IG N HM QN K  P YF+HLTL+S LK+ QAWLFA
Sbjct: 457  VCMLEKKNKSRFEAVLTSLDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFA 516

Query: 494  VEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCSSNINQRMLLRTK 553
            VE TLDGRGKMGSLVGASD+FKN GGENAILEYCQW+M+FINHLCSCS NINQRMLLRTK
Sbjct: 517  VEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTK 576

Query: 554  LENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNANINLQDPTSMLRN 613
            LENCGILRIMNK+K LDYDKVI+QI+LY+NNKLDD N  LE+NNK  N++L DP S+L+N
Sbjct: 577  LENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEANNKAFNVDLHDPLSLLKN 636

Query: 614  LWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDSLVTNVSVSST-DQ 672
            LWD CKGTENEKLL+SL+QHLFLSSS+ IEE ++  KL++QLKL+DSLVTNVSV+ST D+
Sbjct: 637  LWDICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMDSLVTNVSVASTSDE 696

Query: 673  EASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKLKNAEHGLVGQL 732
            E +MNMAIQRLYDAMQTDEVARR+ILESR LTKKLEE+QAERD LS+KL  AEHGLVGQL
Sbjct: 697  ETNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQL 756

Query: 733  QDELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLTILNARPEIVEGN 792
            +DEL +RDRIL+KNQRVM                         RKMLTILN+RPE  E  
Sbjct: 757  EDELHERDRILAKNQRVMQQLEAELEELKKKHLLEKHQQEVELRKMLTILNSRPE--ESF 814

Query: 793  GTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTIQPNKRLKLLRMQ 852
              ++ T+  N S+L+ S+K +IQ+ LQDGLSR KKDY  D++ FGMT+QPNKRLK+LRMQ
Sbjct: 815  NKNEGTRGMN-SSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQ 873

Query: 853  MEDIENEARELEMTNFTEYEK-RXXXXXXXXXXXXXXXXXXXXDP-------SINKLNDL 904
            ME+IENEAR+LEMTNF E+EK R                     P        +NKLNDL
Sbjct: 874  MENIENEARQLEMTNFAEFEKDRLEPPIHIKKPKVKKMKNKDRKPLVKPQEADVNKLNDL 933

Query: 905  RQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNIDELVDS 964
            R+ LAEIQMESNDISKFNV+ERVNELFN+K+  ALKRL++LETKYK FGIDFN+DE++DS
Sbjct: 934  RRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVDEIMDS 993

Query: 965  ASKDENG-NNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNLXXXXXXXX 1023
              K+      ++  +Y+SLDPK YQ+KLDE+NR+TD+LL ++ +   +++ +        
Sbjct: 994  PKKNTGDVETEEDANYASLDPKTYQKKLDEINRITDQLLDIQTQ---TEHEIQVEEDGES 1050

Query: 1024 XXXXXXXXXXXXXXXXXLIERQDTQSNFS--GTSAGPGSFLEALTQKYATGQK-SASPRD 1080
                                 Q+ +S  S   + +GPGSFL+AL+QKY TGQ  +AS   
Sbjct: 1051 DLSSSSSDDESEEIYQDASPTQELRSEHSELSSGSGPGSFLDALSQKYGTGQNVTASAAF 1110

Query: 1081 QSTRMKDNI----------FINRIKQTNV-APPFLDELTDKVAEAPPVEASLAEPDNNNT 1129
                    I          F+NR++++ V + P+L+ELT KV +  P E +  E  +  +
Sbjct: 1111 GENNNGSGIGPLHSKVEKTFMNRLRKSTVSSAPYLEELTQKVNKVEPYEQNEDEGLDKKS 1170

Query: 1130 INESSKEETGEANLTSSDN-----EVVAQASLSNPEVSPKHDNNSVKDVNESDDKAEVSA 1184
            + E+S      A   +  +     E   Q  + N E     D ++V  +N +D   ++S 
Sbjct: 1171 LPENSTASAASAFDKAEKDMRQHVENGKQGRVVNHEEDKTADFSAVSKLNNTDGAEDLST 1230

Query: 1185 KDTSADSQ 1192
            + +   SQ
Sbjct: 1231 QSSVLSSQ 1238

 Score =  868 bits (2244), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/624 (68%), Positives = 502/624 (80%), Gaps = 11/624 (1%)

Query: 1273 KKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVL 1332
            K  + SPLLPQS SLFE YPRP KKLKQLHWEKLD TDNSIW T KAEKFADDLYEKGVL
Sbjct: 1333 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDCTDNSIWGTGKAEKFADDLYEKGVL 1392

Query: 1333 TDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCD 1392
             DLEKAFAAREIKSLASK+KEDL KI+FLSRDISQQFGINLHMY++L V D+VKKIL CD
Sbjct: 1393 ADLEKAFAAREIKSLASKRKEDLQKITFLSRDISQQFGINLHMYSSLSVADLVKKILNCD 1452

Query: 1393 RDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQ 1452
            RDFL TPSV+EFLSK EI+EVSVNLARNYAPYSTDWEGV+++EDAK PEKDPN+LQRADQ
Sbjct: 1453 RDFLQTPSVVEFLSKSEIIEVSVNLARNYAPYSTDWEGVRNLEDAKPPEKDPNDLQRADQ 1512

Query: 1453 LYLQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVI 1512
            +YLQL++NL+SYWGSRMRALTV+T++++EYNELL KLRKVDKAVS+LQES+NL+NVFNVI
Sbjct: 1513 IYLQLMVNLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVSALQESDNLRNVFNVI 1572

Query: 1513 LAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELE 1572
            LAVGN+MNDTSKQAQGFKL+TLQRLTFIKD+TNSMTFLNYVEKIVR NYPSFNDFL+ELE
Sbjct: 1573 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIVRLNYPSFNDFLSELE 1632

Query: 1573 PVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDAR 1632
            PVLDVVK+SIEQLV+DCK+FSQSIVNVERSVE GNLSDSSKFHP D+VL K LP+LP+AR
Sbjct: 1633 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1692

Query: 1633 KKGELLGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEE 1692
            KKG+LL DEVKLTIMEF  LM  YGEDS                I EYKKAQ QN+ AEE
Sbjct: 1693 KKGDLLEDEVKLTIMEFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAAEE 1752

Query: 1693 EEQVYERHKKMVEDQQKKLQEQXXXXXXXX--XXXXXXXXXXXXRRAMMDKLLDQLKNAG 1750
            EE++Y +HKK+VE+QQK+ QE+                      RRA+MDKLL+QLKNAG
Sbjct: 1753 EERLYIKHKKIVEEQQKRAQEKEKQKENSNSPSSEGNEEDEAEDRRAVMDKLLEQLKNAG 1812

Query: 1751 PSKTDPSSARKRALVRKKLMTE---STALLKDIETEDDSIIYSPEGKNPFVNPVDLDTPH 1807
            P+K+DPSSARKRALVRKK ++E   +  LL D++TE+ SI+YSPE  +P  + V     H
Sbjct: 1813 PAKSDPSSARKRALVRKKYLSEKDNAPQLLNDLDTEEGSILYSPEAMDPTADTV----IH 1868

Query: 1808 DESEMDVXXXXXXXXXXXXXNSTLLS--DDQDEVTDRAKALLMELRGSNTPSKRNSLLDE 1865
             ES   +             + +  S  +DQ+E++DRA+ LL ELRGS+TP K+NS+LDE
Sbjct: 1869 AESPTPLATRGVMNTSEDLPSPSKTSALEDQEEISDRARMLLKELRGSDTPVKQNSILDE 1928

Query: 1866 HKEKLRARRRKTNSDLHSGTRLQF 1889
            H EKLRAR+ ++  +  +G RL F
Sbjct: 1929 HLEKLRARKERSIGEASTGNRLSF 1952

 Score =  172 bits (436), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 116/209 (55%), Gaps = 16/209 (7%)

Query: 25  IFQNLRRLTNPSSNHTNKXXXXXXXXXXXX--------------XERDSTTTRESHTNSL 70
           IFQNL+RL N ++ ++N                             R       S +   
Sbjct: 23  IFQNLKRLANSNATNSNTGSPTYASQQQHSPVGNEVSTSPASSSSFRKLNAPSRSTSTEA 82

Query: 71  KPLNKKTSLNTQNLSQYINDKHSPQHTRXXXXXXXXXXXXXXXXXXXXXXXXXNQIARQH 130
           +PLNKK++LNTQNLSQY+N K S                              N++ RQH
Sbjct: 83  RPLNKKSTLNTQNLSQYMNGKLSGDVPVSSQHARSHSMQSKYSYSKRNSSQASNKLTRQH 142

Query: 131 TNQS--SASILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRNILQSLPTD 188
           T QS  ++S+LSQGS TNLSKF  PDGKI LEMP DP EVEVLFEDIM KRNI QSL  D
Sbjct: 143 TGQSHSASSLLSQGSLTNLSKFTTPDGKIYLEMPSDPYEVEVLFEDIMYKRNIFQSLSED 202

Query: 189 KQNELMSYDLEKKWLIVKQDLQNEMKKMR 217
           KQ  LM Y +EKKWLIVKQDLQNE+KKMR
Sbjct: 203 KQEALMGYSIEKKWLIVKQDLQNELKKMR 231

>Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {ON}
            YNL271C (REAL)
          Length = 1946

 Score =  979 bits (2532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/828 (60%), Positives = 612/828 (73%), Gaps = 28/828 (3%)

Query: 314  PPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSSD 373
            PPIHYV+RI+AD +T++EMKDLWVTLRTEQ+DWVDAFIEHQGHIAMAN+LM S+YKT+  
Sbjct: 336  PPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMNSMYKTAPR 395

Query: 374  GTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSITLSTRRMATEIF 433
                 +LLEKEN+FFKCFRVLSMLSQGL EF+ H +M+ TVA GLFS  L+T++MATEIF
Sbjct: 396  DNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLATKKMATEIF 455

Query: 434  VCMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHLTLDSQLKVTQAWLFA 493
            VCMLEKKN  RF+ +L ALD+KF+IG N HM QN K  P YF+HLTL+S LK+ QAWLFA
Sbjct: 456  VCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFA 515

Query: 494  VEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCSSNINQRMLLRTK 553
            VE TLDGRGKMGSLVGASDDFKN GGENAILEYCQW+M+FINHLCSCS NINQRMLLRTK
Sbjct: 516  VEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTK 575

Query: 554  LENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNANINLQDPTSMLRN 613
            LENCG+LRIMNK+K LDYDKVI+QIDLY+NNKLDD N  LE+NN+  N++LQDP S+L+N
Sbjct: 576  LENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEANNEAFNVDLQDPLSLLKN 635

Query: 614  LWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDSLVTNVSV-SSTDQ 672
            LW  CKGTENEKLL+SL+QHLFLSSS+ IEE ++  KL++QLKL+DSLVTNVS+ S+ D+
Sbjct: 636  LWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMDSLVTNVSIASAADE 695

Query: 673  EASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKLKNAEHGLVGQL 732
            E+++NMAIQRLYDAMQTDEVARR+ILESR LTKKLEE+QAERD LS+KL  AEHGLVGQL
Sbjct: 696  ESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQL 755

Query: 733  QDELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLTILNARPEIVEGN 792
            +DEL +RD IL+KNQRVM                         RKMLTILN+RPE  E +
Sbjct: 756  EDELHERDHILAKNQRVMQQLESELEELKKKHLLEKHQQEVELRKMLTILNSRPE--ESS 813

Query: 793  GTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTIQPNKRLKLLRMQ 852
              ++ T+  +PS L+ S+K +IQ+ LQDGLSR KKDY  D++ FGMT+QPNKRLK+LRMQ
Sbjct: 814  DINEGTRNIDPS-LNFSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQ 872

Query: 853  MEDIENEARELEMTNFTEYEKR--------XXXXXXXXXXXXXXXXXXXXDPSINKLNDL 904
            ME+IENEAR+LEMTNF E+EK                             +  +NKLNDL
Sbjct: 873  MENIENEARQLEMTNFAEFEKERLEPPIQIKKPKLKKNKHKDKNFLARAQEADMNKLNDL 932

Query: 905  RQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNIDELVDS 964
            R+ LA+IQMESN+ISKFNV+ERVNELFN+K+  ALKRL++LETKYK FGIDFN++++++S
Sbjct: 933  RRALADIQMESNNISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEKIMES 992

Query: 965  ASKDENGNNQQSGD--YSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNLXXXXXXX 1022
              K     +++ GD  YSSLDPKAYQ+KLDE+NR+TDELL ++ +               
Sbjct: 993  PKKLSVA-DEREGDARYSSLDPKAYQKKLDEINRITDELLDLQTQTKQETKEEENGKSSF 1051

Query: 1023 XXXXXXXXXXXXXXXXXXLIERQDTQSNFSGTSAGPGSFLEALTQKYATGQ---KSASPR 1079
                                E +   S  S  S GPGSFL+AL+QKY TGQ    SA  R
Sbjct: 1052 SSSSSDADDDEVYQDASPTHEIRSENSELSAGS-GPGSFLDALSQKYGTGQNVTASAGLR 1110

Query: 1080 D--------QSTRMKDNIFINRIKQTNV-APPFLDELTDKVAEAPPVE 1118
            D         +    +  F+NR+K++ V + P+L+ELT KV +  P E
Sbjct: 1111 DSGYVSGLGHTPSKVEKTFMNRLKRSTVNSAPYLEELTQKVNKVEPCE 1158

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/623 (66%), Positives = 494/623 (79%), Gaps = 9/623 (1%)

Query: 1273 KKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVL 1332
            K  + SPLLPQS SLFE YPRP KKLKQLHWEKLD+TDNSIW + KAEKFADDLYEKGVL
Sbjct: 1326 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVL 1385

Query: 1333 TDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCD 1392
             DLEKAFAAREIKSLA+K+KEDL KI+FLSRDISQQFGINLHMY++L V D+VKK+L CD
Sbjct: 1386 ADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCD 1445

Query: 1393 RDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQ 1452
            RDFL TPSV+EFLSK EI+EVSVNLARNYAPYSTDWEGV++++DAK PEKDPN+LQRADQ
Sbjct: 1446 RDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQ 1505

Query: 1453 LYLQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVI 1512
            +YLQL+INL+SYWGSRMRALTV+T++++EYNELL KLRKVDKAV +LQ S+NL+NVFNVI
Sbjct: 1506 VYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVI 1565

Query: 1513 LAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELE 1572
            LAVGN+MNDTSKQAQGFKL+TLQRLTFIKD+TNSMTFLNYVEKI+R NYP+FNDFL ELE
Sbjct: 1566 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELE 1625

Query: 1573 PVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDAR 1632
            PVLDVVK+SIEQLV+DCK+FSQSIVNVERSVE GNLSDSSKFHP D+VL K LP+LP+AR
Sbjct: 1626 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1685

Query: 1633 KKGELLGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEE 1692
            +KG+LL DEVKLTIMEF  LMQ YGEDS                I EYKKAQ QN+  EE
Sbjct: 1686 RKGDLLKDEVKLTIMEFESLMQTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAGEE 1745

Query: 1693 EEQVYERHKKMVEDQQKKLQEQXXXXXXXXXXX--XXXXXXXXXRRAMMDKLLDQLKNAG 1750
            EE++YE+HKK+VE+QQKK QE+                      RR +MDKLL+QLKNAG
Sbjct: 1746 EERLYEKHKKLVEEQQKKAQEKEKQKERSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAG 1805

Query: 1751 PSKTDPSSARKRALVRKKLMTESTA---LLKDIETEDDSIIYSPEGKNP-FVNPVDLDTP 1806
            P+KTDPSSARKRALVRKK +++  +   LL D++ E+ SI+YSPE   P     V  ++P
Sbjct: 1806 PAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHAESP 1865

Query: 1807 HDESEMDVXXXXXXXXXXXXXNSTLLSDDQDEVTDRAKALLMELRGSNTPSKRNSLLDEH 1866
               + +               +     +DQ+E++DRA+ LL ELRGS    K+NS LDEH
Sbjct: 1866 ---TPLATRGLMNTPEDLPSPSKAPALEDQEEISDRARMLLKELRGSEISVKQNSTLDEH 1922

Query: 1867 KEKLRARRRKTNSDLHSGTRLQF 1889
             EKLRAR+ + +S+ ++G +L F
Sbjct: 1923 LEKLRARKERASSETNTGNKLSF 1945

 Score =  167 bits (422), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 89/157 (56%), Positives = 103/157 (65%), Gaps = 4/157 (2%)

Query: 65  SHTNSL--KPLNKKTSLNTQNLSQYINDKHSPQHTRXXXXXXXXXXXXXXXXXXXXXXXX 122
           S T S+  +PLNKK++LNTQNLSQY++ K S                             
Sbjct: 74  SRTTSIEARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQSKYSYSKRNSSQA 133

Query: 123 XNQIARQHTNQS--SASILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRN 180
            N++ RQHT QS  ++S+LSQGS TNLSKF  PDGKI+LEMP DP EVE+LFEDIM KRN
Sbjct: 134 SNKLTRQHTGQSHSASSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEILFEDIMYKRN 193

Query: 181 ILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMR 217
           I QSL  DKQ  LM Y  EKKWLIVKQDLQNE+KKMR
Sbjct: 194 IFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMR 230

>Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {ON}
            YNL271C (REAL)
          Length = 1952

 Score =  979 bits (2531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/829 (60%), Positives = 613/829 (73%), Gaps = 34/829 (4%)

Query: 314  PPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSSD 373
            PPIHYV+RI+AD +T++EMKDLWVTLRTEQ+DWVDAFI+HQGHIAMAN+LM S+YKT+  
Sbjct: 338  PPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPR 397

Query: 374  GTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSITLSTRRMATEIF 433
             +   +LLEKEN+FFKCFRVLSMLSQGL EF+ H +M+ TVA GLFS  L+TR+MATEIF
Sbjct: 398  DSLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTRLATRKMATEIF 457

Query: 434  VCMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHLTLDSQLKVTQAWLFA 493
            VCMLEKKN  RF+ +L ALD+KF+IG N HM QN K  P YF+HLTL+S LK+ QAWLFA
Sbjct: 458  VCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFA 517

Query: 494  VEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCSSNINQRMLLRTK 553
            VE TLDGRGKMGSLVGASD+FKN GGENAILEYCQW+M+FINHLCSCS NINQRMLLRTK
Sbjct: 518  VEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTK 577

Query: 554  LENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNANINLQDPTSMLRN 613
            LENCG+LRIMNK+K LDYDKV++QI+LY+NNKLDD N  LE+NNK  N++LQDP S+L+N
Sbjct: 578  LENCGVLRIMNKIKLLDYDKVMDQIELYDNNKLDDFNVRLEANNKAFNVDLQDPLSLLKN 637

Query: 614  LWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDSLVTNVSVSST-DQ 672
            LWD CKGTENEKLL+SL+QHLFLSSS+ IEE ++P KL++QLK++DSLVT+VS++ST D+
Sbjct: 638  LWDICKGTENEKLLVSLVQHLFLSSSKLIEENQNPSKLTKQLKVMDSLVTSVSIASTSDE 697

Query: 673  EASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKLKNAEHGLVGQL 732
            E++MNMAIQRLYDAMQTDEVARR+ILESR LTKKLEE+QAERD LS+KL  AEHGLVGQL
Sbjct: 698  ESNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQL 757

Query: 733  QDELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLTILNARPEIVEGN 792
            +DEL  RDRIL+KNQRVM                         RKMLTILN+RPE  E +
Sbjct: 758  EDELHGRDRILAKNQRVMQQLEAELEELKKKHLLEKHQQEVELRKMLTILNSRPE--ENS 815

Query: 793  GTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTIQPNKRLKLLRMQ 852
              ++  + KN S+L+ S+K +IQ+ LQDGLSR KKDY  D++ FGMT+QPNKRLK+LRMQ
Sbjct: 816  SINEGIRGKN-SSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQ 874

Query: 853  MEDIENEARELEMTNFTEYEK--------RXXXXXXXXXXXXXXXXXXXXDPSINKLNDL 904
            ME+IENEAR+LEMTNF E+EK                             +  +NKLNDL
Sbjct: 875  MENIENEARQLEMTNFAEFEKDHLEPPIQIKKPKLKKIKHKDKKLISRPQEVDMNKLNDL 934

Query: 905  RQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNIDELVDS 964
            R+ LAEIQMESNDISKFNV+ERVNELFN+K+  ALKRL++LETKYK FGIDFN++E+++S
Sbjct: 935  RRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEEIMES 994

Query: 965  ASKDENGNNQQSG-DYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNLXXXXXXXX 1023
              K+     ++ G +YSSLDP+ YQ KLDE+NR+TD+LL ++ +    D  +        
Sbjct: 995  PKKNSANERKEDGANYSSLDPRTYQNKLDEINRITDQLLDLQAQTKQDDGGVSSLSSSSS 1054

Query: 1024 XXXXXXXXXXXXXXXXXLIERQDTQSNFSGTS--AGPGSFLEALTQKYATGQK---SASP 1078
                                 Q+ +S  S  S  +G GSFL+AL+QKY TGQ    S   
Sbjct: 1055 SAEGEDVYQDA-------FPAQEVRSENSELSVESGSGSFLDALSQKYGTGQNNTVSVGL 1107

Query: 1079 RDQS-----TRMKDNI---FINRI-KQTNVAPPFLDELTDKVAEAPPVE 1118
            RD         M   +   F+N++ K T  + P+L+ELT KV +    E
Sbjct: 1108 RDSDYVSVIGHMPSKVEKTFMNKLRKSTASSAPYLEELTQKVNKVESYE 1156

 Score =  864 bits (2232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/624 (68%), Positives = 501/624 (80%), Gaps = 11/624 (1%)

Query: 1273 KKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVL 1332
            K  + SPLLPQS SLFE YPRP KKLKQLHWEKLD+TDNSIW T KAEKFADDLYEKGVL
Sbjct: 1332 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGTGKAEKFADDLYEKGVL 1391

Query: 1333 TDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCD 1392
             DLEKAFAAREIKSLA+K+KEDL KI+FLSRDISQQFGINLHMY++L V D+VKKIL CD
Sbjct: 1392 ADLEKAFAAREIKSLATKRKEDLKKITFLSRDISQQFGINLHMYSSLSVTDLVKKILNCD 1451

Query: 1393 RDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQ 1452
            RDFL TPSV+EFLSKPEI+EVSVNLARNYAPYSTDWEGVK+++DAK PEKDPN+LQRADQ
Sbjct: 1452 RDFLQTPSVVEFLSKPEIIEVSVNLARNYAPYSTDWEGVKNLKDAKPPEKDPNDLQRADQ 1511

Query: 1453 LYLQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVI 1512
            +YLQL++NL+SYWGSRMRAL V+T+++KEYNELLTKLRKVDKAV +LQES+NL+NVFNVI
Sbjct: 1512 IYLQLMVNLESYWGSRMRALIVVTSYEKEYNELLTKLRKVDKAVGALQESDNLRNVFNVI 1571

Query: 1513 LAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELE 1572
            LAVGN+MNDTSKQAQGFKL+TLQRLTFIKD+ NSMTFLNYVEKI+R NYPSFNDFL ELE
Sbjct: 1572 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELE 1631

Query: 1573 PVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDAR 1632
            PVLDVVK+SIEQLV+DC++FSQSIVNVERSVE GNLSDSSKFHP D++L K LP+LP+AR
Sbjct: 1632 PVLDVVKVSIEQLVNDCRDFSQSIVNVERSVEIGNLSDSSKFHPLDKILIKTLPVLPEAR 1691

Query: 1633 KKGELLGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEE 1692
            KKG+LL DEVKLTIMEF  LM  YGEDS                I EYKKAQ+QN+ AEE
Sbjct: 1692 KKGDLLEDEVKLTIMEFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQSQNLAAEE 1751

Query: 1693 EEQVYERHKKMVEDQQKKLQEQXXXXXXXXXXXXXXXXXXXX--RRAMMDKLLDQLKNAG 1750
            EE++YE+HKK+VE+QQK+ QE+                      RRA+MDKLL+QLKNAG
Sbjct: 1752 EERIYEKHKKIVEEQQKRAQEREKQKENSNSSSSEGNEEDEAEDRRAVMDKLLEQLKNAG 1811

Query: 1751 PSKTDPSSARKRALVRKKLMTE---STALLKDIETEDDSIIYSPEGKNPFVNPVDLDTPH 1807
            P K+DPSSARKRALVRK+ +++   S  LL D++ E+ SI+YSPE  +P  + V     H
Sbjct: 1812 PGKSDPSSARKRALVRKRYLSDKDNSQQLLNDLDNEEGSILYSPEALDPDADAV----IH 1867

Query: 1808 DESEMDVXXXXXXXXXXXXXNSTLLS--DDQDEVTDRAKALLMELRGSNTPSKRNSLLDE 1865
             ES   +             + +  S  +DQ+E++DRAK LL ELRGS+TP K+NS+LDE
Sbjct: 1868 AESPTPLTTRGTLNIPEDLPSPSKASTLEDQEEISDRAKMLLKELRGSDTPVKQNSILDE 1927

Query: 1866 HKEKLRARRRKTNSDLHSGTRLQF 1889
            H EKLRAR+ +T  +  +G +L F
Sbjct: 1928 HLEKLRARKERTIGEGSAGNKLSF 1951

 Score =  168 bits (426), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 99/149 (66%), Gaps = 2/149 (1%)

Query: 71  KPLNKKTSLNTQNLSQYINDKHSPQHTRXXXXXXXXXXXXXXXXXXXXXXXXXNQIARQH 130
           +PLNKK++LNTQNLSQY+N K S                              N++ RQH
Sbjct: 84  RPLNKKSTLNTQNLSQYMNGKISADVPVSSQHARSHSMQSKYSYSKRNSSQASNKLTRQH 143

Query: 131 TNQSSA--SILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRNILQSLPTD 188
           T QS +  S+LSQGS TNLSKF  PDGKI+LEMP DP EVEVLFEDIM KRNI QSL  D
Sbjct: 144 TGQSHSVSSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIFQSLSGD 203

Query: 189 KQNELMSYDLEKKWLIVKQDLQNEMKKMR 217
           KQ  LMSY  EKKWLIVKQDLQNE+KK+R
Sbjct: 204 KQEALMSYSTEKKWLIVKQDLQNELKKLR 232

>Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 1930 aa]
            {ON} (137817..142124,142127..143611) [5793 nt, 1931 aa]
          Length = 1930

 Score =  956 bits (2470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/1096 (48%), Positives = 690/1096 (62%), Gaps = 70/1096 (6%)

Query: 70   LKPLNKKTSLNTQNLSQYIN----DKHSP--------QHTRXXXXXXXXXXXXXXXXXXX 117
            L+PLNKK++LNTQNLSQY++    D+ +P         HTR                   
Sbjct: 62   LRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSHTRAHSSQSATKYSYSRRSSTA 121

Query: 118  XXXXXXNQIARQHTNQS--SASILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDI 175
                   +++RQ T QS  S+S+LSQGS+TNL K+I  DGKINLEMPRDP+EVE LFED+
Sbjct: 122  TGPI---KLSRQQTTQSLGSSSVLSQGSYTNLLKYIDSDGKINLEMPRDPHEVEALFEDL 178

Query: 176  MLKRNILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMRLKXXXXXXXXXXXXXXXX 235
            M KRNI Q+LP DKQ ELMSYD+ KKW +VKQDLQNE+KK+  K                
Sbjct: 179  MYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKLMSKSSSYHPTEGSYSSASN 238

Query: 236  XXXXXXXXI----------NLNSPATMQMSPXXXXXXXXXXXXXXXXTPITISKRPTGPI 285
                               + NSP T   +                  P+    RP G  
Sbjct: 239  SNGNLNSYSSSLRSSATSQDSNSPQTAIFTSNSGTMQNNTINLNNGNIPVGGKSRPVGSS 298

Query: 286  SNPI-PNADMYXXXXXXXXXXXXXX-XXXXPPIHYVKRIIADTITSEEMKDLWVTLRTEQ 343
            S     N+ +Y                   PPIHYVK+IIAD +TSEEM DLWVTLRTEQ
Sbjct: 299  STASGTNSMIYQSSENNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMNDLWVTLRTEQ 358

Query: 344  IDWVDAFIEHQGHIAMANILMKSLYKTSSDGTPNPQLLEKENAFFKCFRVLSMLSQGLRE 403
            +DWVDAF+EHQGHIAMAN+LM ++YK +      P+L EKE++FFKCFRVLSMLSQGL E
Sbjct: 359  LDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQEKEHSFFKCFRVLSMLSQGLYE 418

Query: 404  FTRHEIMSQTVARGLFSITLSTRRMATEIFVCMLEKKNPERFKVILNALDQKFKIGYNAH 463
            F +H++MS T+A GLFS  L+TR+MATE+ VCM+EK+N  RF+V+L +LD+ F+   N +
Sbjct: 419  FAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKRNNMRFEVVLASLDRYFRQEENLN 478

Query: 464  MTQNIKMFPDYFTHLTLDSQLKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAI 523
            M    K  P  +   T +++ K+ QAWL A++ TL+GRGKMGSLVGASDD++ S GENAI
Sbjct: 479  MVHLSKTLPGEYPQSTPNTKYKIIQAWLIALDETLNGRGKMGSLVGASDDYR-SAGENAI 537

Query: 524  LEYCQWSMIFINHLCSCSSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYEN 583
            LEYC W+M+FINHLCS SS +NQR+LLRTKLEN G LRIM K+K LDY+K+ EQI+LY+N
Sbjct: 538  LEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRIMTKLKRLDYEKLTEQIELYDN 597

Query: 584  NKLDDLNTLLESNNKNANINLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIE 643
            NKLDD NT+LE+ +KN+ +N+Q+P S++ NLW++CKG++NEKLL+SL+QHL+LSSS+ + 
Sbjct: 598  NKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNEKLLLSLIQHLYLSSSKLMG 657

Query: 644  EKKDPVKLSRQLKLLDSLVTNVSVSSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTL 703
            EK+DP KLS+QLKL+DSL+TNV+ S  D+E+ MN+AIQRLYD+MQTDEVARR+ILESRTL
Sbjct: 658  EKEDPTKLSKQLKLIDSLLTNVNGSMFDEESHMNLAIQRLYDSMQTDEVARRAILESRTL 717

Query: 704  TKKLEEVQAERDLLSQKLKNAEHGLVGQLQDELAQRDRILSKNQRVMXXXXXXXXXXXXX 763
            TKKLEE  AERD LS KL NAE+GLVGQL+ +L QRD IL KNQRVM             
Sbjct: 718  TKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNILEKNQRVMKQLESELEDLKKK 777

Query: 764  XXXXXXXXXXXXRKMLTILNARPEIVEGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLS 823
                        RKMLTILN+R      NGT           LDP+KK  IQ+AL+  L+
Sbjct: 778  HLLEKHEHEVELRKMLTILNSR------NGTQNPDVDDVTITLDPNKKLDIQKALELELN 831

Query: 824  RTKKDYSVDARNFGMTIQPNKRLKLLRMQMEDIENEARELEMTNFTEYEK---------R 874
            +TKKD S D++ FG+T+QPNKRLK+LRMQMEDIENEAR+LEMTNF ++++         +
Sbjct: 832  KTKKDLSNDSKRFGITVQPNKRLKMLRMQMEDIENEARQLEMTNFADHKRTNLKKPVIVK 891

Query: 875  XXXXXXXXXXXXXXXXXXXXDPSINKLNDLRQTLAEIQMESNDISKFNVDERVNELFNQK 934
                                +    KL  LR+ LA IQ E+NDISKFNV+ RVNE+F  K
Sbjct: 892  KEKKLRKKKKINTEEFDKENEMKTKKLMQLRKALAAIQSETNDISKFNVEGRVNEMFQDK 951

Query: 935  RITALKRLQDLETKYKDFGIDFNIDELVDSASKDENGNNQQSGDYSSLDPKAYQRKLDEL 994
            ++ AL+RL+ LE KYKDF I F  DEL D   ++ +   Q    +S+LDP   Q+K++EL
Sbjct: 952  KLKALQRLKQLEAKYKDFEIPF--DELQDLDDRELDDEQQ----HSTLDPTYLQKKINEL 1005

Query: 995  NRLTDELLRVKNKVNASDNNLXXXXXXXXXXXXXXXXXXXXXXXXXLIERQDTQSNFSGT 1054
            + ++DEL  +    +A++ N                             R  + +   G 
Sbjct: 1006 DEISDELYLMNYDSDANNGNTSDSSSSSEADGDGTDSM-----------RSVSNAPSKGI 1054

Query: 1055 SAGPGSFLEALTQKYATGQKS-------ASPRDQSTRMKDNIFINRIKQTNVAPPFLDEL 1107
            S   GSFLE+L+QKY TGQ +        SP ++     +  F+NR+K+  +A PFL+EL
Sbjct: 1055 SEA-GSFLESLSQKYGTGQNAISSPTSITSPNERIASQGEKSFMNRLKRQTMAAPFLEEL 1113

Query: 1108 TDKVAEAPPVEASLAE 1123
            T KV +   ++ ++++
Sbjct: 1114 TQKVNDTSSIDDNISD 1129

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/640 (62%), Positives = 474/640 (74%), Gaps = 39/640 (6%)

Query: 1271 PRKKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKG 1330
            P K V+  P L Q  +  +  PRPQKKLKQLHW+KLD+TD+SIW    AE+FADDLYEKG
Sbjct: 1252 PYKSVVDQPSLLQLTN-SDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKG 1310

Query: 1331 VLTDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILK 1390
            VL +LEKAFAAREIKS+ ++KKEDL KISFLS DISQQFGINLHMY +L V ++++K+LK
Sbjct: 1311 VLRNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLK 1370

Query: 1391 CDRDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRA 1450
            CDR+ ++TPSVIEFL+K EIVEVSVNLARNYAPY+TDWEGVKS++  K         QR 
Sbjct: 1371 CDRNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRR 1422

Query: 1451 DQL-YLQLI------INLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESE 1503
             Q+ Y +LI      +NLQSYW SRMRAL VIT++++EYNEL+TKLRKVDKAV ++Q SE
Sbjct: 1423 IQMTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSE 1482

Query: 1504 NLKNVFNVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPS 1563
            NLKNVFNVILAVGNYMNDTSKQAQGFKL+TLQRLTFIKD+TNSMTFLNYVEKIVR NYPS
Sbjct: 1483 NLKNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPS 1542

Query: 1564 FNDFLTELEPVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAK 1623
            FNDF+ +LEPVLDVVK+S+EQL+SDC EFSQSIVNVERS+E GNLSDSSKFHP D+VL K
Sbjct: 1543 FNDFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTK 1602

Query: 1624 VLPILPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKA 1683
            VLP+LP+A KK  LL DEVKLTIMEF  LM+ YGED+                ITEYKKA
Sbjct: 1603 VLPVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGDKFAKNSFFKKFADFITEYKKA 1662

Query: 1684 QNQNIKAEEEEQVYERHKKMVEDQQKKLQEQXXXXXXXXXXXXXXXXXXXXRRAMMDKLL 1743
            Q+QN+K EEEE+ YE+HK+M+E+QQ K   Q                    RRAMMDKLL
Sbjct: 1663 QSQNLKQEEEERAYEKHKRMIEEQQHK---QDLEEERSREVEGEPGEEQSDRRAMMDKLL 1719

Query: 1744 DQLKNAGPSKTDPSSARKRALVRKKLMT--ESTA-LLKDIETEDDSIIYSP-----EGKN 1795
            ++LKNAGP K DPSSARKRALVRKKL+T  E TA +L+DI+T DDSI+YSP     EG  
Sbjct: 1720 EKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNTPTQEGP- 1778

Query: 1796 PFVNPVDLDTPHDESEMDVXXXXXXXXXXXXXNSTLLSDDQDE-VTDRAKALLMELRGSN 1854
               N + L +P    + D+              ST     +DE ++DRAKALL+ELRGS 
Sbjct: 1779 ---NDIHLASPTPSGKSDLVLASVSPTKE----STADGIAEDEFISDRAKALLLELRGSE 1831

Query: 1855 TPSKRNSLLDEHKEKLRAR--RRKTNSDLHSGTRLQFVGE 1892
               KRNS L+E KEKL+AR  RR+T ++  S  +L F  E
Sbjct: 1832 N-MKRNSQLEEQKEKLKARRSRRRTQTESISSNKLFFTDE 1870

>KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1.82
            YNL271C
          Length = 1957

 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/820 (56%), Positives = 591/820 (72%), Gaps = 29/820 (3%)

Query: 314  PPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSSD 373
            PP  YV++IIAD ++ +EM+DLWVTLRTEQ+DWVD+F+E+QGHIAMANILMK +YKT+  
Sbjct: 316  PPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAMANILMKQIYKTTPK 375

Query: 374  GTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSITLSTRRMATEIF 433
               + +LLEKEN+FFKCF+VLSMLSQG+ EF++H++M+ T+ARGLFS  L TR+MA EIF
Sbjct: 376  DHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDTIARGLFSTRLGTRKMAIEIF 435

Query: 434  VCMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHLTLDSQLKVTQAWLFA 493
            VCMLEK+N  RF+ ILN+LDQ F+IG N HM QN+K  P YF HLT DS LKV QAWLF+
Sbjct: 436  VCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKLPQYFIHLTPDSHLKVLQAWLFS 495

Query: 494  VEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCSSNINQRMLLRTK 553
            +E+T+DGRGKMGSLVGAS D KNSGGENAILEYC W+M+F+N LC+ S+ I QRMLLRTK
Sbjct: 496  IENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNASTIIQQRMLLRTK 555

Query: 554  LENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNANINLQDPTSMLRN 613
            LEN G LRIMNK+K L+Y+KVI++I+ YENNKLDD N +LES NKN+N+NLQDP S+L N
Sbjct: 556  LENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKNSNVNLQDPVSLLNN 615

Query: 614  LWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDSLVTNVSVSST-DQ 672
            LW +CKGTENEKLLISL+QHLFLSSS+ IEE  DP KLS+QLKL+DSLVTNVS SST D+
Sbjct: 616  LWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMDSLVTNVSSSSTADE 675

Query: 673  EASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKLKNAEHGLVGQL 732
            E++MNMAIQRLYD+MQTDEVARR+ILESRTLTKKLEE+QAE+DLL +KL  AE+GLVGQL
Sbjct: 676  ESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLHEKLSKAENGLVGQL 735

Query: 733  QDELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLTILNARPEIVEGN 792
            +++L +RD+IL+KNQRV                          RKMLTILN R    +G 
Sbjct: 736  ENDLNERDQILAKNQRVTQQLQSELEELKKKHLLEKHEHEVELRKMLTILNTRSSTNDGA 795

Query: 793  GTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTIQPNKRLKLLRMQ 852
             T  K K  N S L+  K ++IQ+ LQDGL R K D+++DA+ FGMT+QPNKRLK+LRMQ
Sbjct: 796  KTIDKDK-DNISKLNLQKHENIQKVLQDGLIRAKNDFTIDAKKFGMTVQPNKRLKMLRMQ 854

Query: 853  MEDIENEARELEMTNFTEYEKRX-----------XXXXXXXXXXXXXXXXXXXDPSINKL 901
            MEDIENEAR+LEMTNFTE+E++                                  INKL
Sbjct: 855  MEDIENEARQLEMTNFTEFERKKLEPPVEVTKPKHRHKKHKIEKINQQESNDQKSRINKL 914

Query: 902  NDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNIDEL 961
            NDLR+ LAEIQ ESN+ISKFN++ERVNELFN+K++ AL+RL++LETKYKDFGI+F + + 
Sbjct: 915  NDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQRLKELETKYKDFGINFEMKDF 974

Query: 962  VDSASKDENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNLXXXXXX 1021
            +++   D         +Y SLDPK Y++KLD+++RLT++LL ++                
Sbjct: 975  LENKPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTEQLLNLQ----------KTQELR 1024

Query: 1022 XXXXXXXXXXXXXXXXXXXLIERQDTQSNFSGTSAGPGSFLEALTQKYATGQK----SAS 1077
                                I    + S  +G  +G  SFLE L++KY TGQK    +A+
Sbjct: 1025 EESSSSYSSSESDEENDDDEIFVASSSSKPAG--SGTRSFLETLSEKYGTGQKNVAMTAT 1082

Query: 1078 PRDQSTRMKDNIFINRIKQTNVAPPFLDELTDKVAEAPPV 1117
            P  +     +  F++R+++++ A PFL ELT+KVA A  V
Sbjct: 1083 PNSRIVTQSEKQFLDRMRRSSTAAPFLQELTEKVAPALSV 1122

 Score =  857 bits (2214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/627 (67%), Positives = 500/627 (79%), Gaps = 24/627 (3%)

Query: 1273 KKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVL 1332
            K V +SPLLPQS SLFE YPR QKK+KQLHWEK++ TDNSIW T KAE+FADDL+EKGV 
Sbjct: 1285 KSVSSSPLLPQSPSLFERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVF 1344

Query: 1333 TDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCD 1392
            ++LEKAFAARE+KSLASK+K+DLDKI+FLSRDISQQFGINLHMY++L V+D+V KILKCD
Sbjct: 1345 SNLEKAFAAREVKSLASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCD 1404

Query: 1393 RDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQ 1452
            RDFLHTPSVIEFLSKPEI EVSVNLARNY+PY+TDWEG+KS+EDAK PEKDPN+LQRADQ
Sbjct: 1405 RDFLHTPSVIEFLSKPEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQ 1464

Query: 1453 LYLQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVI 1512
            +YLQL++NLQ YW SRMRAL +ITT++KEYNELL KLRKVDKAV SLQESENL+NVFNVI
Sbjct: 1465 IYLQLMVNLQPYWASRMRALKIITTYEKEYNELLLKLRKVDKAVGSLQESENLRNVFNVI 1524

Query: 1513 LAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELE 1572
            LAVGNYMNDTSKQAQGFKL+TLQRLTFIKDSTNSMTFLNYVEKI+R NYPSFN FL ELE
Sbjct: 1525 LAVGNYMNDTSKQAQGFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELE 1584

Query: 1573 PVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDAR 1632
            PVL+VVKISIEQL +DCKEF QS+ NVERS+E GNLSDSSKFHP DRVLAKVLP LPD R
Sbjct: 1585 PVLEVVKISIEQLANDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVR 1644

Query: 1633 KKGELLGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEE 1692
            KKG+LL DEV LT+MEF  LMQ+YGED+                I EY+KAQ QNIK EE
Sbjct: 1645 KKGDLLNDEVNLTLMEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVEE 1704

Query: 1693 EEQVYERHKKMVEDQQKKLQEQXXXXXXXXXXXXXXXXXXXXRRAMMDKLLDQLKNAGPS 1752
            EE+ YERHK+MVE+QQ+K + +                    RR  MDKLL+QLKN GPS
Sbjct: 1705 EEEAYERHKRMVEEQQRKAERKEAKNQNNIDENEDDDQERTDRRGTMDKLLEQLKNVGPS 1764

Query: 1753 KTDPSSARKRALVRKKLMTE---STALLKDIETEDDSIIYSPE----GKNPFVNPVDLDT 1805
            + DPSSARKRAL RKK++T+   +  ++ D+ETE DSIIYSP+    G  PF    +  +
Sbjct: 1765 RADPSSARKRALARKKMLTDKEGTVNMMHDLETESDSIIYSPDNKAIGSTPF--GANGAS 1822

Query: 1806 PHDESEMDVXXXXXXXXXXXXXNSTLLSDD--QDEVTDRAKALLMELRGSNTPSKRNSLL 1863
             H ++  ++              S    DD  ++E+++RAK LLM LRG+ +PSKRNS+L
Sbjct: 1823 SHKQNSNELSP------------SKGFRDDLSEEEISERAKTLLMGLRGTASPSKRNSML 1870

Query: 1864 DEHKEKLRARRRKTNSDLHSGT-RLQF 1889
            DEHKEKLRARRR+TN+DL SG+ +L+F
Sbjct: 1871 DEHKEKLRARRRRTNNDLPSGSNKLKF 1897

 Score =  152 bits (383), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 120/209 (57%), Gaps = 19/209 (9%)

Query: 25  IFQNLRRLTNPSSNHTNKXXXXXXXXXXXXXE--------------RDSTTTRESHTNSL 70
           +FQNL+RLT+ +SN+T+K                               ++   + T + 
Sbjct: 23  LFQNLKRLTSNNSNNTSKYTESYSINKSSISSPLQKHDTNLPPSSSSSPSSNASAITTTN 82

Query: 71  KPLNKKTSLNTQNLSQYINDKHSPQHTRXXXXXXXXXXXXXXXXXXXXXXXXXNQIARQH 130
           KPLNKK++LNTQNLSQY++   S                               +++RQH
Sbjct: 83  KPLNKKSTLNTQNLSQYMDHARSSSTNSASASKYSSSRRSSTQVSTSESLR---RLSRQH 139

Query: 131 TNQSS-ASILSQ-GSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRNILQSLPTD 188
           T QSS ASI SQ  S+ N SKFI PDGK NLEMPRDP E+E LFE+IM KRNILQ+L  +
Sbjct: 140 TGQSSSASIHSQNSSYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNILQNLSVE 199

Query: 189 KQNELMSYDLEKKWLIVKQDLQNEMKKMR 217
           KQ ELM+YD+ KKWLIVKQD+QNE K++R
Sbjct: 200 KQRELMNYDVRKKWLIVKQDIQNEFKRIR 228

>TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_1.82
            YNL271C
          Length = 1879

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/847 (54%), Positives = 591/847 (69%), Gaps = 44/847 (5%)

Query: 314  PPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSSD 373
            PPIHYVKRIIAD +T  EM DLWVTLRTEQ+DWVD F+EHQGHIAMAN+L  S+YKT  +
Sbjct: 306  PPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGHIAMANVLTTSIYKTDPE 365

Query: 374  GTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSITLSTRRMATEIF 433
               +  LLEKE+AFF+CFRVLS+L+QGL E +RH IM++TVA GLFS+ L+TR+MATEIF
Sbjct: 366  TPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAETVANGLFSVRLATRKMATEIF 425

Query: 434  VCMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHLTLDSQLKVTQAWLFA 493
            VCMLEKKN  RF+ +LNALD+KFKIG N HM   +K  P +F+H T DSQ K+ Q+WLFA
Sbjct: 426  VCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYMKNSPQHFSHFTRDSQFKIVQSWLFA 485

Query: 494  VEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCSSNINQRMLLRTK 553
            VE +L+GRGKMGSLVGAS+DFK SGGENAILEY QW+M+FINH C+ +  INQR+LLRT+
Sbjct: 486  VEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTMVFINHFCNGTDVINQRILLRTR 545

Query: 554  LENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNANINLQDPTSMLRN 613
            LEN G LRIMN+ K LDYDKV+E ++ YEN KLDDLN++LE+    ++I++ D  S+L+ 
Sbjct: 546  LENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETGAHASDIDMNDSASLLKK 605

Query: 614  LWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDSLVTNVSVSSTDQE 673
            L+D CKGTE+EKLL SL++HLFLS+S+ +E+ +DP KLS+QL+L+DSLVTNVSVS+ D+ 
Sbjct: 606  LFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKLSKQLRLMDSLVTNVSVSAVDES 665

Query: 674  ASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKLKNAEHGLVGQLQ 733
            +S+NMAIQRLYD+MQTDEVARR+ILESRTLTKKLEE QAERD LSQKL    +GLVGQL+
Sbjct: 666  SSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGLVGQLE 725

Query: 734  DELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLTILNARPEIVEGNG 793
             E+ QRD IL KNQRV                          RKMLTILN+RPE      
Sbjct: 726  KEVQQRDDILEKNQRVTLQLQDELEELKKKHLLEKHEHEVELRKMLTILNSRPEGDLSRK 785

Query: 794  TSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTIQPNKRLKLLRMQM 853
             S  +KA+ P  LDP KK +IQQALQDGL +TKKD SVD++ FG+T+QPNKRLK+LR+QM
Sbjct: 786  GSVHSKAQ-PGILDPDKKSTIQQALQDGLLKTKKDLSVDSKRFGITVQPNKRLKMLRLQM 844

Query: 854  EDIENEARELEMTNFTEYEK---RXXXXXXXXXXXXXXXXXXXXDPSINKLNDLRQTLAE 910
            EDIE EARELEMTNF ++ K   +                    +   NKL++LR+ LA+
Sbjct: 845  EDIEQEARELEMTNFADHNKAVLQAPVKVESSNYVRKENELRAKELKANKLSELRKALAD 904

Query: 911  IQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNI-----DELVDSA 965
            IQ ESN +SKFNV+ERVNELF QK+++AL RL DLE  YK++GID +      DE  +SA
Sbjct: 905  IQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLENMYKEYGIDLSTHFPIQDEPQESA 964

Query: 966  SKDENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNLXXXXXXXXXX 1025
              ++N         S+LDP+AYQ KLDE++R++ EL+ +K+++  +D  L          
Sbjct: 965  ESEKNAEGP-----STLDPRAYQAKLDEIDRISKELIEMKSELK-NDKALRRHESPSKQD 1018

Query: 1026 XXXXXXXXXXXXXXXLIERQDTQS--NFSGTSAGPGSFLEALTQKYATGQKS-------- 1075
                             E QDT S  N    S+G  SFLE+L+QKY TG+ +        
Sbjct: 1019 TDDD-------------EIQDTGSMVNEDLQSSGTSSFLESLSQKYGTGKNATNMLTNDI 1065

Query: 1076 --ASPRDQSTRMKDNIFINRIKQTNVAPPFLDELTDKVAEAPPVEASLAEPDNNNTINES 1133
              +S R   +R     F+ R+K+ +  P +L+EL  KV +APP+  +  E D+++ I E 
Sbjct: 1066 LNSSERKGHSRQS---FMERMKKPSGVPAYLEELPLKVPKAPPLGVAETE-DSSDNIAED 1121

Query: 1134 SKEETGE 1140
             ++E+ E
Sbjct: 1122 VEKESAE 1128

 Score =  835 bits (2156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/612 (66%), Positives = 486/612 (79%), Gaps = 23/612 (3%)

Query: 1273 KKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVL 1332
            +  + SPLLPQS SLF +YPR +KKLKQLHWEKLDATDNSIW + KAEKFA DLYEKGVL
Sbjct: 1236 RTAVPSPLLPQSPSLFSSYPRARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVL 1295

Query: 1333 TDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCD 1392
             DLEKAFAAREIKSLA+KK+EDLDKI+FLSRD+SQQFGINLHMY+ L V+++V KILKC+
Sbjct: 1296 EDLEKAFAAREIKSLATKKREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCE 1355

Query: 1393 RDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQ 1452
            RDF+ TPSV+EFLSKPEI+EVS NLARNY+PYSTDW+GV  VEDAK+PEKDP ELQRADQ
Sbjct: 1356 RDFMDTPSVLEFLSKPEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQ 1415

Query: 1453 LYLQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVI 1512
            LYLQLI NLQ YWGSRMRAL VIT++++EY+EL+TKLRKVDKAV+ +Q+S NL+NVFNVI
Sbjct: 1416 LYLQLIYNLQPYWGSRMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVI 1475

Query: 1513 LAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELE 1572
            LAVGNYMND++KQAQGFKL+TLQRLTFIKD+ NSMTFLNYVEKIVR NYPSFNDFL +L+
Sbjct: 1476 LAVGNYMNDSAKQAQGFKLSTLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQ 1535

Query: 1573 PVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDAR 1632
            PVLDVVKISIEQL+SDCKEFSQSI NVERS++ GNL+DSSKFHP D+VL KVLP+LP+A 
Sbjct: 1536 PVLDVVKISIEQLISDCKEFSQSITNVERSIDIGNLNDSSKFHPLDKVLVKVLPVLPEAS 1595

Query: 1633 KKGELLGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEE 1692
            K+ ELL +EVKL+IMEF  LMQ YGEDS                I EYK+AQ QN+KAEE
Sbjct: 1596 KRVELLDEEVKLSIMEFESLMQRYGEDSADKFAKNSFFKKFADFINEYKRAQAQNLKAEE 1655

Query: 1693 EEQVYERHKKMVEDQQKKLQEQXXXXXXXXXXXXXXXXXXXXRRAMMDKLLDQLKNAGPS 1752
            EE++Y+ HKKMVE+QQK+ +E+                    RRAMMDKLL+QLKNAGP 
Sbjct: 1656 EERLYQTHKKMVEEQQKRAEEK---ERSENATEEDASEENEDRRAMMDKLLEQLKNAGPV 1712

Query: 1753 KTDPSSARKRALVRKKLMTESTA---LLKDIETEDDSIIYSPEGKNPFVNPVDLDTPHDE 1809
            K DP SARKRA++RKK++ +S A   +L  I+ EDDS+IYSPE +    NP   D+    
Sbjct: 1713 KADPLSARKRAMIRKKMLNDSEAVSDVLDSIQQEDDSMIYSPEKQEGITNPTG-DSSQSP 1771

Query: 1810 SEMDVXXXXXXXXXXXXXNSTLLSDDQDEVTDRAKALLMELRGSNTPSKRNSLLDEHKEK 1869
            S+                       D++E+TDRAKALLM LRG  +PSKRN++L+ HKEK
Sbjct: 1772 SKGAANNQQ----------------DEEEITDRAKALLMGLRGGESPSKRNNVLNGHKEK 1815

Query: 1870 LRARRRKTNSDL 1881
            LRARRRKTN+D+
Sbjct: 1816 LRARRRKTNTDM 1827

 Score =  129 bits (324), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 102/169 (60%), Gaps = 9/169 (5%)

Query: 59  STTTRESHTNSLKPLNKKTSLNTQNLSQYINDKHSPQ-----HTRXXXXXXXXXXXXXXX 113
           S  +R S+ N L+PLNKK+++NTQNLS Y+N K S +     H+R               
Sbjct: 58  SVPSRVSNANDLRPLNKKSTMNTQNLSHYMNGKSSAESLSSNHSRSPSVQSSTKYTYSRR 117

Query: 114 XXXXXXXXXXNQ-IARQHTNQSSASILSQGS--FTNLSKFIAPDGKINLEMPRDPNEVEV 170
                     N  + R+ TNQS +S        F+NL+ F+ PDGKI L+MP   +EVE 
Sbjct: 118 SSSHLSTPGVNSTLTREPTNQSLSSSSVLSQDSFSNLAIFMTPDGKIKLDMP-SSHEVEN 176

Query: 171 LFEDIMLKRNILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMRLK 219
           LFED+M KRNILQ+L  DKQ ELM YD++KKWLIVKQDLQN+ KK+  K
Sbjct: 177 LFEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLAK 225

>ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} some
            similarities with uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1994

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/879 (52%), Positives = 592/879 (67%), Gaps = 42/879 (4%)

Query: 314  PPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSSD 373
            PP +YVK+IIAD +T +E+ DLWVTLRTEQ+DWVDAF+EHQGHIAMAN+LMKSLYKT+ +
Sbjct: 310  PPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMKSLYKTTQE 369

Query: 374  GTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSITLSTRRMATEIF 433
                 + LE+E ++FKCFRVL ML+QGL EFT+H IM++TVA  LFSI L TR+MATEIF
Sbjct: 370  VKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIRLPTRKMATEIF 429

Query: 434  VCMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHLTLDSQLKVTQAWLFA 493
            VCMLEKKN  RF VIL ALD+KF IG N HM Q +K  P  F HL  DSQ K+ QAWL  
Sbjct: 430  VCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQFKIVQAWLTG 489

Query: 494  VEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCSSNINQRMLLRTK 553
            +E  L GRGKMGSLVGAS++ + +GGEN+ILEY QW+M+FINHLC  +  +NQR+LLRT+
Sbjct: 490  LETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDVVNQRVLLRTR 549

Query: 554  LENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNANINLQDPTSMLRN 613
            LEN G LRIMN+ K LDYDK+  QI+ YEN KLDD+N LLES  +N  +N+QDP  ML+ 
Sbjct: 550  LENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVNMQDPMMMLQT 609

Query: 614  LWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDSLVTNVSVSSTDQE 673
            +WD CKGTENEK  ISL++HLFLSSS+  +++ DP KL++QLKL+DSLV NVSVS+ D+E
Sbjct: 610  MWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDSLVANVSVSAVDEE 669

Query: 674  ASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKLKNAEHGLVGQLQ 733
            +S+N+AIQRLYDAMQTDEVARR+ILESR LTK+LEE+QAERD L QKL +   G+VG+L+
Sbjct: 670  SSVNVAIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRLE 729

Query: 734  DELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLTILNARPEIVEGNG 793
            +EL QRD IL+KNQRV                          RKMLTILNARP+      
Sbjct: 730  EELKQRDDILAKNQRVNRHLQAELEELKKKHLLEKHEHEVELRKMLTILNARPDDENLAK 789

Query: 794  TSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTIQPNKRLKLLRMQM 853
            ++K TK+ N   LDP ++ SIQ+ALQDGL RT+KD SVD++ FG+T+QPNKRL++LRM+M
Sbjct: 790  STKVTKSVN--GLDPDRQTSIQKALQDGLQRTRKDLSVDSKRFGITVQPNKRLRMLRMKM 847

Query: 854  EDIENEARELEMTNFTEYEKRXXXXXXXXXXXXXXXXXXXXDPSINKLNDLRQTLAEIQM 913
            E IE EARELEMTNF E+E++                       + KL++LR+ L++IQ 
Sbjct: 848  EGIEQEARELEMTNFAEHEEKQLEEPVGTGTKKKA--------GVRKLSELRKQLSDIQK 899

Query: 914  ESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNIDELVDSASKDENGNN 973
            E+N+++KFNV+ERV ELFNQKR+ ALKRL++LET YK FGIDFN + L++S   D + N+
Sbjct: 900  ETNEVTKFNVEERVKELFNQKRLKALKRLKELETTYKGFGIDFNANALLESKGGDIHWND 959

Query: 974  QQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNLXXXXXXXXXXXXXXXXXX 1033
             +       D +  Q K+DE++R+ +EL  +K KV   +                     
Sbjct: 960  DE---IDGQDLQGAQEKMDEMDRIANELTAMKMKVEIQNQQQHTDSSSTESSSEDDDGAT 1016

Query: 1034 XXXXXXXLIERQDTQSNFSGTS--AGPGSFLEALTQKYATGQK---SASPRDQSTRMKDN 1088
                      R DT S FS  S  +G GSFLEAL+QKY  GQ    S SP     R   N
Sbjct: 1017 GS--------RTDTASEFSQKSFGSGAGSFLEALSQKYGAGQNTTISNSPFPGVDRKSSN 1068

Query: 1089 ---IFINRIKQTNVAPPFLDELTDKVAEAP----PVEASLAEPDNNNTINESSKEETGEA 1141
                F NR+K++N A P+ DELT KVA+AP    P      EP +++T+  +S       
Sbjct: 1069 HRTSFANRMKKSN-ATPYFDELTRKVAKAPSLNDPSSPGSNEPGDDDTLPATSPTVPQSI 1127

Query: 1142 NLTSSDNEVVAQASLSNPEVSPKHDNNSVKDVNESDDKA 1180
            N T S +    + S S+PE  P  D  SV     SD++A
Sbjct: 1128 NDTVSKD----KNSTSSPEAPPTLDPGSV----HSDERA 1158

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/649 (60%), Positives = 481/649 (74%), Gaps = 40/649 (6%)

Query: 1278 SPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVLTDLEK 1337
            S  L ++ +  +NYP+P KKLKQLHWEKLDAT++SIW +  AEKFA DLYEKGVL  LEK
Sbjct: 1246 SNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEK 1305

Query: 1338 AFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLH 1397
            AFAAREIK+LA+KKKEDL KI+FLS D SQQFGINLHMY+++ V+D+V KILKCDRDF+ 
Sbjct: 1306 AFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQ 1365

Query: 1398 TPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQL 1457
            TPSVIEFLSK EI EVSVNLARN++PYSTDW+G+KS+EDAK PEKDPN+LQRADQ+YLQL
Sbjct: 1366 TPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQL 1425

Query: 1458 IINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGN 1517
            I NLQ+YWGSRMRA+ VIT++DKEY EL+TKLRKVDKAV ++ +SENL N+FNVILAVGN
Sbjct: 1426 IFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGN 1485

Query: 1518 YMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDV 1577
            +MNDT+K+AQGFKL+TLQRLTFIKD+ NSMTFLNYVEKI+R NYPSFNDFL ELEPVL+V
Sbjct: 1486 FMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNV 1545

Query: 1578 VKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGEL 1637
             KISI+QLV+DC E+ Q++ NVERS+E GNLSDSSKFHP DRVL KVLP+LP+ARKK +L
Sbjct: 1546 TKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDL 1605

Query: 1638 LGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVY 1697
            L DEV+L+IMEF  LMQ YGED+                + EYKKAQNQN+K EEEE+VY
Sbjct: 1606 LDDEVRLSIMEFENLMQKYGEDTGDKFAKNSFFKKFADFVQEYKKAQNQNLKVEEEERVY 1665

Query: 1698 ERHKKMVEDQQKKLQE-QXXXXXXXXXXXXXXXXXXXXRRAMMDKLLDQLKNAGPSKTDP 1756
            ERHKKMVE+QQ++ Q                       RRAMMDKLLDQLKNAGP+ +DP
Sbjct: 1666 ERHKKMVEEQQRREQTPSKNRDYVVNEDEDIADDDDQDRRAMMDKLLDQLKNAGPTTSDP 1725

Query: 1757 SSARKRALVRKKLMTESTA---LLKDIETEDDSIIYSPEGKNPFVNPVDLDTPHDESEMD 1813
            SSARKRAL+R+KL  +  A   L+ D+++ +DSI+YSP            +   D+S   
Sbjct: 1726 SSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSP------------NASQDQSANA 1773

Query: 1814 VXXXXXXXXXXXXXNSTLLSD-----------------DQDEVTDRAKALLMELRGSNTP 1856
                          N  +LSD                 +++E++D+AK LLMEL G+  P
Sbjct: 1774 EEASPTVHKGSNKNNKPVLSDLESPIKASRNADRNNENEEEEISDKAKNLLMELSGNGAP 1833

Query: 1857 SKRNSLLDEHKEKLRARRRKT--NSDLHSGTRLQFVGETVPEKEVEPIT 1903
            ++R  LL+ HKE+LRARRR+T  + +L S  +L F+ +  P     P+T
Sbjct: 1834 TRREELLNGHKERLRARRRRTQGHGELISSNKLAFLDDETP-----PVT 1877

 Score =  127 bits (319), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 79/100 (79%), Gaps = 7/100 (7%)

Query: 124 NQIARQHTNQS-------SASILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIM 176
            Q++RQ TN S       +AS+LSQGS TNL +F+ PDGK+ L+MP+D +EVE LFEDIM
Sbjct: 139 GQLSRQQTNHSHANSQSSAASVLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIM 198

Query: 177 LKRNILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKM 216
            KRNI+Q+LP +KQ EL +YD++KKWLIV+QDL +++KKM
Sbjct: 199 YKRNIMQTLPPEKQQELRNYDIDKKWLIVRQDLSSDLKKM 238

>KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON} 
          Length = 2028

 Score =  834 bits (2155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/830 (51%), Positives = 563/830 (67%), Gaps = 39/830 (4%)

Query: 315  PIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSSDG 374
            PIHYVK+IIAD ++ +E+ DLWVTLRTEQ+DWVDAF+++QGHIAMAN+LMKSLYKTS + 
Sbjct: 418  PIHYVKKIIADQLSQDELNDLWVTLRTEQLDWVDAFLDNQGHIAMANVLMKSLYKTSPNV 477

Query: 375  TPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSITLSTRRMATEIFV 434
            + +  LL+KE ++FKCF+VLSML+QGLREFT H +++ T+ARGLFS  L TR+MATEIFV
Sbjct: 478  SLSGPLLDKEQSYFKCFKVLSMLAQGLREFTDHRLITDTIARGLFSSRLPTRKMATEIFV 537

Query: 435  CMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHLTLDSQLKVTQAWLFAV 494
            CMLE KN  RF  ++ +LDQ F+IG NAHM  N++  PDYF HL L S LKV QAWLFA+
Sbjct: 538  CMLETKNQTRFDAVITSLDQNFQIGSNAHMVNNLQKMPDYFIHLNLQSTLKVVQAWLFAI 597

Query: 495  EHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCSSNINQRMLLRTKL 554
            + TLDGRGKMGSLVGASD+FK   GEN++LEYCQW+++F+N  C  S+N+NQRMLLRTKL
Sbjct: 598  DQTLDGRGKMGSLVGASDEFKRIDGENSVLEYCQWTLVFVNKFCQSSNNLNQRMLLRTKL 657

Query: 555  ENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNANINLQDPTSMLRNL 614
            EN G LRIMNK+K LDY+K+ +QI+ YE  KLDD N+LLES NK+ANI++Q+P S+L+NL
Sbjct: 658  ENAGFLRIMNKMKLLDYEKIRDQIEFYEAGKLDDFNSLLESQNKHANIDMQNPLSLLQNL 717

Query: 615  WDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDSLVTNV--SVSST-D 671
            WDAC+GT++E LL+SL+QHLFLSS++ I+  KDP +L++QLKL+DSLVTNV  SVS+  D
Sbjct: 718  WDACRGTDSENLLVSLVQHLFLSSTRLIQNNKDPTQLAKQLKLIDSLVTNVGSSVSAVAD 777

Query: 672  QEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKLKNAEHGLVGQ 731
            +E +M+M IQRL+D+MQTDEVARR+I+ESRTLTKK+EE+QAE+D L  KL  AE GLVG+
Sbjct: 778  EETTMSMTIQRLFDSMQTDEVARRAIIESRTLTKKMEELQAEKDRLGDKLSKAEGGLVGE 837

Query: 732  LQDELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLTILN--ARPEIV 789
            LQ ++ +RD IL+KNQRV                          RKMLTI+N  A P + 
Sbjct: 838  LQRDIRERDAILAKNQRVNKQLENELEELKRKTLMEKHEHEVELRKMLTIINSKASPNLA 897

Query: 790  EGNGTS--KKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTIQPNKRLK 847
            +    S  K    KN  +L   ++  IQ+ LQDGL+RTKKD++ DA+ FGMT+QPNKRL+
Sbjct: 898  QNPSASVLKSHDPKNKESLLSEQQSKIQKVLQDGLTRTKKDFTNDAKKFGMTVQPNKRLQ 957

Query: 848  LLRMQMEDIENEARELEMTNFTEYEKRXX---------------XXXXXXXXXXXXXXXX 892
            LLRM++EDIENEAR+LEMTNF + EK                                  
Sbjct: 958  LLRMKVEDIENEARQLEMTNFADIEKNATPVILTKGTKKKKSKKKLKTAQPDKKQRANQR 1017

Query: 893  XXDPSINKLNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDF 952
              +  I  LN LR  L  IQ ESNDISKFNV+E VNELF +++  AL+RL+DLE+K+   
Sbjct: 1018 NENQKIEALNKLRMALTAIQSESNDISKFNVEEHVNELFTERKFKALQRLRDLESKFNGL 1077

Query: 953  GIDFNIDELVDSASKDENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASD 1012
              +FNID+++ S  K     +    D  SLDP+    KLDE+ RLT++L ++ + +   +
Sbjct: 1078 NTNFNIDDIIASTEKALTATD----DGYSLDPRRADNKLDEIERLTNDLSKLHDSMKEQE 1133

Query: 1013 NNLXXXXXXXXXXXXXXXXXXXXXXXXXLIERQDTQSNFSGTSAGPGSFLEALTQKYATG 1072
                                          E    QS+ S  + G GSFL +L+QKY TG
Sbjct: 1134 QATLQSDNSSESSDSESVESDN--------EGSTVQSDVSEPTVGSGSFLASLSQKYETG 1185

Query: 1073 QKSA-SPRDQSTRMKDNIFINRIKQTNVAPPFLDELTDKVAEAPPVEASL 1121
            QK   SP      +    F+ R+K+++ AP +L EL+ K+ + P  + S+
Sbjct: 1186 QKQPNSP----VTVNQKAFMTRLKRSSGAPLYLQELSKKIPQRPAFDESV 1231

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/601 (66%), Positives = 470/601 (78%), Gaps = 18/601 (2%)

Query: 1276 IASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVLTDL 1335
            I SPL  QS S+FE YPRPQKKLKQLHWEKLD+T+NSIW  +KAEKFADDLYEKGVL++L
Sbjct: 1362 IPSPLFSQS-SIFEKYPRPQKKLKQLHWEKLDSTNNSIWSASKAEKFADDLYEKGVLSNL 1420

Query: 1336 EKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDF 1395
            EKAFAARE+KSL+SKK +D  KI+FL+RD+SQQFGINLHM+ NL V+++V KILKCDR+ 
Sbjct: 1421 EKAFAAREVKSLSSKKGDD-SKITFLTRDVSQQFGINLHMFGNLSVEELVTKILKCDREV 1479

Query: 1396 LHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYL 1455
            L++PSVIEFLSK E+VEVSVNLARNY+PYSTDWEGVK +EDAKAPEKDPNELQRADQLY+
Sbjct: 1480 LNSPSVIEFLSKQEVVEVSVNLARNYSPYSTDWEGVKRIEDAKAPEKDPNELQRADQLYM 1539

Query: 1456 QLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAV 1515
             L++NLQ YW SRMRAL VITT+++EY ELL KLRKVDKAV SLQ+SENLKNV NVILAV
Sbjct: 1540 SLMVNLQPYWSSRMRALKVITTYEREYAELLEKLRKVDKAVGSLQQSENLKNVLNVILAV 1599

Query: 1516 GNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVL 1575
            GNYMNDTSKQAQGFKLATLQRLTFIKD+TNSMTFLNYVEKIVR NYP+FNDFL EL+PVL
Sbjct: 1600 GNYMNDTSKQAQGFKLATLQRLTFIKDTTNSMTFLNYVEKIVRKNYPTFNDFLNELQPVL 1659

Query: 1576 DVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKG 1635
            DVVKISI+QLVSDC+EFS S+VNVERS+E GNLSDSSKFHP DRVL KVLP+LP+ARKK 
Sbjct: 1660 DVVKISIDQLVSDCQEFSGSVVNVERSIEIGNLSDSSKFHPSDRVLVKVLPVLPEARKKA 1719

Query: 1636 ELLGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQ 1695
            +LL DEVKLT++EF  LMQ YGEDS                I EYKKAQ QN+ AEEEEQ
Sbjct: 1720 DLLTDEVKLTMLEFNNLMQTYGEDSADKFAKNSFFKKFADFIQEYKKAQVQNVAAEEEEQ 1779

Query: 1696 VYERHKKMVEDQQKKLQEQXXXXXXXXXXXXXXXXXXXX------RRAMMDKLLDQLKNA 1749
             YERHKK+VE+QQ++ +E                           RRA+MDKLL+QLKNA
Sbjct: 1780 QYERHKKIVEEQQRQGEEARKRLESASPDATNGEDTTAVDDETKDRRAIMDKLLEQLKNA 1839

Query: 1750 GPSKTDPSSARKRALVRKKLMTE---STALLKDIETEDDSIIYSPEGKNPFVNPVDLDTP 1806
            G  K DPSSARKRAL R+KL+ +   ++ALL DI+T+DDS++YSP+ K   V  +   +P
Sbjct: 1840 GTVKADPSSARKRALARRKLLGDKDAASALLHDIDTDDDSLVYSPDTKRQSVGHLIGGSP 1899

Query: 1807 HDESEMDVXXXXXXXXXXXXXNSTLLSDDQDEVTDRAKALLMELRGS-NTPSKRNSLLDE 1865
                ++               +S     D ++VTDRAKALLMELRG  ++P K+N+ LDE
Sbjct: 1900 TPGDKL------LGSTPTKELSSPTAGQDDEDVTDRAKALLMELRGGQSSPMKKNAFLDE 1953

Query: 1866 H 1866
             
Sbjct: 1954 Q 1954

 Score =  137 bits (344), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 103/163 (63%), Gaps = 16/163 (9%)

Query: 71  KPLNKKTSLNTQNLSQYIND-----------KHSPQHTRXXXXXXXXXXXXXXXXXXXXX 119
           KPL+KK ++N+QNLS Y +              SP++T                      
Sbjct: 152 KPLSKKATMNSQNLSHYTSGVSATSSDGDGGMASPEYTHSRTQSGQTSRFSYTSPSRRSS 211

Query: 120 XXXXNQIARQHTNQSSA-SILSQGSFTNL-SKFIAP-DGKINLEMPRDPNEVEVLFEDIM 176
                ++A+ HT QSS  SI SQGS + L ++FI+P DGK+ LEMP DP EVE+L+EDIM
Sbjct: 212 SDA--KLAKYHTAQSSQNSIASQGSLSTLYNRFISPEDGKLRLEMPDDPAEVELLYEDIM 269

Query: 177 LKRNILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMRLK 219
            KRNILQ+LPTDKQ ELM+YD++KKWLIVKQDLQNE KK++ K
Sbjct: 270 YKRNILQNLPTDKQLELMNYDVKKKWLIVKQDLQNERKKLKTK 312

>TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa] {ON}
            Anc_1.82 YNL271C
          Length = 2170

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/650 (61%), Positives = 488/650 (75%), Gaps = 28/650 (4%)

Query: 1277 ASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVLTDLE 1336
            ++P    S + FE YPR QKKLKQLHWEKLD TDNSIW   KAE+FADDL+EKGVL  LE
Sbjct: 1425 SAPDFSTSPNFFEKYPRSQKKLKQLHWEKLDDTDNSIWVNGKAEEFADDLFEKGVLKRLE 1484

Query: 1337 KAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFL 1396
             AFAAREIKSLASKKKED  KI++LSRDISQQFGINLHM++NL VD +++KI++CDR  L
Sbjct: 1485 SAFAAREIKSLASKKKEDSTKITYLSRDISQQFGINLHMFSNLTVDQLIEKIIRCDRSIL 1544

Query: 1397 HTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQ 1456
            +TPSVI+FLSK EIVEVSVNLAR+YAPYSTDWEGVK V+DAK PEKDPNELQRADQ+YLQ
Sbjct: 1545 NTPSVIDFLSKQEIVEVSVNLARSYAPYSTDWEGVKDVKDAKPPEKDPNELQRADQIYLQ 1604

Query: 1457 LIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVG 1516
            L++NLQSYWGSRM AL V+T+++K+++EL+ KLR+VD AV S+Q+SENLKNVFNVILAVG
Sbjct: 1605 LMVNLQSYWGSRMIALKVVTSYEKDFDELIRKLRRVDLAVGSIQKSENLKNVFNVILAVG 1664

Query: 1517 NYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLD 1576
            N+MND SKQAQGFKLATLQRLTFIKDSTN+MTFLNYVE I+R NYP FNDFL EL+PVLD
Sbjct: 1665 NFMNDASKQAQGFKLATLQRLTFIKDSTNNMTFLNYVESIIRQNYPEFNDFLNELQPVLD 1724

Query: 1577 VVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGE 1636
            VVK+SIEQLV DCKEFSQ I+NV RSVE G LSDSSKFHPQD+VL KVLP+LP+A KK +
Sbjct: 1725 VVKVSIEQLVRDCKEFSQGIINVGRSVEIGKLSDSSKFHPQDKVLIKVLPVLPEATKKAD 1784

Query: 1637 LLGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQV 1696
            LL DEVKL+IMEF  LMQ++GEDS+               I EYK+AQ QN+K EEEE++
Sbjct: 1785 LLSDEVKLSIMEFENLMQVFGEDSKDKFAKNSFFKKFADFINEYKRAQEQNLKVEEEERI 1844

Query: 1697 YERHKKMVEDQQKKLQE--QXXXXXXXXXXXXXXXXXXXXRRAMMDKLLDQLKNAGPSKT 1754
            YE HKK +E+QQK+L++  +                    RR +MDKLL+QLKN GP KT
Sbjct: 1845 YENHKKRIEEQQKRLEDSKKKSHSDDTSNTDGTEEEEDEDRRDVMDKLLEQLKNVGPVKT 1904

Query: 1755 DPSSARKRALVRKKLMTE---STALLKDIETEDDSIIYSPEGKNPFVNPVDLD------- 1804
            DP+SARKRA+VRKKL  E   ++ +LK+ ET +DSI+YSP      + P  +        
Sbjct: 1905 DPTSARKRAMVRKKLQNEKETASQILKEFETGEDSIVYSPTDSK--ITPKKVSNEYLQSP 1962

Query: 1805 TPHDESEM-DVXXXXXXXXXXXXXNSTLLSDDQD-----EVTDRAKALLMELRGSNTPSK 1858
            TP ++S + D+             +  + +D  +     E+ DRAK+LL ELRGS TP++
Sbjct: 1963 TPGEKSSLADMTSTPNPTTITTTTDGKVTNDSSNDDLDQEIVDRAKSLLFELRGSQTPTR 2022

Query: 1859 RNSLLDEHKEKLRARRRKTNSDLHSGTRLQFVGETVPEKEVEPITGEPDG 1908
            +NS+L+E KEKLRARRR T SDL S  +L+FV         + + GEPD 
Sbjct: 2023 KNSVLEERKEKLRARRRNT-SDLTSN-KLKFVSSD------KTVDGEPDS 2064

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/847 (48%), Positives = 557/847 (65%), Gaps = 43/847 (5%)

Query: 315  PIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSS-D 373
            P  Y+K I+ D ++ +EM DLWVTLRTEQ+ WV+ F+E QGHIAMAN LMKS+Y+ ++  
Sbjct: 422  PNDYIKEILNDRLSVDEMNDLWVTLRTEQLTWVNTFLEDQGHIAMANSLMKSIYRINTMQ 481

Query: 374  GTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSITLSTRRMATEIF 433
             + +  L++KE  FFKCFRVLSMLSQGL EF +H++M+ T+ +GLFS  L+TR++ATEIF
Sbjct: 482  NSLSTYLIDKEYNFFKCFRVLSMLSQGLTEFIKHKLMTDTLVQGLFSTRLATRKIATEIF 541

Query: 434  VCMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHL--TLDSQLKVTQAWL 491
            V ML+K N +   ++L   D+ F I  N +M   +K  PD + +L  T  +Q+KV  +WL
Sbjct: 542  VLMLQKINDDGLNILLTTFDKTFSINENLNMVYLLKNVPDKYHYLNSTNTTQIKVLVSWL 601

Query: 492  FAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCSSNINQRMLLR 551
            +AVE TLDGRGKMGSLVGAS DFK +GGENAILEYCQW+M+ IN LC+ S+ INQR+LLR
Sbjct: 602  YAVESTLDGRGKMGSLVGASQDFKITGGENAILEYCQWTMVLINRLCNASTIINQRVLLR 661

Query: 552  TKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNANINLQDPTSML 611
            TKLEN G +RIMNK+K LDY+K+ EQ++ YEN KLDDLNTLLE + K++ ++L +P S+L
Sbjct: 662  TKLENIGSIRIMNKLKKLDYEKITEQLEDYENKKLDDLNTLLEQDTKSS-VDLDNPISLL 720

Query: 612  RNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDSLVTNVSVSSTD 671
             +L + CK TE E+ L S++QHL+LSSS+  ++K DP KLS+QLKL+DSL+T+ ++S+ D
Sbjct: 721  SHLLEVCKDTEGEQSLTSIIQHLYLSSSKLFDDKDDPTKLSKQLKLMDSLMTDATLSTVD 780

Query: 672  QEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKLKNAEHGLVGQ 731
             E+ MNMAIQ LYD+M TD+VARR+ILESR LTKKLEEVQAERD LS +L  AE+GLVG+
Sbjct: 781  NESKMNMAIQHLYDSMVTDDVARRAILESRNLTKKLEEVQAERDFLSNRLSEAENGLVGK 840

Query: 732  LQDELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLTILNARPEIVEG 791
            L++ELAQRD IL+KNQRV                          RKMLTILN+RPE    
Sbjct: 841  LENELAQRDSILAKNQRVTQQLRTELDELKKKHLMEKHDHEVELRKMLTILNSRPETELD 900

Query: 792  NGTSKKTKAK-NPSALDP----SKKQSIQQALQDGLSRTKKDYSVDARNFGMTIQPNKRL 846
            N  S  ++ K N   ++      +K+ I++ALQDGL +TKKD S+D++ FG+T+QPNKRL
Sbjct: 901  NTMSSISRTKRNKHEIEKLELLKRKKVIEKALQDGLQKTKKDLSLDSKRFGITVQPNKRL 960

Query: 847  KLLRMQMEDIENEARELEMTNFTE--------YEKRXXXXXXXXXXXXXXXXXXXXDPS- 897
            + LR+QMEDIENEAR+LEMTNFT+         EKR                    D S 
Sbjct: 961  QALRLQMEDIENEARQLEMTNFTDPVRTPKKGQEKRDSHNKHPSLKPGIPIAKKNKDRSE 1020

Query: 898  -----INKLNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDF 952
                   KL +LR+ LA+IQ E+NDIS+FNV+E VNELFN K+I A++RL++LET Y++F
Sbjct: 1021 EMAKKQQKLAELRKALADIQQETNDISRFNVEEHVNELFNAKKIQAMERLKELETMYQNF 1080

Query: 953  GIDFNIDELVDSASKDENGNNQQSGDYSSLDPKAYQRKLDELNRLT---DELLR-VKNKV 1008
            G+DFN++E ++  +      +  S  Y +LDP  +  K+DEL++ +   D+L   + N +
Sbjct: 1081 GVDFNMEEFLEKNNTSTKELDPDSPAYETLDPNLFIDKMDELDKFSMKLDQLTSDLNNTM 1140

Query: 1009 NASDNNLXXXXXXXXXXXXXX-----XXXXXXXXXXXLIERQDTQSNFS--GTSAGPGSF 1061
            +A  N+L                                   D  S FS   T++G  SF
Sbjct: 1141 SAKQNSLSTTNSNQISTPSSTSSSDFESDEENENTALSNNVNDNSSTFSHQSTTSGGSSF 1200

Query: 1062 LEALTQKYATGQKSASPRDQSTRMKDNI-----FINRIKQTNVAPPFLDELTDKVAEAPP 1116
            LE+L+QKY TGQ ++ P   +T    +      F++R+K+ +  P ++ EL  KV+    
Sbjct: 1201 LESLSQKYGTGQNASGPMSSNTPNVSHYNPERKFMSRMKKQHATPNYIRELNQKVS---- 1256

Query: 1117 VEASLAE 1123
            V  SL+E
Sbjct: 1257 VTHSLSE 1263

 Score =  138 bits (348), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 65/88 (73%), Positives = 75/88 (85%)

Query: 132 NQSSASILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRNILQSLPTDKQN 191
           N +S+SILSQGS  NL KF+ PDGK+NLEMP +P EVE L+EDIM KRNILQ+LP DKQ 
Sbjct: 180 NPNSSSILSQGSLHNLMKFMTPDGKVNLEMPNNPAEVEALYEDIMYKRNILQNLPADKQR 239

Query: 192 ELMSYDLEKKWLIVKQDLQNEMKKMRLK 219
           ELMSYD+ KKWLIVKQDLQ+E+KKMR K
Sbjct: 240 ELMSYDVSKKWLIVKQDLQSELKKMRSK 267

>TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_1.82
            YNL271C
          Length = 1940

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/623 (62%), Positives = 470/623 (75%), Gaps = 29/623 (4%)

Query: 1277 ASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVLTDLE 1336
             S +L +S SL+  YPRPQKKLKQLHW+KLD ++ SIW +  AE+FADDLYEKGVL +LE
Sbjct: 1249 GSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVLHNLE 1308

Query: 1337 KAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFL 1396
            KAFAAREIKSLA+KKKEDLDKISFLSRDISQQFGINLHM+ +L VD++V KILKC+RD +
Sbjct: 1309 KAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVM 1368

Query: 1397 HTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQ 1456
            +TPSVIEFLSKPEI +VS+NLARNYAPY TDWEGVK VEDAKAPEK  + LQRADQ+Y+Q
Sbjct: 1369 NTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQ 1428

Query: 1457 LIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVG 1516
            L++NLQSYW SRMRA+ VIT+++KEY EL+TKLR++D AVS++Q+S+NL N+FNVILAVG
Sbjct: 1429 LMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVG 1488

Query: 1517 NYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLD 1576
            NYMND+SKQAQGFKL TLQRLTFIKDSTNSMTFLNYVEKI+R NYP FN F+ ELEPVLD
Sbjct: 1489 NYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELEPVLD 1548

Query: 1577 VVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGE 1636
            VVKIS+EQLV+DC EF+QSI+NVERS+E GNLSDSSKFHP D+V+ KVLP+LP+A KK +
Sbjct: 1549 VVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSD 1608

Query: 1637 LLGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQV 1696
            LL DEVKLT MEF  LMQ +GEDS                I EYKKA+ QN+KAEEE + 
Sbjct: 1609 LLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRK 1668

Query: 1697 YERHKKMVEDQQKKLQEQXXXXXXXXXXXXXXXXXXXXRRAMMDKLLDQLKNAGPSKTDP 1756
            YERHK+MVE+QQ+K +EQ                     R  MDKLL QLKNAGP+++DP
Sbjct: 1669 YERHKQMVEEQQRKAKEQEKNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPARSDP 1728

Query: 1757 SSARKRALVRKKLMTE---STALLKDIETEDDSIIYSPE---------GKNPFV------ 1798
            SSARKRA++RKKL++E   ++ +L D+   D SIIYSP          G++  +      
Sbjct: 1729 SSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDEMILKSPTP 1788

Query: 1799 ---NPVDLDTPHDESEMDVXXXXXXXXXXXXXNSTLLSDD-------QDEV-TDRAKALL 1847
               + ++ D   D+S  D                T ++DD       +DEV TDRAKALL
Sbjct: 1789 KSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITDDGNSNGDGEDEVITDRAKALL 1848

Query: 1848 MELRGSNTPSKRNSLLDEHKEKL 1870
            MELRGS TPSK+NS LD+ +EKL
Sbjct: 1849 MELRGSQTPSKKNSHLDDQREKL 1871

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/830 (46%), Positives = 532/830 (64%), Gaps = 74/830 (8%)

Query: 315  PIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSSDG 374
            PIHYV++I++DT++  E+ DLWVTLRTEQ+DWVDAF+EHQGHIA+AN L++ +YKT+   
Sbjct: 334  PIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCIYKTAPGS 393

Query: 375  TPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSITLSTRRMATEIFV 434
              + +L+EKE  FFKCFRVL+ML QGL EFT+H++M  T+A GLFS  +STR+MA EI V
Sbjct: 394  NLSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTRKMALEILV 453

Query: 435  CMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHLTLDSQLKVTQAWLFAV 494
             ++ KKN +RF+ ++ +LD+ F++  N +M + I  F   F+  + D+Q K+ QA++ ++
Sbjct: 454  YIINKKNTQRFESVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKIFQAFVISL 513

Query: 495  EHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCSSNINQRMLLRTKL 554
            E TL+GRGKMGS VGASDDFK SGGENAILEYC W++IFIN LC+ S  +NQR++LRTK 
Sbjct: 514  ESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQRVVLRTKF 573

Query: 555  ENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNANINLQDPTSMLRNL 614
            EN G LR+M K+K +DY+K+  Q++ YE++KLDD N+LLE  + +A IN+QDPTS++ +L
Sbjct: 574  ENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDPTSLIGSL 633

Query: 615  WDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDSLVTNVSVSSTDQEA 674
            W+ CKGTENEKLL+SLMQHLFLSSS+ +++K++P KLS+QLKL+DSL+TN++ S  D++ 
Sbjct: 634  WEVCKGTENEKLLLSLMQHLFLSSSKLVDDKREPAKLSKQLKLMDSLMTNITASEVDEQT 693

Query: 675  SMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKLKNAEHGLVGQLQD 734
             MN+AIQRLYD+MQTD+VARR+ILE+RTL+KKLEEV AE++ L +KL  AE+GLVGQL+ 
Sbjct: 694  HMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENGLVGQLEL 753

Query: 735  ELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLTILNARPEIVEGNGT 794
            EL QRD IL+K+QRV                          RK+LTI+N          T
Sbjct: 754  ELEQRDNILTKSQRVTKQLQAELEDLKKKHLLEKHEHEVELRKILTIVNT--------NT 805

Query: 795  SKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTIQPNKRLKLLRMQME 854
                   N S     KK +IQ+AL+  LSRTKKD + D + FG+++QPNKRL++LR+QME
Sbjct: 806  DADASLNNSS----DKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRMLRLQME 861

Query: 855  DIENEARELEMTNFTEYEKRXXXXXXXXXXXXXXXXXXXXDPSI---------------- 898
            DIE EARELEMTNF+E++K                       S                 
Sbjct: 862  DIEKEARELEMTNFSEHQKLSLESPAVLNKTKKETKKKSKKKSKSSKSKEENNRKRANAI 921

Query: 899  --NKLNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDF 956
               KL +LR+ LA IQ E+ND+SKFNVD+RVNELF +K+  AL RLQ LE KYK F IDF
Sbjct: 922  KKQKLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYKSFEIDF 981

Query: 957  NIDELVDSASKDENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNLX 1016
            + ++    A  D N +      Y SLDP    +K+ +++R+ DEL               
Sbjct: 982  DPNDF-KQAQLDSNAS------YESLDPNFVTKKITDIDRIADEL--------------- 1019

Query: 1017 XXXXXXXXXXXXXXXXXXXXXXXXLIERQDTQSNFSGTSAGP-------GSFLEALTQKY 1069
                                      E+   +SN   T  GP        SFLE+L++KY
Sbjct: 1020 -------DAFSGDGTSSYSSSSLSDSEKNYYESNAVPT-IGPQKGLIDGSSFLESLSEKY 1071

Query: 1070 ATGQKSA-------SPRDQSTRMKDNIFINRIKQTNVAPPFLDELTDKVA 1112
             T Q +        SP+++   + +  F+NR K+   +  FL+EL+ KV 
Sbjct: 1072 GTAQNTEGTSLSPLSPQNRIASLGEKSFMNRFKRKPSSMQFLEELSQKVG 1121

 Score =  140 bits (354), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 121/231 (52%), Gaps = 47/231 (20%)

Query: 25  IFQNLRRLTNPSS-----NHTNKXXXXXXXXXXXXXERDSTTTRESHTNSLKPLNKKTSL 79
           +  NL++LTN SS     N  NK              +    T +   + LKPLNK+TSL
Sbjct: 26  LLHNLKKLTNSSSTTSQNNAINKSDISS--------PKSQLLTNKLSMDDLKPLNKRTSL 77

Query: 80  NTQNLSQYIN-----------------------------DKHSPQHTRXXXXXXXXXXXX 110
           N QNLSQYIN                             D  SP H R            
Sbjct: 78  NNQNLSQYINGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSASVQSSAKYSY 137

Query: 111 XXXXXXXXXXXXXNQIARQHTN--QSSASILSQGSFTNLSKFIAPDGKINLEMPRDPNEV 168
                         +++RQ TN   S+ S+ SQGS+ NLSK++  +G++NL+MP D +E+
Sbjct: 138 SRRSSNSTAAT---RLSRQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMPTDTHEI 194

Query: 169 EVLFEDIMLKRNILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMRLK 219
           E LFE++M KRNILQ+L  DKQ ++M+YD +KKW+IVKQDLQNE+K+++LK
Sbjct: 195 ESLFEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQNELKRIKLK 245

>Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] {ON}
            YNL271C (BNI1) - contains formin homology domains;
            homologous to BNR1 (BNI1 related protein) [contig 118]
            FULL
          Length = 1968

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/624 (60%), Positives = 467/624 (74%), Gaps = 23/624 (3%)

Query: 1278 SPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVLTDLEK 1337
            SP+LPQS SLFE YPRP KKLKQLHWEK+D  ++SIWK  KAE+FADDLYEKG+L+ LEK
Sbjct: 1305 SPMLPQSPSLFERYPRPTKKLKQLHWEKIDDAEDSIWKNAKAEQFADDLYEKGILSRLEK 1364

Query: 1338 AFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLH 1397
            AFAAREIKSL S+KK+D DK++FLSRD+SQQFGINLHMY++L V++VV KILKCD+DFL 
Sbjct: 1365 AFAAREIKSLTSRKKKDSDKLTFLSRDVSQQFGINLHMYSSLSVEEVVTKILKCDKDFLT 1424

Query: 1398 TPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQL 1457
            TPSVIEFLSK EIVEVS NLARN+APY+TDWEG+ +V+DAK PEKDP+ELQRAD+LYL+L
Sbjct: 1425 TPSVIEFLSKQEIVEVSNNLARNFAPYTTDWEGITNVKDAKPPEKDPSELQRADRLYLEL 1484

Query: 1458 IINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGN 1517
             +NLQ YW SRMRAL VIT+++KEY++L+ KLR +DKA  ++Q+SENL+NV +VILAVGN
Sbjct: 1485 FVNLQGYWSSRMRALKVITSYEKEYSDLIHKLRMIDKATCAIQQSENLRNVLDVILAVGN 1544

Query: 1518 YMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDV 1577
            +MND+SKQAQGF+LATLQRLTFIKD  NSMTFLNYVEKIVR  YP FN FL ELEPV+  
Sbjct: 1545 FMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIVRETYPEFNVFLKELEPVVAA 1604

Query: 1578 VKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGEL 1637
            VKISIEQ+  DCKEFSQS++NVERSV+ GNLSDSSKFHP DR L KVLP+LP+ARKKG+L
Sbjct: 1605 VKISIEQVSQDCKEFSQSVINVERSVDIGNLSDSSKFHPLDRTLLKVLPVLPEARKKGDL 1664

Query: 1638 LGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVY 1697
            L DE+KLT++EF  LM+++GED+                + EYKKAQ  N+K EEEE+ Y
Sbjct: 1665 LMDEMKLTLLEFDNLMKMFGEDAMDKFSRNSFFKKFADFLQEYKKAQTYNMKLEEEEKAY 1724

Query: 1698 ERHKKMVEDQQKKLQEQXXXXXXXXXXXXXXXXXXXXRRAMMDKLLDQLKNAGPSKTDPS 1757
            ER KKMVE+QQ++ +E                      R +MD+LL++LKNAGP K+DPS
Sbjct: 1725 ERRKKMVEEQQRRARESNEQENSVDGNADDNTAASGD-RDVMDRLLEKLKNAGPGKSDPS 1783

Query: 1758 SARKRALVRKKLMTESTA---LLKDIET---EDDSIIYSPEGKNPFVNPVDLD-TPHDES 1810
            SARKRA+ R+KL+  S++   +L + E    E  S++YSPE +    N VD   TP    
Sbjct: 1784 SARKRAIARRKLLQGSSSNSTILDNFEIEKPEGKSLVYSPE-QVTLSNSVDHSPTP---- 1838

Query: 1811 EMDVXXXXXXXXXXXXXNSTLLSDDQDEVTDRAKALLMELRGSNTPSKRNSLLDEHKEKL 1870
              DV              S + + +  ++TDRA+ LL+ELRG  +PS+R S  D+   KL
Sbjct: 1839 --DVRKREGQSTA-----SEVQTSESSDLTDRARNLLIELRGPESPSRRASSKDQRISKL 1891

Query: 1871 RARRRKTNSDLHSGT--RLQFVGE 1892
            RARR+   S  +SG+   L FVG+
Sbjct: 1892 RARRKNDGSG-NSGSDNHLNFVGQ 1914

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/1130 (37%), Positives = 607/1130 (53%), Gaps = 106/1130 (9%)

Query: 25   IFQNLRRLTNPSSNHTNKXXXXXXXXXXXXXERDST--TTRESHTNSLKPLNKKTSLNTQ 82
            IF NL+RLT  ++N +++             ++ +   T   SH    KPL+K+++LN  
Sbjct: 27   IFSNLKRLTGNANNSSSQTLQKVDISDISSPKKINLPDTGEFSH----KPLSKQSTLNIA 82

Query: 83   NLSQYINDKHSPQHTRXXXX------XXXXXXXXXXXXXXXXXXXXXNQIARQHTNQS-- 134
            NLS Y +   +  H R                                +++RQ TNQS  
Sbjct: 83   NLSAYTD--VASTHNRSSSAASNSSPTKYSYSRRASQWSSNGGTAPSTKLSRQQTNQSIS 140

Query: 135  SASILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRNILQSLPTDKQNELM 194
            SASI SQGSF+NLSKF+ PDG I LE PRDP E+E LFE+++ KRN+ QSLP   Q EL 
Sbjct: 141  SASIFSQGSFSNLSKFVGPDGSIRLEKPRDPREIEELFEEVLYKRNVYQSLPPSAQKELN 200

Query: 195  SYDLEKKWLIVKQDLQNEMKKMRLKXXXXXXXXXXXXXXXXXXXXXXXXINLNSPATMQM 254
            +YDLEKKWL+V+QDLQ+E+KK                            I   SP+T   
Sbjct: 201  NYDLEKKWLMVRQDLQSEVKKF--------MNNKSVSKSPAAASTGISLIAPESPSTGHF 252

Query: 255  SPXXXXXXXXXXXXXXXXTPITISKRPTGPISNPIPNADMYXXXXXXXXXXXXXXXXXXP 314
            +                    +++        NP  +   Y                   
Sbjct: 253  ASNSSINE-------------SLAGSSRSRAQNPGTSDQFYGSNNGTSSTTTLSQDPSHL 299

Query: 315  PIHYVKRII-ADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSSD 373
               Y  R I  + I+++ + DLWV+LRTEQ+DWV  F+E QG +A+AN+++K+ Y+ S D
Sbjct: 300  SPDYYVRKIICNNISAKRLNDLWVSLRTEQLDWVVGFLEAQGQVAIANVILKTCYRESPD 359

Query: 374  GTPNPQLLEKENAFFKCFRVLSMLSQGLREFT---RHEIMSQTVARGLFSITLSTRRMAT 430
                 ++L+KE A+FKC +    L +G  E       +I+   +  GL S+ ++TRR+A+
Sbjct: 360  NLLGDEVLDKEFAYFKCLKTSLNLKEGADEAVLSNSAKIIISAIIEGLLSLRVATRRIAS 419

Query: 431  EIFVCMLEKKNPERFKVILNALDQKFKIGYNAHM-------TQNIKMFPDYFTHLTLDSQ 483
            E+ V + +   P  F  ++NALDQ+ +   N H+       T N ++     + L  D+ 
Sbjct: 420  ELLVSLSQWALPHGFTHVMNALDQESRFCDNVHLQARLLSQTSNKEIKNSLRSSLLADNN 479

Query: 484  ----LKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCS 539
                ++  + W+  VE+TLDGRGKMGSLVGAS+DF+ SGGENAI+EY   +++ +NHLC 
Sbjct: 480  GDRIMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLVNHLCQ 539

Query: 540  CSSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKN 599
               ++ QR +LR +L+N G+ RI+NK+K L+Y+KV EQ+ ++E++  DD +TL       
Sbjct: 540  TPVDVKQRTILRARLKNAGLPRILNKMKRLNYEKVDEQLAIFEDSTTDDFDTLYSQGPNG 599

Query: 600  ANINLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQF-IEEKKDPVKLSRQLKLL 658
              IN+QDP SM +NLWD CKGTE E+ L+SL+Q+L +S+ +     K+DP + ++QLKL+
Sbjct: 600  ELINMQDPVSMTQNLWDLCKGTEAEEHLMSLLQNLLISTGELGGTSKEDPAQRTKQLKLI 659

Query: 659  DSLVTNVSVSSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLS 718
            D+LV+NVS++S D ++S N AIQRLYDAMQTDE+ARR+ILE+R   K+ EE++AER+ L 
Sbjct: 660  DALVSNVSMASVDLQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKAERNNLK 719

Query: 719  QKLKNAEHGLVGQLQDELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKM 778
            +KL NAE GLVGQLQ+EL QRD IL K+QRV                          RK 
Sbjct: 720  EKLSNAEGGLVGQLQEELKQRDHILEKSQRVTAQLQHELDESKKKLILAKHQHEVELRKT 779

Query: 779  LTILNARPEIVEGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGM 838
            LT LN++     G           P  L P +  +IQ+ALQ  L +T K+ +V++   G+
Sbjct: 780  LTALNSK-----GGDIQLTEDGGQPKPLKPERMLAIQRALQIKLEKTSKEITVESSRLGV 834

Query: 839  TIQPNKRLKLLRMQMEDIENEARELEMTNFTEY----EKRXXXXXXXXXXXXXXXXXXXX 894
            +++PNKRL+LLR +ME+IEN+ARELEMTNF+EY    +K                     
Sbjct: 835  SLEPNKRLRLLRSRMEEIENQARELEMTNFSEYREDADKEIEMAHEGTHMYPSDVDVGTT 894

Query: 895  DPSINKLNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGI 954
              S  KL  LR+ LA +Q ESNDISKFNV+ R +E+F+ ++I AL RL+ LE  Y  FGI
Sbjct: 895  QDSNLKLEQLRRKLASLQNESNDISKFNVEGRFHEMFSDQKIQALDRLKKLENDYSGFGI 954

Query: 955  DFNIDELVDSASKDENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNN 1014
            +++  E    + K E G  Q      +LDPK     +DE    TD       + NAS ++
Sbjct: 955  NYDPAE--SPSLKQEQG--QDVNKSRTLDPKGPNNSVDESQLETD-------RANASIDS 1003

Query: 1015 LXXXXXXXXXXXXXXXXXXXXXXXXXLIERQDTQSNFSGTSAGPGSFLEALTQKYATGQK 1074
                                       +E +D     S T    GSFLE L+QKY  GQ 
Sbjct: 1004 ---------------------SPASESLEEEDVHLTKSTTEEIGGSFLERLSQKYGKGQA 1042

Query: 1075 SASPRDQSTRMKDNI---------FINRIKQT-NVAPPFLDELTDKVAEA 1114
            + S R+     +++          F+NR+K++ NV  P+L+EL+ K   A
Sbjct: 1043 NLSNRNSVVGRENSYPGSGYHRKSFMNRVKKSDNV--PYLEELSGKFGTA 1090

>SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1988

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/625 (61%), Positives = 462/625 (73%), Gaps = 12/625 (1%)

Query: 1278 SPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVLTDLEK 1337
            SPLLPQS SLFE YPRP+KKLKQLHWEK++ T NSIWK  KAEK+ADDLYE+GVL  LEK
Sbjct: 1297 SPLLPQSPSLFERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEK 1356

Query: 1338 AFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLH 1397
            AFAAREIK LA+++KEDL+K++FLSRD+SQQFGINLHMYA L V +VV KIL+CD+DFL 
Sbjct: 1357 AFAAREIKLLANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLG 1416

Query: 1398 TPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQL 1457
            + SVI+FL KPEIVEVS NLARN+APYST+WEGV SV++AK PEKDP ELQRADQLYL++
Sbjct: 1417 SASVIDFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEM 1476

Query: 1458 IINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGN 1517
            ++NLQ YW SRMRAL VITT++KEY++LLTKLR +DKAVSS+Q S+NL++VF VILAVGN
Sbjct: 1477 MVNLQGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGN 1536

Query: 1518 YMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDV 1577
            YMND+SKQA GFKLATLQRLTFIKD  NSMTFLNYVEKI+R NY  FN FL ELEPVLDV
Sbjct: 1537 YMNDSSKQAHGFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDV 1596

Query: 1578 VKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGEL 1637
            VKIS+EQL +DC+EFSQ+IVNVERS+E GNLSDSSKFHP DRVL KVLP+LP+ARK+ +L
Sbjct: 1597 VKISVEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDL 1656

Query: 1638 LGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVY 1697
            L DEVKLT+MEF  LMQ++GED+                I EYKKAQ  NIK EEEE+ Y
Sbjct: 1657 LSDEVKLTLMEFDGLMQMFGEDASDKFAKNSFFKKFADFIQEYKKAQAHNIKMEEEERAY 1716

Query: 1698 ERHKKMVEDQQKKLQ-EQXXXXXXXXXXXXXXXXXXXXRRAMMDKLLDQLKNAGPSKTDP 1756
            ER KKMVE+Q K+ + E                      R +MDKLL++LKNAGP K+DP
Sbjct: 1717 ERRKKMVEEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGKSDP 1776

Query: 1757 SSARKRALVRKKLM---TESTALLKDIETED-----DSIIYSPEGKNPFVNPVDLD--TP 1806
            SSARKRAL RKKL+     S  +L + E ++      S++YSPE      N    +  TP
Sbjct: 1777 SSARKRALARKKLLDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAANAAHAESPTP 1836

Query: 1807 HDESEMDVXXXXXXXXXXXXXNSTLLSDDQDEVTDRAKALLMELRGSNTPSKRNSLLDEH 1866
                +  V              S   S   ++V DRA+ LL ELRG  +  KR  LL++H
Sbjct: 1837 KASRQGSVAGSGATATPLLESPSKQASAGPEDVADRARNLLKELRGPES-EKRKPLLEDH 1895

Query: 1867 KEKLRARRRKTNSDLHSGTRLQFVG 1891
            +EK+RARRR+ N    S  +L FVG
Sbjct: 1896 REKMRARRRRVNEGASSENKLVFVG 1920

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/897 (41%), Positives = 543/897 (60%), Gaps = 76/897 (8%)

Query: 315  PIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSSDG 374
            P +YV++II+D I+++++KDLWV+LRTEQ+DWV  F++ QG +A+AN+L++  +K S D 
Sbjct: 301  PDYYVRKIISDKISTKQLKDLWVSLRTEQLDWVVGFLDAQGQVAIANVLLRFFHKESPDA 360

Query: 375  TPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSITLSTRRMATEIFV 434
              N + L+KE AFFKC + L  L +G  E  R +++   +  GL S+ +STRR+A+E+ V
Sbjct: 361  LLNDEALDKEFAFFKCLKTLLNLKEGANEAVRTKLVVSAITDGLLSLRISTRRIASEMLV 420

Query: 435  CMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIK--------MFPDYFTHLTLDSQLKV 486
             + +   P     ++  LDQ+  +  N H+   +         +  D+   LT D   K 
Sbjct: 421  FITQWDIPYGLNQVIGELDQESHVSSNVHLQARLLSANKRDSLLAQDHELDLTRDHASKK 480

Query: 487  TQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCSSNINQ 546
             + WLF VE+TLDGRGKMGSLVGAS+DFK++GGENAILEY   +++ +N LC+  +++NQ
Sbjct: 481  FEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQ 540

Query: 547  RMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNANINLQD 606
            R LLR++ ++CG+ RIM K++ L+YDK+ EQ+ ++E+   DD NT++ S + N N+++++
Sbjct: 541  RTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNVDMEN 600

Query: 607  PTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDSLVTNVS 666
            P S+L+NLW++ KGT  EK L+SL+QHLF++SS+  +E  DP + S+QLKL+DSLV+NV+
Sbjct: 601  PLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDDPTEASKQLKLIDSLVSNVT 660

Query: 667  VSSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKLKNAEH 726
            +SS D E+S N AIQRLYD+MQTDEVARR+I+E+R LT+K EEV+AERD L +KL  AE 
Sbjct: 661  MSSIDTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGEKLSKAEG 720

Query: 727  GLVGQLQDELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLTILNARP 786
            GLVGQLQ+EL+QRDRIL KNQRV                          RK+LTILN+RP
Sbjct: 721  GLVGQLQNELSQRDRILEKNQRVTEQLQADLEELKKKHLLEKHEHEVELRKLLTILNSRP 780

Query: 787  EIV-----EGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDAR----NFG 837
            +       E  GT+  +    P  L   +K +IQ+ALQD L +TKKD + +++      G
Sbjct: 781  QGSSAVQEEEAGTASSSA---PGVLHADRKLAIQKALQDRLQQTKKDLTKESKRLGTTLG 837

Query: 838  MTIQPNKRLKLLRMQMEDIENEARELEMTNFTEYEKRXXXXXXXXXXXXX---------- 887
             T++PN+RLKLLR +MEDIENEARELEMTNF + +++                       
Sbjct: 838  TTLEPNRRLKLLRSRMEDIENEARELEMTNFADIQRQTVEEQTVVPALPPPAVPVLDRAP 897

Query: 888  XXXXXXXDPSINKLNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLET 947
                   +  + KL +LRQ LA +Q ESND+SKFNV+ER+NELFN K+++AL RL++LET
Sbjct: 898  KAKKQVKEDQVRKLRELRQRLASVQKESNDVSKFNVEERINELFNDKKLSALDRLKELET 957

Query: 948  KYKDFGIDFNIDELVDSASKDENGNNQQSGD---YSSLDPKAYQRKLDELNRLTDELLRV 1004
            KYK FGIDF  D  + +   D    N  + D   + SLDPK   RK++E++++ DEL   
Sbjct: 958  KYKGFGIDFQADPELSAMLSDAPPENHHAKDGQAHPSLDPKHLSRKIEEMSKIVDELTAF 1017

Query: 1005 KNKVNASDNNLXXXXXXXXXXXXXXXXXXXXXXXXXLIERQDTQSNFSGTSAGPGSFLEA 1064
            K ++     +                           +E+ D  S  SG +A  GSFLE 
Sbjct: 1018 KKEIENGPPSSSSSSSDEE------------------LEQDDRASIHSG-NASTGSFLET 1058

Query: 1065 LTQKYATGQKS---ASPRDQSTRMKD--------NIFINRIKQTNVAPPFLDELTDKVAE 1113
            L+QKY TGQ +   AS R    R  +          F+ R+K+++ A PFL ELT KVA 
Sbjct: 1059 LSQKYGTGQNAGPTASSRAMVGRESNYPGRGYHRRSFMERVKKSDAA-PFLSELTQKVAP 1117

Query: 1114 APPVEASLAEPDNNNTINESSKEETGEANLTSSDNEVVAQA-------SLSNPEVSP 1163
              P++ +         +   S+EE     + S  N  V +         +SN EV+P
Sbjct: 1118 KTPIDGAY-----EIEVGARSEEEHIGIGIPSKRNGTVVEGMKDADNSGVSNAEVAP 1169

 Score =  140 bits (354), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 98/155 (63%), Gaps = 8/155 (5%)

Query: 69  SLKPLNKKTSLNTQNLSQYINDKHSPQHTRXXXXXXXXXXXXXXXXXXXX-----XXXXX 123
           S KPL+K+T+LNTQNLS Y+ D ++P H R                              
Sbjct: 67  SGKPLSKQTTLNTQNLSSYV-DMNTPHHNRSPSGMSGSPTKYSYSRRSSQWSNGNNIGNG 125

Query: 124 NQIARQHTNQS--SASILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRNI 181
            +++RQ TNQS  SASI SQGS TNL+KF+  DGK+ L+ P +P E+E LF ++M KRN 
Sbjct: 126 GRLSRQQTNQSLSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNF 185

Query: 182 LQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKM 216
            QSLP   Q ELM+YDL+KKWL+VKQDLQ+E+KK+
Sbjct: 186 FQSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKL 220

>AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNL271C (BNI1)
          Length = 1918

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/595 (61%), Positives = 439/595 (73%), Gaps = 38/595 (6%)

Query: 1278 SPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVLTDLEK 1337
            SPLLPQS SLFE YPRP+KKLKQLHWEK+D  DNSIW+  +AEKFADDLYEKGVL++LEK
Sbjct: 1357 SPLLPQSPSLFERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEK 1416

Query: 1338 AFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLH 1397
            AFAAREIKS   +KK++ +KI+FLSRDISQQFGINLHMY++LPV  VV KILKCD+DFL 
Sbjct: 1417 AFAAREIKSFKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLS 1476

Query: 1398 TPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQL 1457
            T S IEFLSKPEIVEVS N+AR++APY+TDWEGV SVEDAK+PEKDP+ELQR+DQL+L L
Sbjct: 1477 TQSAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNL 1536

Query: 1458 IINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGN 1517
            I+NLQSYW SRMR L +ITT++K+YN+L+ KLR +DKAV ++Q+SENL+NVF+VILAVGN
Sbjct: 1537 IVNLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGN 1596

Query: 1518 YMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDV 1577
            YMNDTSKQAQGFKL+TLQRLTFIKD  NSMTFLNYVE+IV  NYPSFN FL ELEPVL V
Sbjct: 1597 YMNDTSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQV 1656

Query: 1578 VKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGEL 1637
            VKISIEQL +DC EF  ++ NVERS+E GNLSDSSKFHP DRVLAKVLPILP+ARKK  L
Sbjct: 1657 VKISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANL 1716

Query: 1638 LGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVY 1697
            L DEV+L++MEF  LM+++GED++               I EYK+AQ  N K +EEE+ Y
Sbjct: 1717 LADEVQLSLMEFENLMRMFGEDADDKFAKNSFFKKFADFILEYKRAQEFNRKIDEEERAY 1776

Query: 1698 ERHKKMVEDQQKK---LQEQXXXXXXXXXXXXXXXXXXXXRRAMMDKLLDQLKNAGPSKT 1754
            ER K M+++QQ++   +QE                      R +MDKLL++LKNAGPSK 
Sbjct: 1777 ERRKLMIQEQQRRAKLVQEGDETTCARLSAISASGDD----RDVMDKLLEKLKNAGPSKG 1832

Query: 1755 DPSSARKRALVRKKLMT--ESTALLKDIETEDDSIIYSPEGKNPFVNPVDLDTPHDESEM 1812
            DPSSARKRAL RKKLM   E + +L+ ++ +D       +   P V P   DTP      
Sbjct: 1833 DPSSARKRALARKKLMGGREGSIILEGLDVDD------LQSAAPDVQP---DTP------ 1877

Query: 1813 DVXXXXXXXXXXXXXNSTLLSDDQDEVTDRAKALLMELRGSNTPSKRNSLLDEHK 1867
                            +   S   D   DRA+ LL+ELR    P  R S+LDEHK
Sbjct: 1878 --------------LRAASASPPPDPAADRARHLLLELRNGEHPESRKSMLDEHK 1918

 Score =  535 bits (1378), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 316/715 (44%), Positives = 444/715 (62%), Gaps = 25/715 (3%)

Query: 315  PIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSSDG 374
            P HYV++II+D +T++E+ DLW++LRTE IDWV  FI+ QG +A+AN L+K + + S D 
Sbjct: 296  PDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQRESLDI 355

Query: 375  TPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSITLSTRRMATEIFV 434
              +   LEKENA++KC RVL+ L +G++E  + +++  +V  GL S  LSTRR+ATE  +
Sbjct: 356  LHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVATETLL 415

Query: 435  CML---EKKNPERFK----VILNALDQKFKIGYNAHM------TQNIKMFPDYFTHLTLD 481
             ML   E K  +  +     +L ALDQ+ K   N H+      T   K  P       + 
Sbjct: 416  YMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRADFHVV 475

Query: 482  SQLKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCS 541
            +  K  + WL+ +E+TLDGRG+MGSLVGASDD+K  GGEN +LEY  +SMI +N LCS  
Sbjct: 476  A--KRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVLEYLLYSMILLNLLCSNH 531

Query: 542  SNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNAN 601
             ++ QR LLR++L++ G+ RI+ K++ L Y  +  ++  +E+  LDD N L+ S   ++ 
Sbjct: 532  PDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVDSA 591

Query: 602  INLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDSL 661
            ++++DP ++ ++ W   +GTE E  L+SL+QHLFL S  F E  +DP +  +QLKLLD+L
Sbjct: 592  VDMKDPAALWQDFWTQHRGTEAEGHLLSLLQHLFLWSRAFAE-YRDPAESIKQLKLLDAL 650

Query: 662  VTNVSVSSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKL 721
            VTNV+ SS D E+  N AIQRLYDAMQTDEVARR+ILESR LTKK EE++AERD L+ KL
Sbjct: 651  VTNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLASKL 710

Query: 722  KNAEHGLVGQLQDELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLTI 781
              A++GLVGQLQ E+ Q +RIL K+ RV                          RKMLTI
Sbjct: 711  SQAQNGLVGQLQSEVEQLERILEKSNRVTDQLKGELHALKKKHLLEKHEHEVELRKMLTI 770

Query: 782  LNARPEIVEGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTIQ 841
            LN++P     NG S +     PS L P KK +IQ+ALQD L +T+KD + D++       
Sbjct: 771  LNSKPH--GENGGSPEVNTSTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSKRLNTVPA 828

Query: 842  PNKRLKLLRMQMEDIENEARELEMTNFTEYEKRXXXXXXXXXXXXXXXXXXXXDPSINKL 901
            PN+RLK+LR +M+ IE EAR LEMTNF +++K                        + +L
Sbjct: 829  PNRRLKMLRSKMDIIEKEARLLEMTNFADFKKEPEEENEPKLLSPPKIQRSLRGEQVKEL 888

Query: 902  NDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNID-E 960
              LR+ LA IQ ESN++SKFNV+ERVNELF +K+  AL RL+DLE KYK FGIDFN D E
Sbjct: 889  AALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRLRDLENKYKGFGIDFNEDPE 948

Query: 961  LVD----SASKDENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNAS 1011
            L+     + S D +G        + LDP     K++E+ ++ D L ++K  ++ S
Sbjct: 949  LMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKIEEMTKILDRLNKLKKDIDMS 1003

 Score = 91.7 bits (226), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 61/92 (66%)

Query: 126 IARQHTNQSSASILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRNILQSL 185
           + RQ TNQS+ S  S  S + L K    DG + LE P DP E+E L+++++ KRNI QS+
Sbjct: 152 LTRQMTNQSNYSASSYTSLSLLHKATDIDGTLTLEKPEDPQEIEELYQELLQKRNIPQSV 211

Query: 186 PTDKQNELMSYDLEKKWLIVKQDLQNEMKKMR 217
                 ELMSY ++KKWL+VKQDLQ E KKM+
Sbjct: 212 SVHGHRELMSYGIDKKWLMVKQDLQTEYKKMK 243

 Score = 37.7 bits (86), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 38/79 (48%), Gaps = 24/79 (30%)

Query: 1059 GSFLEALTQKYATG-QKSASPRDQSTRMKDNI-------------------FINRIKQTN 1098
             SFLE L+QKY TG Q  A+    S  M+  +                   F+NR+K+T 
Sbjct: 1086 ASFLETLSQKYGTGSQSGAASVSSSEHMRGVVNVKRRTSQNSINSGNHRKSFVNRMKRT- 1144

Query: 1099 VAPP---FLDELTDKVAEA 1114
            + P    FL+ELT KV+ A
Sbjct: 1145 ITPTSSNFLEELTQKVSPA 1163

>KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1976

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/627 (59%), Positives = 463/627 (73%), Gaps = 17/627 (2%)

Query: 1273 KKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVL 1332
            K    SP+LPQS SLF+ YPRP KKLKQLHWEK+D  ++SIW+  KAEKFADDLYEKGVL
Sbjct: 1317 KSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVL 1376

Query: 1333 TDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCD 1392
            + LEKAFAAREIKSLAS+KK+D DK+SFLSRD+SQQFGINLHMY++L V++VV KIL+CD
Sbjct: 1377 SRLEKAFAAREIKSLASRKKKDSDKLSFLSRDVSQQFGINLHMYSSLSVEEVVSKILRCD 1436

Query: 1393 RDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQ 1452
            RDFL TPSVI+FLSK EIVEVS NLARN+APY+ DWEGV SVE+AK PEKDP ELQRAD+
Sbjct: 1437 RDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADR 1496

Query: 1453 LYLQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVI 1512
            LYL+L +NLQ+YW SRMRAL VITT++K+Y++L+ KL  +DKA  S+Q+SENL+NV +VI
Sbjct: 1497 LYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVI 1556

Query: 1513 LAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELE 1572
            LAVGN+MND+SKQAQGF+LATLQRLTFIKD  NSMTFLNYVEKI+R  YP FNDFL ELE
Sbjct: 1557 LAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELE 1616

Query: 1573 PVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDAR 1632
            PV+  VKISIEQ+  DC+EFSQS++NVERSV+ GNLSD +KFHP DRVL KVLP LP+AR
Sbjct: 1617 PVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEAR 1676

Query: 1633 KKGELLGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEE 1692
            KKG+LL DE+KLT++EF  LM+++GED+                + EYKKAQ  N+K EE
Sbjct: 1677 KKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNLKLEE 1736

Query: 1693 EEQVYERHKKMVEDQQKKLQE-QXXXXXXXXXXXXXXXXXXXXRRAMMDKLLDQLKNAGP 1751
            EE+ YER KK+VEDQ K+ +E +                     R +MD+LL++LKNAGP
Sbjct: 1737 EERAYERRKKLVEDQLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGP 1796

Query: 1752 SKTDPSSARKRALVRKKLMTESTA---LLKDIETEDD---SIIYSPEGKNPFVNPVDLDT 1805
            +K+DPSSARKRA+ RK+L+  S++   +L + + ED    S++YSP+  +  V   + DT
Sbjct: 1797 AKSDPSSARKRAVARKRLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNSSEVQLNEADT 1856

Query: 1806 -PHDESEMDVXXXXXXXXXXXXXNSTLLSDDQDEVTDRAKALLMELRGSNTPSKRNSLLD 1864
             P  E  +               + T  SD    +TDRA+ LL+ELRG  +P  + S   
Sbjct: 1857 SPTPERRV-----RDSNATSPASHDTGSSD----LTDRARNLLIELRGPESPGVKMSAQH 1907

Query: 1865 EHKEKLRARRRKTNSDLHSGTRLQFVG 1891
            +   KLRARR+  +S   S  RL FVG
Sbjct: 1908 QRLSKLRARRKNDSSSSGSENRLNFVG 1934

 Score =  560 bits (1444), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 329/845 (38%), Positives = 497/845 (58%), Gaps = 63/845 (7%)

Query: 315  PIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSSDG 374
            P +YV++II + I+++ + DLWV+LRTEQ+DWV  F+E QG +A+AN+++K+ Y+ S D 
Sbjct: 303  PDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCYRESPDN 362

Query: 375  TPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQT-------VARGLFSITLSTRR 427
                ++L+KE A+FKC +     S  LRE     +MS +       +  GL S+ ++TRR
Sbjct: 363  LLGDEVLDKEFAYFKCLKT----SLNLREGADEAVMSNSARIIVSAIVEGLLSLRVATRR 418

Query: 428  MATEIFVCMLEKKNPERFKVILNALDQKFKIGYNAHM-----TQNIKMFPDYFTHLT--- 479
            +A+E+ + + +   P  F  +++ALDQ+ +   N H+     TQ+    P   + +    
Sbjct: 419  VASELLISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAPTP 478

Query: 480  ---LDSQLKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINH 536
                D  ++  + W+  VE+TLDGRGKMGSLVGAS+DF+ SGGENAI+EY   +++ INH
Sbjct: 479  DGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINH 538

Query: 537  LCSCSSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESN 596
            LC    ++ QR +LR +L+N G+ RI+NK+K L+Y+KV EQ+  ++++  DD + L    
Sbjct: 539  LCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQE 598

Query: 597  NKNANINLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKK-DPVKLSRQL 655
            +    ++++DP SM +NLW+ CKGT+ E+ L SL+Q+L +S+ +   + K DP + ++QL
Sbjct: 599  STGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQL 658

Query: 656  KLLDSLVTNVSVSSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERD 715
            KL+D+LV+NVS++S D ++S N AIQRLYDAMQTDE+ARR+ILE+R   K+ EE++A+RD
Sbjct: 659  KLIDALVSNVSMASVDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRD 718

Query: 716  LLSQKLKNAEHGLVGQLQDELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXX 775
             L +KL NAE GLVGQLQDE+ QRD IL K+QRV                          
Sbjct: 719  NLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEVEL 778

Query: 776  RKMLTILNARPEIVEGNGTSKKTKA-KNPSALDPSKKQSIQQALQDGLSRTKKDYSVDAR 834
            RK LT +N+     EG+   +  K  +NP  L P +K +IQ+ALQ  L +T K+ +V+++
Sbjct: 779  RKTLTAMNSN---FEGSHNMRDEKGSENPRPLRPERKLAIQKALQAKLEKTSKEINVESK 835

Query: 835  NFGMTIQPNKRLKLLRMQMEDIENEARELEMTNFTEYEKRXXXXXXXXXXXXXXXXXXXX 894
              G++++PNKRLKLLR +MEDIEN+ARELEMTNF++Y+K                     
Sbjct: 836  RLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEPEVSNEDDHKAVSESE 895

Query: 895  DP----SINKLNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYK 950
            +     S  KL +LR+ LA +Q ESNDISKFNV+ R +E+F+ ++  AL RL+ LET YK
Sbjct: 896  EKAQQISALKLEELRKKLASLQQESNDISKFNVEGRFHEMFSGQKSLALDRLKKLETDYK 955

Query: 951  DFGIDFNIDELVDSASKDENGNNQQSGDYS-SLDPKAYQRKLDELNRLTDELLRVKNKVN 1009
             FGI+F+ D  +  A     G +  S D + +LDPK     ++E++ +   L   K    
Sbjct: 956  GFGINFDPDSPLGQALA---GKSVSSDDKARTLDPKEALNIVEEVSNILSGLDSSKAAEK 1012

Query: 1010 ASDNNLXXXXXXXXXXXXXXXXXXXXXXXXXLIERQDTQSN-FSGTSAGP-GSFLEALTQ 1067
            +++  L                           E  D   +  +  S  P  SFLE+L+Q
Sbjct: 1013 SNETPLRTATSSDSSED----------------EMDDKNGDKIAADSTLPTSSFLESLSQ 1056

Query: 1068 KYATGQKSASPRDQSTRMKDNI---------FINRIKQTNVAPPFLDELTDKVAEAPPVE 1118
            KY   Q S S R      + N          F+NR+K+T  A P+L EL+ K+  +  ++
Sbjct: 1057 KYGGAQNSLSNRHSFAGGEINYPGSGYHRKSFMNRVKRTG-AVPYLGELSGKIGSSSYIK 1115

Query: 1119 ASLAE 1123
             S AE
Sbjct: 1116 PSEAE 1120

 Score =  136 bits (343), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 96/156 (61%), Gaps = 10/156 (6%)

Query: 69  SLKPLNKKTSLNTQNLSQYINDKHSPQHTRXXXXXXXXXXXXXXXXXXXXXXXXXN---- 124
           S KPL+K+++LN  +LS Y +   +  H R                         N    
Sbjct: 70  SHKPLSKQSTLNMASLSAYTDAVGA--HNRSASNASVGSPTKYSYSRRASQWSNNNSAVS 127

Query: 125 --QIARQHTNQS--SASILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRN 180
             +++RQ TNQS  SASI SQGSF+NLSKF+ PDG + LE PRDP E+E LFE+++ KRN
Sbjct: 128 GSKLSRQQTNQSMSSASIFSQGSFSNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRN 187

Query: 181 ILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKM 216
           + QSLP   Q EL +YDLEKKWL+V+QDLQ+E+KK 
Sbjct: 188 VYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKF 223

>Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON}
            similar to Ashbya gossypii AFR669W
          Length = 2091

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/627 (60%), Positives = 457/627 (72%), Gaps = 29/627 (4%)

Query: 1278 SPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVLTDLEK 1337
            SPLLPQS SLFE YPRP+K+LKQLHWEK+D  DNSIW+  +AEKFADDLYE+GVLT+LEK
Sbjct: 1390 SPLLPQSPSLFEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEK 1449

Query: 1338 AFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLH 1397
            AFAAREIKSL S+KK D +K++FLSRDISQQFGINLHMY++L VD +V KILKCD+DFL+
Sbjct: 1450 AFAAREIKSLISRKK-DENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLN 1508

Query: 1398 TPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQL 1457
            T S IEFLSK EIVEVS+N+AR +APY+TDWEGV SVE+AK PEKDPNELQRADQLYL L
Sbjct: 1509 TQSAIEFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDL 1568

Query: 1458 IINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGN 1517
            I+NLQSYW SRMRAL +ITT++K+YN+L+ KLR +DKAV ++Q+SENL+NVF+VILAVGN
Sbjct: 1569 IVNLQSYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGN 1628

Query: 1518 YMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDV 1577
            YMND+SKQAQGFKL+TLQRLTFIKD  NSMTFLNYVEKIVR+NYP F+ FL ELEPVL V
Sbjct: 1629 YMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQV 1688

Query: 1578 VKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGEL 1637
            VKISIEQL +DC EF  ++ NVERS+E GNLSDSSKFHP DRVLAKVLP+LP+ARK+  L
Sbjct: 1689 VKISIEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANL 1748

Query: 1638 LGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVY 1697
            L DEV+L++MEF  LM+++GEDS+               I EYK+AQ  N K EEEE+ Y
Sbjct: 1749 LADEVQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAY 1808

Query: 1698 ERHKKMVEDQQKK----LQEQXXXXXXXXXXXXXXXXXXXXRRAMMDKLLDQLKNAGPSK 1753
            ER K M+E+QQK+    +Q                       R +MD+LL++LKNAGPSK
Sbjct: 1809 ERRKIMIEEQQKRARKNIQIDTSFSRRGSSLSTSSISASGDDRDVMDRLLEKLKNAGPSK 1868

Query: 1754 TDPSSARKRALVRKKLM---TESTALLKDIETE----------DD------SIIYSPEGK 1794
             DPSSARKRAL RKKLM      + +L  ++ E          DD      +I+ SP   
Sbjct: 1869 ADPSSARKRALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTST 1928

Query: 1795 NPFVNPVD-LDTPHDESEMDVXXXXXXXXXXXXXNSTLLSD---DQDEVTDRAKALLMEL 1850
                  V+ L+  HD     +             +S   S    D+D VT RA+ LL EL
Sbjct: 1929 VGATADVEGLNPDHDLPSAPISAEKGSVSSALSHSSESPSKKILDEDAVTHRARNLLQEL 1988

Query: 1851 RGSNTPSK-RNSLLDEHKEKLRARRRK 1876
            R S+  ++ R SLLDEHKEK+R RR K
Sbjct: 1989 RSSDDHTEDRKSLLDEHKEKVRQRRNK 2015

 Score =  566 bits (1460), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 327/729 (44%), Positives = 454/729 (62%), Gaps = 37/729 (5%)

Query: 315  PIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSSDG 374
            P HYV++II+D IT+ E+ DLWV+LRTE IDWV  FI+ QG +A+AN L+K   + S + 
Sbjct: 292  PDHYVRKIISDRITAYELNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQRESLES 351

Query: 375  TPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSITLSTRRMATEIFV 434
              +  LLEKE A++KC RVL+ L +G++     +++   V  GL SI L+TRR+ATE  +
Sbjct: 352  LLDSDLLEKETAYYKCLRVLTNLREGMQAALSSKLVISAVVEGLLSIRLTTRRIATETLL 411

Query: 435  CMLE----KKNPERFKVI---LNALDQKFKIGYNAHM------TQNIKMFPDYFTHLTLD 481
             ML     K     F  I   L+ALDQ+ K   + H+      T   +  P     L + 
Sbjct: 412  YMLTDDELKTADTDFDAIFPVLHALDQESKYSSSIHLRGRLHETNKRRSLPTGRADLHVI 471

Query: 482  SQLKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCS 541
            ++ K+ Q WL+ +E+TLDGRG+MGSLVGAS+D+KN  GEN +LEY  +SMI IN LCS  
Sbjct: 472  AK-KIEQ-WLYVLEYTLDGRGRMGSLVGASEDYKN--GENTVLEYLLYSMILINLLCSSH 527

Query: 542  SNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNAN 601
             +++QR LLR++L++ G+ R++ K++ L Y  +  ++  +E+  LDD N+L+ S+  +++
Sbjct: 528  PDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSS 587

Query: 602  INLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDSL 661
            ++++DP S+  N W   KGTE+E  L+SLMQHLFL SS+   E  DP + S+QLKLLD+L
Sbjct: 588  VDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKLLDAL 647

Query: 662  VTNVSVSSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKL 721
            V+NV+ SS D E+  N AIQRLYDAMQTDEVARR+ILESR LTKK EE++AERD L  KL
Sbjct: 648  VSNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKL 707

Query: 722  KNAEHGLVGQLQDELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLTI 781
              A+ GLVGQLQ E+ Q  RIL K+ RV                          RKMLTI
Sbjct: 708  AQAQDGLVGQLQGEVQQLQRILEKSNRVTDQLKADLHDLKKKHLLEKHEHEVELRKMLTI 767

Query: 782  LNARP-----EIVEGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNF 836
            LN++P     + V  +G + KT    PS L P KK +IQ+ALQD L +T+KD + D+R F
Sbjct: 768  LNSKPNDASNDAVSPDGINNKT----PSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRRF 823

Query: 837  GMTIQPNKRLKLLRMQMEDIENEARELEMTNFTEYEKRXXXXXXXXXXXXXXXXXXXXDP 896
            G    PN+RLK+LR +M+DIE EA  LEMTNF E++K                       
Sbjct: 824  GTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEFKKETKVEDLPRLQSPPKIERNVRSE 883

Query: 897  SINKLNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDF 956
             + +L  LRQ LA IQ ESN+ISKFNV+ERVNELF +K+  AL RL+DLE KY+ FGIDF
Sbjct: 884  KVKELAALRQRLAVIQQESNEISKFNVEERVNELFYEKKTKALDRLRDLEEKYRSFGIDF 943

Query: 957  NID-ELVDSASKDENGNNQ----------QSGDYSSLDPKAYQRKLDELNRLTDELLRVK 1005
            N++ EL+    ++ +G+             S D   LDP     K++E+ ++ +EL R+K
Sbjct: 944  NMESELLIETDREGDGDASVGEASNSTAPNSLDSCVLDPARLDAKIEEMTKILEELNRLK 1003

Query: 1006 NKVNASDNN 1014
             +V+ +  N
Sbjct: 1004 CQVDPTTAN 1012

 Score = 85.1 bits (209), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 85/161 (52%), Gaps = 14/161 (8%)

Query: 71  KPLNKKTSLNTQNLSQYIND------------KHSPQHTRXXXXXXXXXXXXXXXXXXXX 118
           KPL+K ++LNT +LSQY ++              SP                        
Sbjct: 78  KPLSKHSTLNTSSLSQYADEIAQSRTPSGPVSLGSPSKYSYSKRSSQWSGGNSNKQLLLL 137

Query: 119 XXXXXNQ--IARQHTNQSSASILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIM 176
                +Q  ++RQ TNQS+ S  S  S T L K    DG ++LE P+ P E+E L+++++
Sbjct: 138 PQPQHSQHTLSRQPTNQSNNSDNSFSSVTLLQKITDSDGNLSLEKPKYPQEIEELYQELL 197

Query: 177 LKRNILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMR 217
            KRNIL S+      ELM YDL+KKWL+VKQDLQ E+K+M+
Sbjct: 198 QKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRMK 238

 Score = 33.5 bits (75), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 53/120 (44%), Gaps = 28/120 (23%)

Query: 1042 IERQDTQSNFSGTSAGPGSFLEALTQKYATGQKSASPRDQSTRMKDN------------- 1088
            +ER D+    S TS     FLE+L+QKY TG       D + R+  +             
Sbjct: 1097 MERSDSILTTSNTS-----FLESLSQKYGTGTNLQPAEDGAKRLSSSSAFRAGDSSQRNS 1151

Query: 1089 -----IFINRIKQTNV--APPFLDELTDKVAEAPPVEASLAEPDNNNTINESSKEETGEA 1141
                  F+NR+K+ +   +  F+DE++ K+    PV  + +     NT   SS  ++ ++
Sbjct: 1152 GYHRKSFVNRMKKNSTPKSSSFVDEVSQKMT---PVHVAQSPDSLQNTATSSSTPQSAKS 1208

>KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] {ON}
            similar to uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1842

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/581 (59%), Positives = 427/581 (73%), Gaps = 21/581 (3%)

Query: 1273 KKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVL 1332
            K  + SPLLPQS SLFE YPRP+KKLKQLHWEK+D   +SIWK  +AEK ADDL+E+GVL
Sbjct: 1211 KATVTSPLLPQSPSLFERYPRPKKKLKQLHWEKIDNAGDSIWKNAQAEKVADDLFERGVL 1270

Query: 1333 TDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCD 1392
            + LEKAFAARE KSL  K KE  +KI+FLSRD+SQQFGINLHM++NL V DVV K++KCD
Sbjct: 1271 SQLEKAFAARETKSLKGKSKEANEKITFLSRDVSQQFGINLHMFSNLDVKDVVGKVMKCD 1330

Query: 1393 RDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQ 1452
            R+FL TPSVIEFLSKP I+EV+ NLAR + PYSTDWEGV SV+DAK PEKDPNELQRADQ
Sbjct: 1331 REFLSTPSVIEFLSKPTIIEVTNNLARYFNPYSTDWEGVTSVDDAKPPEKDPNELQRADQ 1390

Query: 1453 LYLQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVI 1512
            LY++ +INLQ YWGSRMRA+T+ITT++K+Y++L+TKLRK+D+AV  +++SE+L++VF+VI
Sbjct: 1391 LYVEFMINLQPYWGSRMRAITMITTYEKDYSDLVTKLRKIDRAVQCIEQSESLRHVFDVI 1450

Query: 1513 LAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELE 1572
            LAVGNYMND+SKQAQGFKL+TLQRLTFIKD  NSMTFLNYVEKI+R NYP ++ F+ ELE
Sbjct: 1451 LAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIIRENYPEYSHFVEELE 1510

Query: 1573 PVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDAR 1632
            P+  V KISIEQLV+DCKEFSQS++NVERS+E GNLSD SKFHP DRVL KV+P+LP+AR
Sbjct: 1511 PIFSVTKISIEQLVTDCKEFSQSVINVERSIEIGNLSDPSKFHPLDRVLNKVVPVLPEAR 1570

Query: 1633 KKGELLGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEE 1692
            KK +LL DE+KL+++EF  LM+ +GED+                ITE+KKA+  N+K EE
Sbjct: 1571 KKADLLSDEIKLSLLEFENLMKKFGEDANDKFSKNSFFQKFADFITEFKKAKTHNVKLEE 1630

Query: 1693 EEQVYERHKKMVEDQQKKLQEQXXXXXXXXXXXXXXXXXXXXRRAMMDKLLDQLKNAGPS 1752
            EE+ YER KKM+EDQQ+K QE                      R  ++KLLD+LKNA PS
Sbjct: 1631 EERAYERRKKMIEDQQRKQQEADSKATAKNLSTSQEPSDD---RDDIEKLLDKLKNAAPS 1687

Query: 1753 KTDPSSARKRALVRKKLM-TESTALLKDIETEDDSIIYSPEGKNPFVNPVDLDTPHDESE 1811
            K DPSS RKRAL RKKL+  +S A + D  T D +I         FV          E  
Sbjct: 1688 KGDPSSTRKRALARKKLLDGKSGASIFDNITADSTI-------EAFV----------EQN 1730

Query: 1812 MDVXXXXXXXXXXXXXNSTLLSDDQDEVTDRAKALLMELRG 1852
              +              +  LS  + +  DRA+ LL+ELRG
Sbjct: 1731 RTLTESPTAKKSASLPETESLSSSKQDPADRARNLLLELRG 1771

 Score =  559 bits (1440), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 330/833 (39%), Positives = 482/833 (57%), Gaps = 66/833 (7%)

Query: 314  PPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSSD 373
            PP +YV++II+  I ++E+ DLWV+LRTE +DWV +F+E QG +A+AN+++ S+++ ++D
Sbjct: 267  PPEYYVRQIISKKIKNKELNDLWVSLRTEPLDWVISFLEAQGQVAIANLIITSMHQDTTD 326

Query: 374  ---GTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSITLSTRRMAT 430
                  +PQ LE+E A FKC RVL  + + L E     +++  +  GL S  + TRR+AT
Sbjct: 327  NQNAVTDPQFLERETALFKCLRVLLNIRECLEEAVNSTLVTNALVEGLLSTKIPTRRLAT 386

Query: 431  EIFVCMLEKKNPERFKVILNALDQKFKI-----GYNAHMTQNIKMFPDYFTHLTLDSQ-- 483
            E  + ++ K   E FK     LD  F +      +   + QNI M   + T+ + D +  
Sbjct: 387  ETLIYLVTKD--EDFKSRTAGLDC-FSLVMESLNHETSLVQNIHMKAKFSTNDSTDPESN 443

Query: 484  ------LKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHL 537
                   K+ Q WL+ VE TLDGRGKMGSLVGASD+++N+ GEN+I EY   S++ I+ L
Sbjct: 444  PQLYQVCKILQQWLYVVEQTLDGRGKMGSLVGASDEYRNNTGENSIYEYLVDSIVLIDQL 503

Query: 538  CSCSSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNN 597
            C  + ++ +R ++RT+L++ G+ RI+ K++ LDY  +   +  +E+  +DD N+L++S  
Sbjct: 504  CLNNEDVKKRHMMRTQLKSFGLNRILQKMQLLDYPPLSTMLLQFEDAAIDDYNSLIDSQK 563

Query: 598  KNANINLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKL 657
               N+++ DP S+L+ L  + KGTE E  L+S++Q+LFLSS++  +E  DP K  +QLKL
Sbjct: 564  FTENVDMDDPVSILQKLTSSFKGTEAESYLLSMLQNLFLSSNKNAQESDDPGKNVQQLKL 623

Query: 658  LDSLVTNVSVSSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLL 717
            +DSL++NV++++ D E++ N+AIQRLYD+MQTDE+ARR+ILESR LTKKLEEV+AERD L
Sbjct: 624  IDSLISNVAITTLDSESNFNVAIQRLYDSMQTDEIARRAILESRELTKKLEEVKAERDYL 683

Query: 718  SQKLKNAEHGLVGQLQDELAQRDRILSKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRK 777
            + K+  AE+GLVGQLQ ELA+RD IL K QRV                          RK
Sbjct: 684  NDKISKAENGLVGQLQKELAERDLILDKTQRVTEQLQSELEELKKRHLLEKHEHEIELRK 743

Query: 778  MLTILNARPEIVEGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFG 837
            MLTI+N++      +  S  T   +P  L+P +K +IQ  LQ  L +T++D   ++R  G
Sbjct: 744  MLTIVNSK---TSDDLESGSTVQNDPKPLNPERKTAIQNVLQRSLQKTEQDLLNESRRLG 800

Query: 838  MTIQPNKRLKLLRMQMEDIENEARELEMTNFTEYEKRXXXXXXXXXXXXXXXXXXXXDPS 897
              +    RLKLLR +MEDIEN+ARELEMTNF + + +                       
Sbjct: 801  TAVGSKSRLKLLRSKMEDIENQARELEMTNFADVKPKQNQKFKEQVKGQQA--------- 851

Query: 898  INKLNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFN 957
              KL +LR+ LA IQ ESNDI+KFN++ RVNELF  K++ AL RL+DLE KY  F IDF 
Sbjct: 852  -TKLAELRKKLAIIQNESNDITKFNIEARVNELFQDKKLAALDRLKDLENKYNGFHIDFA 910

Query: 958  ID-ELVDSASKDENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNLX 1016
             D EL +  ++  NG         SLDP   QRK++E+N + DEL  +K ++        
Sbjct: 911  DDPELKELLTQSSNGG-------PSLDPTIVQRKVEEMNSIIDELNALKEEM-------- 955

Query: 1017 XXXXXXXXXXXXXXXXXXXXXXXXLIERQDTQSNFSGTSAGPGSFLEALTQKYATGQKSA 1076
                                        Q   S+ S   +   SFLE+L+QKY+TGQ++A
Sbjct: 956  KNRPKTGSSSSSSSSLSSASSSSEDGSSQSQASHGSDIVSNGSSFLESLSQKYSTGQQTA 1015

Query: 1077 SP----------RDQSTRMKDNIFINRIKQTNV--------APPFLDELTDKV 1111
            +           R   +      F+NR+K T V         PPFL EL  KV
Sbjct: 1016 TSTNGGRVGRETRYPGSGYHRKSFLNRLKNTTVNPTATSEHLPPFLTELKSKV 1068

 Score = 89.0 bits (219), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 100/200 (50%), Gaps = 16/200 (8%)

Query: 25  IFQNLRRLTNPSSNHTNKXXXXXXXXXXXXXERDSTTTR-ESHT--NSLKPLNKKTSLNT 81
           +F NL++L     NH +              +R  TT   ES T     KPLNK +SLNT
Sbjct: 29  LFSNLKKLAT-GGNHGSSQPSQTRKELISSPKRVFTTASLESATPIGGSKPLNKISSLNT 87

Query: 82  QNLSQYINDKHSPQHTRXXXXXXXXXXXXXXXXXXXXXXXXXNQIARQHTNQSSASILSQ 141
            NLS Y  D  +   ++                         +Q+ R  TN+S  S  + 
Sbjct: 88  HNLSHYTMDPEANSRSQSASLLTSPTKYSYSRRS--------SQLTRSSTNKSIISSSAV 139

Query: 142 GSFTN----LSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRNILQSLPTDKQNELMSYD 197
              +N    L++F+  DG + L+ P +P E+  LF D+++KRN+  S+ +  Q ++++Y 
Sbjct: 140 SVSSNSTSILNRFLTNDGTLKLDRPENPEEINGLFMDLLIKRNVFDSVSSQDQKDMLNYP 199

Query: 198 LEKKWLIVKQDLQNEMKKMR 217
           +EKKWL+VKQDLQ+E K+++
Sbjct: 200 IEKKWLMVKQDLQSEFKRLK 219

>NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717
          Length = 1314

 Score =  310 bits (794), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 160/420 (38%), Positives = 258/420 (61%), Gaps = 12/420 (2%)

Query: 1296 KKLKQLHWEKLDATDNSIWKTNKA-EKFADDLYEKGVLTDLEKAFAAREIKSLASKKK-- 1352
            KK+KQ+HWEK++  +N+ W   +  E+   +L   G+   +E  F  + +  +  KKK  
Sbjct: 818  KKIKQIHWEKIEDIENTFWDNEQEREETVTELRHMGIFKQIEDIFKMKNVSVIMKKKKVV 877

Query: 1353 -EDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLSKPEIV 1411
                + ISFLSRD++QQFGINLH++  L  D++V K+L+CD D L   SV+EF  K E+ 
Sbjct: 878  SSSTELISFLSRDLAQQFGINLHIFVQLSEDELVSKVLRCDDDILENVSVLEFFCKEEMT 937

Query: 1412 EVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSYWGSRMRA 1471
             ++ +L R+  PYSTD+   +SV     P K+P+ELQRAD+++L+L  NL+SYW  R + 
Sbjct: 938  HINPSLVRHLTPYSTDYMNPESV-----PTKNPDELQRADKIFLKLSFNLRSYWNERSQC 992

Query: 1472 LTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQAQGFKL 1531
            L ++ T++K+Y +LL KL+K+D A+  +  SE  KN+  +I+ +GN+MN  ++   G +L
Sbjct: 993  LLLLCTYEKDYYDLLYKLQKIDDALQRIYHSERFKNLLYIIVEIGNFMN--TRPVSGIRL 1050

Query: 1532 ATLQRLTFIK-DSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQLVSDCK 1590
            + L +L FIK ++ N+++FL+Y+E+++R +Y     F+ +L  V ++ KIS++Q+   C+
Sbjct: 1051 SALNKLAFIKSNNDNNVSFLHYIERVIRIHYADVYGFIDDLHKVEELGKISMDQVALQCE 1110

Query: 1591 EFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLTIMEFL 1650
            EF   I  +  ++  G LSD  K HP D++L KV   +  AR KGELLGD  KL+  +F 
Sbjct: 1111 EFCSKIDKMVFNITKGKLSDPLKLHPDDQILKKVKYKINRARTKGELLGDHFKLSNNDFE 1170

Query: 1651 RLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVYERHKKMVEDQQKK 1710
            ++M+ YGED                  T +KK   +N++ EE E+VY + KK++E   +K
Sbjct: 1171 KVMRYYGEDPTDVESKSVFFQTFVEFSTLFKKCAKENMEREEAERVYAQRKKIMEASTRK 1230

 Score = 38.5 bits (88), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 113/230 (49%), Gaps = 28/230 (12%)

Query: 530 SMIF-INHLCSCSSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDD 588
           SM+F IN +     +   +  +  +L+   +  ++  ++ +D + + EQ+ L++    D 
Sbjct: 345 SMLFLINSIVQGFQSFTTKKNILAELKRSEVYTLLYLLEDIDCNVIQEQVKLFK----DT 400

Query: 589 LNTLLESNNKNANINLQDPT-SMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKKD 647
              +LE  ++ + +++  P  S+L+ L +    T+ E  + SL+  L L S      KK 
Sbjct: 401 EENILEVTSRESGVHIDSPYGSILQQLTNLTSNTQLEPQINSLLD-LILKSVN----KKT 455

Query: 648 PVKLSRQLKLLDSLVTNVSVSSTDQ------EASMNMAIQRLYDAMQTDEVARRSILESR 701
             + S+ L+ ++S +   S+ +++       E     ++  L D++Q+DE+A+R++LE  
Sbjct: 456 YSESSKLLQFMESFL-QYSLDNSNHNHYEHPETLFQESVNNLMDSLQSDEIAKRAMLE-- 512

Query: 702 TLTKKLEEVQAERDLLSQ---KLKNAEHGLVGQLQDELAQRDRILSKNQR 748
                L+E Q++ ++LS    KL+N +      + D+L Q   +L    R
Sbjct: 513 -----LDEKQSQMNILSNQLTKLRNEKTMDKSDILDQLKQVTDLLESKDR 557

>SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1335

 Score =  303 bits (776), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 153/418 (36%), Positives = 271/418 (64%), Gaps = 13/418 (3%)

Query: 1297 KLKQLHWEKLDATDNSIWKTNKAEKFADD-LYEKGVLTDLEKAFAAREI---KSLASKKK 1352
            KL+Q+HW+ ++    + W   +  K     L E GV  ++E+ F  ++    K   +K  
Sbjct: 859  KLRQIHWDNIEDIRETFWSEEEERKEKSKELQELGVFEEIEELFRIKQPVPKKPNVAKTS 918

Query: 1353 EDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLSKPEIVE 1412
            ++L K+SFLSRD++QQFGINLHM++N  V ++V K+L C+ + +   SV+EF +K ++  
Sbjct: 919  QNLKKVSFLSRDLAQQFGINLHMFSNYTVHELVLKVLHCENEVVKNQSVLEFFNKEDLTN 978

Query: 1413 VSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSYWGSRMRAL 1472
            +S ++ +N+ PYST+      V   + P KD +EL+RAD+++L+L  NL+SYW +RMR L
Sbjct: 979  ISQSVKKNFEPYSTN------VLTGEGPTKDVSELERADRIFLELCYNLRSYWRARMRCL 1032

Query: 1473 TVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQAQGFKLA 1532
             ++ T++K+Y ++L KL+K+D A  +++ S+ LK +  +I+ +GNYMN+  +QA+G KL+
Sbjct: 1033 LILLTYEKDYYDILYKLQKIDDATRAIRNSKRLKELLFIIVEIGNYMNN--RQARGIKLS 1090

Query: 1533 TLQRLTFIKDSTNS-MTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQLVSDCKE 1591
            +L +L F+K STN+ M+FL+Y+E+I+R+ Y      + +L  +  + K++++Q+  DC+E
Sbjct: 1091 SLGKLAFVKASTNNNMSFLHYIERILRTKYMDLYGVIDDLSKISHLGKLTVDQVELDCRE 1150

Query: 1592 FSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLTIMEFLR 1651
            F++ I N+ERS + G+LS +  FHP+D +++K    +P A++K  LL D+ KLT+ +  +
Sbjct: 1151 FNERIDNMERSFKTGDLSKTQNFHPEDLIVSKTKHKIPIAKRKRSLLMDQCKLTMHDLEK 1210

Query: 1652 LMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVYERHKKMVEDQQK 1709
            LM   GE+ +               ++ +KKA  +NI+ EE E++YE+ KK++E +++
Sbjct: 1211 LMTYCGEEPKDHNAKNTFFQNFIDFVSLFKKAARENIEKEEVERIYEQRKKLLEIKER 1268

 Score = 50.1 bits (118), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 117/244 (47%), Gaps = 32/244 (13%)

Query: 523 ILEYCQWSMIFINHLCSCSSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYE 582
           + +YC  ++  IN +   +++  ++ LL  K + CGI R+  K K      + ++I  Y+
Sbjct: 317 LTDYCLSTLFLINSIIQVTTSYREKELLIKKFKECGIHRMFYKTKDFGSGLLDDEIRKYK 376

Query: 583 NNKLD-------DLNTLLESNNKNANINLQDPTSMLRNLWDACKGTENEKLLISLMQHLF 635
             + +       +L T L+ +            S+L+ L    + T  E  L  L++ + 
Sbjct: 377 EVEEEVITRSSPELPTFLDISY----------GSILKTLILETRSTPLEHPLYQLLEGVL 426

Query: 636 LSSSQFIEEKKDPVKLSRQLKLLDSLVTNV------SVSSTDQEASMNMAIQRLYDAMQT 689
             S        + +KL    KL  S++  +      S S    E+++  ++ ++ D++Q+
Sbjct: 427 QIS--VTRTSSESIKL---FKLFHSILCYLKDHTFDSDSGEGPESALKTSLNQMMDSLQS 481

Query: 690 DEVARRSILESRTLTKKLEEVQAERDLLSQKLKNAEHGLVGQLQ---DELAQRDRILSK- 745
           DE+ARR++ E  +L + ++++ AE + L ++ K  +  ++ QL+   + L  +D  L + 
Sbjct: 482 DEIARRAMKELNSLQETVDQLTAEVESLKEERKVTKGEVIMQLEEARESLRDKDETLKQL 541

Query: 746 NQRV 749
           N+R+
Sbjct: 542 NERI 545

>Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] {ON}
            (35789..38224,38226..40265) [4476 nt, 1492 aa]
          Length = 1491

 Score =  304 bits (779), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 159/426 (37%), Positives = 258/426 (60%), Gaps = 15/426 (3%)

Query: 1292 PRPQ--KKLKQLHWEKLDATDNSIWKTN-KAEKFADDLYEKGVLTDLEKAFAAREI---K 1345
            P+PQ  K LKQ+HW+K++  DN+IWK N +  +   +L    +   +E +F  +E+   K
Sbjct: 993  PKPQHVKNLKQIHWDKVENIDNTIWKYNLENREILKELEYGSIFNQVEDSFKIKEVVIKK 1052

Query: 1346 SLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFL 1405
            S   K KE  +  SFLSRD++QQFGINLHMY+N    + +  +L C  + +   SV+EF 
Sbjct: 1053 SKTEKNKEKSNLKSFLSRDLAQQFGINLHMYSNYTEKEFLDLVLSCSDEVIKNISVLEFF 1112

Query: 1406 SKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSYW 1465
             K +++ +  +++RNYAPYS D+         + P KD +EL+RAD+L+L+L  NL+ YW
Sbjct: 1113 CKEDLINIPGSISRNYAPYSRDYLS------GEEPVKDSSELERADKLFLELCYNLRYYW 1166

Query: 1466 GSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQ 1525
              R + L ++ T++++Y +L+ KL+K+D A+  L  S+  ++   ++L +GNYMN   K 
Sbjct: 1167 ADRSQCLLLLYTYERDYYDLVFKLQKIDDAIQRLLNSQRFRDFLYIVLEIGNYMN--KKT 1224

Query: 1526 AQGFKLATLQRLTFIKDSTNS-MTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQ 1584
             +G K+++L +L FIK S+N+ ++FL+++EK++R+ YP    F+ +L  V D+ K+++E 
Sbjct: 1225 VEGVKISSLSKLAFIKSSSNNNISFLHFIEKLIRTRYPEVYGFIDDLTKVEDLGKVTLEH 1284

Query: 1585 LVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKL 1644
            + ++C EF   + +V  SV  G LS S K HP D +L KV   +  A+ K ELL D+  L
Sbjct: 1285 IGTECDEFCAKVNSVVYSVTNGKLSKSEKLHPNDSILKKVKYKVSRAKTKSELLKDQYNL 1344

Query: 1645 TIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVYERHKKMV 1704
            T  +  +L+  YGED +               ++ +KK   +NI+ EE E+VYE+ K M+
Sbjct: 1345 TKHDVTKLLVYYGEDPKDKDSNDSFFSNILEFLSVFKKCAKENIEREESERVYEQRKNML 1404

Query: 1705 EDQQKK 1710
            E Q KK
Sbjct: 1405 ESQSKK 1410

 Score = 40.4 bits (93), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 47/234 (20%), Positives = 103/234 (44%), Gaps = 21/234 (8%)

Query: 518 GGENAILEYCQWSMIFINHLCSCSSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQ 577
           G +  I EY    +  IN +     N  ++  L   L+  GI  I + +K L    + EQ
Sbjct: 350 GFDKLIEEYLTTCLFLINSILQVVPNFERKYKLIENLKEFGIHHIFHLLKDLASTVIKEQ 409

Query: 578 IDLYENNKLDDLNTLLESNNKNANINLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLS 637
           I +Y   + D + ++  +N+   +++  +   +L +        +    L++ +  +  S
Sbjct: 410 ISIYSKIEQDIILSISNNNSMFIDVSYGNEIQLLLSQSQKTPLEQPIGELLNFLNKILTS 469

Query: 638 SSQFIEEKKDPVKLSRQLKLLDSLVTNVSV----------SSTDQEASMNMAIQRLYDAM 687
            +Q           S  +KL  S  + +            +    E+++  +I  L D +
Sbjct: 470 RTQ-----------SESMKLFKSFGSTLGYLLDHFYKDNDTLLSPESTVQNSINELMDRL 518

Query: 688 QTDEVARRSILESRTLTKKLEEVQAERDLLSQKLKNAEHGLVGQLQDELAQRDR 741
           Q+DE+ARR++ E ++L + ++ +Q+E   L ++ +  +  L+ QL+    Q ++
Sbjct: 519 QSDEIARRAMNEMKSLEQIIDNLQSEISSLKEERQLDKGELIAQLKSAHIQIEK 572

>CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] {ON}
            similar to uniprot|P40450 Saccharomyces cerevisiae
            YIL159w BNR1
          Length = 1294

 Score =  299 bits (766), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 175/504 (34%), Positives = 292/504 (57%), Gaps = 41/504 (8%)

Query: 1292 PRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVLTDLEKAFA----AREIKSL 1347
            P+   +LKQ+HWEK+D    ++W+        D L ++GV + +EK F      ++ K L
Sbjct: 816  PKSTIRLKQIHWEKVDDVGGTLWEDVSGIPL-DHLKDEGVFSQIEKYFKILEPVKKTKVL 874

Query: 1348 ASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLSK 1407
            A  + +   KISFL+RDI+QQFGINLHMY+ L V++ V K+LKC+ D +   SV+ F +K
Sbjct: 875  AENENKP-TKISFLTRDIAQQFGINLHMYSQLSVEEFVTKVLKCEDDLIQNVSVLGFFTK 933

Query: 1408 PEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSYWGS 1467
             ++ ++   L R +APYST++     + D  +PEKDP EL+RAD +YL+L  NL+SYW +
Sbjct: 934  EDLTQIPSGLERKFAPYSTNY-----LTD-DSPEKDPRELERADHIYLELFYNLRSYWSA 987

Query: 1468 RMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQAQ 1527
            R   L V+TT++++Y +L+ KL K+D+A+  L +S  +K +  +I  +GNYMN  S    
Sbjct: 988  RSHCLLVLTTYERDYFDLMYKLEKIDEAIQRLYDSTRIKKLLLIIREIGNYMNKGS--VT 1045

Query: 1528 GFKLATLQRLTFIKDST-NSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQLV 1586
            G KL +L +L+F+K S+  +++FL++VE++VR ++P    F  ++  V D+ K+++E + 
Sbjct: 1046 GIKLNSLPKLSFVKSSSEKNISFLHFVERVVRESFPDVYTFTEDIAKVEDLGKVTLEHVE 1105

Query: 1587 SDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLTI 1646
             +C+EF++ + +V  S+  G LSD +K HP+D +  K+   +  A+ K ELL ++ +LT 
Sbjct: 1106 LECEEFAEKVGSVVYSLTQGKLSDPTKLHPKDAIFTKMRYKINRAKSKSELLINQHELTK 1165

Query: 1647 MEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVYERHKKMVED 1706
                RLM+ YGE+                    +KK   +NI+ EE  ++YE+ K ++E 
Sbjct: 1166 RSLNRLMKYYGEEPMDKESKNNFFNYFVEFAMVFKKCAKENIEREEVTRLYEQRKHLLEQ 1225

Query: 1707 QQKKLQEQXXXXXXXXXXXXXXXXXXXXRRAMMDKLLDQLKNAGPSKTDPSSARKR---- 1762
            + KK++EQ                        +D L+ +L++A   K  P+  R+R    
Sbjct: 1226 RNKKIEEQEHSDDEINA---------------VDDLITKLRDA--KKQHPAPLRRRRSTK 1268

Query: 1763 ALVRKK-----LMTESTALLKDIE 1781
            A++ +K     L+  + ALL DI+
Sbjct: 1269 AVLNEKRAGEPLLERTQALLSDIQ 1292

 Score = 41.2 bits (95), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 102/223 (45%), Gaps = 24/223 (10%)

Query: 523 ILEYCQWSMIFINHLCSCSSNINQRMLLRTKLENC-GILRIMNKVKTLDYDKVIEQIDLY 581
           ++EYC   M  +N +     +  ++  +    EN      ++  ++ LD +    QI  Y
Sbjct: 266 LVEYCTLFMFMVNSIIEGYQSFEKKSAIIASFENVEKFTPLITLIENLDDENTSTQIKKY 325

Query: 582 ENNKLDDLNTLLESNNKNANINLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQF 641
            + KL+    ++  N+   +I L+D  S  + L D    T+N  L  S + +LF    Q 
Sbjct: 326 RDVKLE----IMTRNSCVPSI-LED-VSYSQVLTDLVIQTKNTALE-SGLGNLFTLVFQV 378

Query: 642 IEEKK--DPVKLSRQLKLLDSL---VTNVSVSSTDQEASMNMAIQRLYDAMQTDEVARRS 696
           I  KK  + +K  + + LL      V  V  S  + +     AI  L D +Q++++ RR+
Sbjct: 379 IHTKKLNECIKFLKLIALLVPYLNKVLTVEDSLENPDYFFKDAITTLVDNLQSEDLTRRA 438

Query: 697 ILESRTLTKKLEEVQA-----------ERDLLSQKLKNAEHGL 728
           ++E +TL K + E+ +           ++  + Q+LK AEH L
Sbjct: 439 MVEIKTLEKNITELNSHIAELENEAHMDKRTIIQQLKQAEHML 481

>Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to
            Ashbya gossypii AFR301C - AGL364C
          Length = 1454

 Score =  293 bits (749), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 151/420 (35%), Positives = 254/420 (60%), Gaps = 17/420 (4%)

Query: 1294 PQKKLKQLHWEKLDATDNSIW--KTNKAEKFADDLYEKGVLTDLEKAFAAREIKSLASKK 1351
            P+ KLKQ+HW+K+D    ++W  ++ +  K + +L   G+  ++++ F         +  
Sbjct: 958  PKLKLKQIHWDKIDDIKETVWCDQSQRVSK-STELASFGIFQEIDELFQLNPTSPAIANA 1016

Query: 1352 KEDL-----DKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLS 1406
              +L      K+S LSR+++Q+FGINLH++++  V+++  K+L CD + L   SVIEF  
Sbjct: 1017 TANLLKAKSTKVSLLSRELAQEFGINLHIFSHYTVEELTSKVLNCDNEVLKNQSVIEFFC 1076

Query: 1407 KPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSYWG 1466
            K EI  +  ++ + +APYS ++         + P++DPNEL RAD++YL+L  NL+SYWG
Sbjct: 1077 KEEINNIPKSVQQLFAPYSANYI------TGEQPDRDPNELDRADRIYLELFYNLRSYWG 1130

Query: 1467 SRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQA 1526
            +R + L VI TFDK+Y ++L KL ++D A  +LQ S  LK +F +I+ +GNYMN   +  
Sbjct: 1131 ARSKYLLVILTFDKDYFDILHKLERIDDATKALQNSAKLKELFFIIVEIGNYMNQ--RPV 1188

Query: 1527 QGFKLATLQRLTFIKDST-NSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQL 1585
             G +L++L +L F K ST N+M+F++ +E+IVR  YPS +DF+  L+ +L+V  I ++ +
Sbjct: 1189 AGIQLSSLNKLAFTKTSTDNNMSFIHVIERIVRRKYPSIHDFVEGLDKILEVQNIIVQHV 1248

Query: 1586 VSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLT 1645
              +  EF   I ++ER    G LSD S+FHP+D+ + K    +  A+KK +LL D+  LT
Sbjct: 1249 QQEAHEFCDRIAHLERLTTIGILSDPSRFHPEDKFMLKTESKILLAKKKADLLKDQCTLT 1308

Query: 1646 IMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVYERHKKMVE 1705
            + +F +LM  +GE+                 IT ++KA  +N + EE  ++YE+ ++ +E
Sbjct: 1309 MSDFEKLMVYWGENPNNTNSKNSFFKKFIDFITLFRKAGKENSEREEMTRIYEKRRRALE 1368

>AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1655

 Score =  286 bits (733), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 157/436 (36%), Positives = 259/436 (59%), Gaps = 28/436 (6%)

Query: 1292 PRPQKKLKQLHWEKLDATDNSIW--KTNKAEKFADDLYEKGVLTDLEKAFAAREIK---- 1345
            P  + KLKQ+HW+K++    ++W  +  +  K + +L   G+  ++E+ F   EIK    
Sbjct: 1160 PSTRIKLKQIHWDKIENIKETVWCDEQQRVSK-SSELESLGIFKEIEELF---EIKPAST 1215

Query: 1346 ----SLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSV 1401
                + AS  K    +IS LSR+++Q+FGINLH+++   V+++V K+L CD + +    V
Sbjct: 1216 NLANATASLLKAKSSRISLLSRELAQEFGINLHVFSLYTVEELVDKVLSCDSEVMKNQGV 1275

Query: 1402 IEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINL 1461
            +EF  K E   V  ++ R + PY T++         + PEKDP EL+RAD++YL+L  NL
Sbjct: 1276 LEFFCKEEANNVPQSIQRLFGPYETNYL------TGERPEKDPAELERADRIYLELFYNL 1329

Query: 1462 QSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMND 1521
            +SYW +R   L VI+TF+++Y ++L KL+++D A  ++Q S  LK +F +I+ +GNYMN 
Sbjct: 1330 RSYWAARSNYLLVISTFERDYFDILYKLQRIDDATKAIQSSNKLKELFFIIVEIGNYMNQ 1389

Query: 1522 TSKQAQGFKLATLQRLTF---IKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVV 1578
              K  QG +L++L +L F   IKD  N+++F++ +E+IVR+ YPS +DF+  +  +  V 
Sbjct: 1390 --KPVQGIQLSSLNKLAFTKTIKD--NNLSFIHVLERIVRTRYPSVHDFVEGINSITGVA 1445

Query: 1579 KISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELL 1638
             I ++ +  +  EF   I N++RS+  G LSD SKFHP+DR L +    L  A+KK  LL
Sbjct: 1446 NIIVQHVQQEAHEFCDRIANLDRSLASGKLSDPSKFHPKDRFLQRTDTKLAQAKKKARLL 1505

Query: 1639 GDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVYE 1698
             D+  LTI +F +LM  +GE+                 I  ++KA  +N + EE ++ YE
Sbjct: 1506 RDQCSLTISDFEKLMLYWGENPANPNSKNTFFQKFIDFILLFRKAAKENTEREELDRTYE 1565

Query: 1699 RHKKMVEDQQKKLQEQ 1714
            + ++++E Q   LQ++
Sbjct: 1566 KRRRLLE-QTAALQDR 1580

>KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1367

 Score =  284 bits (727), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 151/423 (35%), Positives = 253/423 (59%), Gaps = 10/423 (2%)

Query: 1293 RPQKKLKQLHWEKLDATDNSIWKTNKAEK-FADDLYEKGVLTDLEKAFAAREI-----KS 1346
            +P KKLKQ+HW+K++  +++IW   +  +     L   GVL ++E  F  +E      KS
Sbjct: 867  KPVKKLKQIHWDKVEDIEDTIWHNEEIRRDTLKHLQHDGVLKEIESTFKIKEAGPIAKKS 926

Query: 1347 LASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLS 1406
             A++       +SFLSRD++Q FGINLHM++NL VD+ VKK+L CD D +    V+EF +
Sbjct: 927  CATEGSASKKSVSFLSRDLAQAFGINLHMFSNLSVDEFVKKVLGCDNDIIKNVPVLEFFN 986

Query: 1407 KPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSYWG 1466
            + E+  +S +  R YAPY   +       +    E  P  L+R D+++L+L   L+ YW 
Sbjct: 987  REELGAISSSTLRKYAPYCVQYFPEPDASNHTTFEPLP-PLERGDEIFLKLCYVLRDYWS 1045

Query: 1467 SRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQA 1526
             R   L V+ T++K+Y +++ KL+K++ A+  L+ES  L+N   +I+ +GNYMN  +K A
Sbjct: 1046 VRSHCLLVVCTYEKDYYDIVYKLQKLEDAMRRLKESTALQNFLYIIIEIGNYMN--TKAA 1103

Query: 1527 QGFKLATLQRLTFIKDSTN-SMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQL 1585
             G K+++L +L FIK S N +++FL+Y+E+++R+ YP    F+ +L+ V D+ K++++QL
Sbjct: 1104 SGVKISSLNKLVFIKSSDNKNLSFLHYIERLIRTKYPDIYRFVHDLKTVEDLGKLTLDQL 1163

Query: 1586 VSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLT 1645
              +C E+   I  +  +V+ G LSD +K +P D VL K+      A  K +LL  ++KL+
Sbjct: 1164 ELECSEYIGKIRKMGHAVKKGPLSDPAKLYPGDMVLKKIRFKAQRANSKAQLLESQMKLS 1223

Query: 1646 IMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVYERHKKMVE 1705
              +  +LM+ YGED +               +  +KK   +NI+ EE ++VYE+ +K++E
Sbjct: 1224 SNDMNQLMKYYGEDPKDATTKNHFFTSFAEFLQLFKKCSRENIEREEMDRVYEQRRKLLE 1283

Query: 1706 DQQ 1708
            D+Q
Sbjct: 1284 DKQ 1286

>TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1292

 Score =  282 bits (721), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 147/422 (34%), Positives = 250/422 (59%), Gaps = 13/422 (3%)

Query: 1293 RPQKKLKQLHWEKLDATDNSIWK-TNKAEKFADDLYEKGVLTDLEKAFAARE--IKSLAS 1349
            +P++ LKQ+HWEKL+  + ++W   N+ ++   +L   G+ + +E++F  +E  IK   +
Sbjct: 798  KPKEALKQIHWEKLNDIEETLWADQNQKDETMKELKRGGIFSQIEESFKVKERTIKQTKN 857

Query: 1350 K-KKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLSKP 1408
            K K+E     SFL RD++QQFGINLHM++    +  V K+L+CD + +   + +EF ++ 
Sbjct: 858  KDKREKTPTKSFLPRDVAQQFGINLHMFSQYSPEQFVLKVLQCDNEIIQNSTALEFFTRE 917

Query: 1409 EIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSYWGSR 1468
            ++V V+ +L R + PYSTD+      ED   P KDP EL R D+++L+L  NLQ YW  R
Sbjct: 918  DLVNVTQSLRRAFDPYSTDYLS----EDG--PSKDPAELDRPDRIFLELCYNLQYYWYER 971

Query: 1469 MRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQAQG 1528
               L  +TT++++Y + + +L+K+D  +  L+     K++  +I+ +GNYMN   + A+G
Sbjct: 972  SFCLFTLTTYERDYYDFIYRLQKIDDVIQKLRHGTRFKSILYIIVEIGNYMN--KRPAEG 1029

Query: 1529 FKLATLQRLTFIKDSTNSMT-FLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQLVS 1587
             KL++L +L F+K S +  T FL+++E+I+R  YP    F  +L  V D+ KIS++ L  
Sbjct: 1030 IKLSSLNKLAFVKSSVDKNTSFLHFLERIIRVKYPDLYGFTDDLSKVEDIGKISLDHLEQ 1089

Query: 1588 DCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLTIM 1647
            +C EF   I  V  +++ G LSD S+ HP+D ++ K+   +  A+ K +LL D+ KL  +
Sbjct: 1090 ECNEFRSKIDEVVHTLKEGKLSDHSRLHPKDLIVEKITYKIRRAKVKSDLLQDQFKLINI 1149

Query: 1648 EFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVYERHKKMVEDQ 1707
            +  +LM  +GED                    +KK   +NI+ E+ ++VYE+ K M+E +
Sbjct: 1150 DLKKLMSHFGEDFNDSEAKNSFFQHFIEFSVNFKKCAKENIEREDSQRVYEQRKNMLESR 1209

Query: 1708 QK 1709
            Q+
Sbjct: 1210 QR 1211

 Score = 50.1 bits (118), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 102/218 (46%), Gaps = 22/218 (10%)

Query: 518 GG---ENAILEYCQWSMIFINHLCSCSSNINQRMLLRTKLENCGILRIMNKVKTLDYDKV 574
           GG   E    ++   S++ +N +       +Q++ L   L+ CGI    + +K L  D  
Sbjct: 317 GGLKPEKCRADFMTTSLLVVNSILQALPTKDQKVSLMQTLKECGIHHCFHLIKQLQVDDT 376

Query: 575 IEQIDLYENNKLDDLNTLLESNNKNANINLQDPTSMLRNLWDACKGTENEKLLISLMQHL 634
            +QI +Y    L+    L+E+ +    I+       L  L    KGT    L+   + HL
Sbjct: 377 DKQIAIY----LELETELIEATSAADQIDDSVYQPALHYLLSRTKGT----LIEQDLAHL 428

Query: 635 FLSSSQFIEEK--KDPVKLSRQL-KLLDSLVTNVSVSSTDQEASM-NMAIQRLYDAMQTD 690
           F S ++ +  +   + +KL R L  +LD L+ N   + + + AS+   +I +  D ++++
Sbjct: 429 FESLNKILATRTTSESIKLFRSLGSILDYLIDNFCQAVSTEPASLVQESINKFLDNLESE 488

Query: 691 EVARRSILESR-------TLTKKLEEVQAERDLLSQKL 721
           E+ RR++ E          L K+L E++  +D+  +KL
Sbjct: 489 EIGRRAMKEMTELENTIVVLRKELSELRDFKDISKEKL 526

>ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1424

 Score =  283 bits (723), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 147/420 (35%), Positives = 250/420 (59%), Gaps = 16/420 (3%)

Query: 1293 RPQKKLKQLHWEKLDATDNSIWKTN-KAEKFADDLYEKGVLTDLEKAF-----AAREIKS 1346
            +P++ LKQ+HWEK+D  + ++W+ N + E+   +L   G+   ++  F       +++K+
Sbjct: 848  KPKQSLKQIHWEKIDDVEKTVWEDNEQREETVKELEISGIFEKVQTTFQLKNSTVKKVKN 907

Query: 1347 LASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLS 1406
              S KK    K SFLSRD++QQFGINLHMY+  PV++ V K+L+CD D L   SV+EF +
Sbjct: 908  DNSTKKTTQLK-SFLSRDLAQQFGINLHMYSQYPVEEFVLKVLRCDNDILQNVSVLEFFN 966

Query: 1407 KPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSYWG 1466
              E+  +  +L+R++APYS D+      ++ K+P  DPNEL+R D+++L+L  NL+SYW 
Sbjct: 967  NEELTNIPASLSRSFAPYSADF------QENKSPTVDPNELERPDRIFLELCYNLRSYWR 1020

Query: 1467 SRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQA 1526
             R + L +  T++++Y +L+ KL+ +D A+  ++ +  LK +  +I+ +GNYMN   K  
Sbjct: 1021 ERSKCLLIFATYERDYYDLVYKLQNIDDAIQKIKNAFRLKQLLYIIMEIGNYMN--KKNV 1078

Query: 1527 QGFKLATLQRLTFIKDST-NSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQL 1585
             G +L +L +L+F+K S  N+++FL+++EK+VR  YP    F  +L     +  IS + +
Sbjct: 1079 SGIRLNSLSKLSFVKSSVDNNLSFLHFIEKVVRVKYPDIYHFTDDLNKAEALGYISFDHI 1138

Query: 1586 VSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLT 1645
             S+C+E+   + +V R    G LS  S  HP+D ++ KV   +  A+ K +LL D+ KL 
Sbjct: 1139 QSECEEYCSKVNSVVRMTTEGILSQQSNLHPKDEIMRKVKYKINRAKTKSQLLWDQYKLI 1198

Query: 1646 IMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVYERHKKMVE 1705
              +  +LM+ +GE+                    +KK   +NI+ EE  +VYE+ KK+++
Sbjct: 1199 SADLDKLMKYFGENPMDKEAKNSFFANFGEFSVVFKKCAKENIEKEEAYRVYEQRKKLLD 1258

>Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W
            (BNR1) - involved in actin filament organization [contig
            159] FULL
          Length = 1389

 Score =  281 bits (719), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 152/419 (36%), Positives = 255/419 (60%), Gaps = 14/419 (3%)

Query: 1296 KKLKQLHWEKLDATDNSIWKTNKA-EKFADDLYEKGVL---TDLEKAFAAREIKSLASKK 1351
            ++LKQ+HW+K++    +IW   +     A  L E G+L   +DL K   +   K+   + 
Sbjct: 919  QRLKQIHWDKIEDVKETIWNEEEGRHNVALHLEESGILDEISDLFKITPSAPTKANTGRL 978

Query: 1352 KEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLSKPEIV 1411
             E+   ++ L RD++QQFGINLHM++NL V+D V K+L CDR  +   SV+EF ++ ++V
Sbjct: 979  NEE-GPLAILPRDLAQQFGINLHMFSNLSVEDFVLKVLHCDRQIITNQSVLEFFARDDLV 1037

Query: 1412 EVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSYWGSRMRA 1471
             +  +L+  + PYS+D+         K P KD ++L+RAD+++L L  NL+SYW  R   
Sbjct: 1038 NIPHSLSLKFEPYSSDFRL------GKGPLKDSSKLERADRIFLALCYNLRSYWRQRSIC 1091

Query: 1472 LTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQAQGFKL 1531
            L  + T++K+Y +++ KL++VD A++ ++ S  LK+   +I+ +GNYMN   KQA G KL
Sbjct: 1092 LLTLLTYEKDYFDIMYKLQRVDDAITMIKSSHKLKDALMMIVEIGNYMN--RKQAPGIKL 1149

Query: 1532 ATLQRLTFIKDSTN-SMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQLVSDCK 1590
            ++LQ+L F+K S + +++FL+ VE+ +R    +   F+ EL  VLD+  + + Q+  D +
Sbjct: 1150 SSLQKLAFVKSSKDKNVSFLHVVERFLRVKCKATYGFVDELSKVLDLGNLVVGQVEQDFQ 1209

Query: 1591 EFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLTIMEFL 1650
            E+ + I  V++S++ G LSDS  FHP+DR+L KV P +  A +K  LL ++ KLT+    
Sbjct: 1210 EYLKRIDAVKQSLDCGRLSDSESFHPEDRLLIKVGPKMAGAARKATLLQNQFKLTMRALE 1269

Query: 1651 RLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVYERHKKMVEDQQK 1709
             LM++YGED +               I ++KKA  +NI+ EE E++Y   K++++ + K
Sbjct: 1270 NLMRLYGEDHKSVDCRNDFFHHFIQFIIQFKKAAKENIENEEVERIYNHRKELLQQKTK 1328

 Score = 42.4 bits (98), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 49/231 (21%), Positives = 112/231 (48%), Gaps = 20/231 (8%)

Query: 525 EYCQWSMIFINHLCSCSSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENN 584
           +YC  S+  IN +   +S++ +++    +L+   I R+   +  L++ ++  +ID Y++ 
Sbjct: 348 DYCLTSLFLINSILQITSSVAEKLAYFKRLKELNIHRLFQLMHQLEHHEIDGEIDKYKS- 406

Query: 585 KLDDLNTLLESNNKNANINLQDPTSMLRNLWDACKGTENEKLLISLMQHLF--LSSSQFI 642
            L++   + ++N +   +        L N+        ++  L   M  LF  LS +   
Sbjct: 407 -LEE-EVIQKTNPEFPQLLNVSYGKFLTNIIHQT----HQNPLEHCMHQLFETLSKTLVA 460

Query: 643 EEKKDPVKLSRQLKLLDSLVTNVSVSSTDQE-----ASMNMAIQRLYDAMQTDEVARRSI 697
               D +K+   L L  S++  +   S  +E     + +N+++  L D +Q+DE+A+R++
Sbjct: 461 RTMSDNLKV---LTLFHSVIDYLKEYSYGEENINIDSVVNISLNHLVDGLQSDEIAKRAM 517

Query: 698 LESRTLTKKLEEVQAERDLLSQKLKNAEHGLVGQL---QDELAQRDRILSK 745
            E     K++E +++E   L +  +  + G++ +L   Q  LA+++  + K
Sbjct: 518 SELELAQKEIENLESEIRALRKDKEITKGGVLSELRQTQQALAEKETAIEK 568

>NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717
          Length = 1349

 Score =  280 bits (715), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 153/428 (35%), Positives = 253/428 (59%), Gaps = 16/428 (3%)

Query: 1290 NYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYE---KGVLTDLEKAFAAREI-- 1344
            N  + +KKLKQ+HW+K++   N++W  + A+   D + E    G+   ++  F+ +++  
Sbjct: 851  NNQQSKKKLKQIHWDKIENVKNTLW--DHADGRQDTILELEHAGIFEKVQGMFSVQDLVV 908

Query: 1345 -KSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIE 1403
                A   +E    +SFLSRD SQQ  INLH++A L   +V++K+L CD D +   SV+E
Sbjct: 909  KPKRAVNVRESNKLLSFLSRDFSQQLAINLHIFAQLTEKEVLQKVLACDNDTIQNVSVLE 968

Query: 1404 FLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQS 1463
            F  K E+V +     R++ PYS D+     +  ++ P K+P+EL+RAD+L+L L  NL+ 
Sbjct: 969  FFCKDEMVNIGSARIRHFTPYSADY-----LNASEQPAKNPDELERADKLFLYLPFNLRR 1023

Query: 1464 YWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTS 1523
            YW  R + L VI+T+++EY ++L  L+K+D A+ +++ SE  K    +I+ +GNYMN  +
Sbjct: 1024 YWAERSQCLLVISTYEREYYDMLYNLQKIDDALQNIRHSEKFKTFLYIIIELGNYMN--T 1081

Query: 1524 KQAQGFKLATLQRLTFIKDSTN-SMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISI 1582
            K  +G +L +L +L FIK + N + +FL++VEK++R +YP    F+ +L  V D+ KI+I
Sbjct: 1082 KAVEGIRLNSLTKLAFIKSNDNKNFSFLHFVEKMLRIHYPDVYGFINDLNKVEDLGKITI 1141

Query: 1583 EQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEV 1642
            +Q+   C+E+   I  +  SV  G LSD ++ HP D++L KV   +  A+ K ELL  + 
Sbjct: 1142 DQVQLQCEEYCTKIERIAHSVTKGKLSDPTQLHPDDQILRKVKYKVTRAKTKSELLQAQF 1201

Query: 1643 KLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVYERHKK 1702
            KLT  +F + M  YGED +                + ++K   +NI+ EE ++ YE+ KK
Sbjct: 1202 KLTNNDFRKSMLYYGEDPDDTDNKINFFNQFVEFSSLFRKCARENIEKEEADRAYEQRKK 1261

Query: 1703 MVEDQQKK 1710
            + E + KK
Sbjct: 1262 IAELRNKK 1269

>KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1283

 Score =  276 bits (706), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 153/482 (31%), Positives = 279/482 (57%), Gaps = 36/482 (7%)

Query: 1288 FENYPRPQ-KKLKQLHWEKLDATDNSIWK--TNKAEKFADDLYEKGVLTDLEKAFAAREI 1344
            F + P+P+ K LKQ+HW+K++   +++W   T +++   +DL EKGV  ++   F  + +
Sbjct: 792  FVSKPKPEVKPLKQIHWDKIEDISDTLWNEPTTRSD-LKEDLNEKGVFNEIVNLFEQKAV 850

Query: 1345 K------SLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHT 1398
            +        ASKK E   K+S LSRD++QQFGINLHM+++  V+D++ K+L+CD D +  
Sbjct: 851  RMKKKSNVTASKKNE---KVSLLSRDLAQQFGINLHMFSSYSVEDLLIKVLRCDDDIIKN 907

Query: 1399 PSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLI 1458
             SV+EF +K +   +  ++ R++ PY++DW+        KAP++D ++L+RAD++YL++ 
Sbjct: 908  HSVLEFFNKDDFETIPQSIIRSFEPYASDWKT------GKAPKEDVSKLERADRIYLEMF 961

Query: 1459 INLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNY 1518
             N++ YW  R  +L +  T++K+Y ++L +L+K+D   S ++ S  LK  F +++ +GN+
Sbjct: 962  YNMRYYWKIRSSSLLIALTYEKDYYDILYQLQKIDDGTSMIKNSNRLKQFFYIVVEIGNF 1021

Query: 1519 MNDTSKQAQGFKLATLQRLTFIK-DSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDV 1577
            MN+  K+ QG KL++L +L+ +K +S  +++FL+ +E+I+R  YP   DF  +L  + D+
Sbjct: 1022 MNN--KKTQGIKLSSLNKLSMVKTNSDKNLSFLHVIERIIREKYPDIYDFTRDLNRLSDL 1079

Query: 1578 VKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGEL 1637
             KI+IE + S+  E+ + I+ ++ S E G LS + K HP D+   K+   LP A +K EL
Sbjct: 1080 GKINIESIESEIHEYYEKIMRMKESFERGKLSHTEKHHPDDKFRKKISAKLPSAVRKAEL 1139

Query: 1638 LGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVY 1697
            L ++ KLT+ +F   M+  GED                 +T + K   +N + E   +V+
Sbjct: 1140 LHNQCKLTMNDFNSTMKYCGEDPTNSEAKNTFFRNFSEFLTLFNKISQENKEREAMNRVH 1199

Query: 1698 ERHKKMVEDQQKKLQEQXXXXXXXXXXXXXXXXXXXXRRAMMDKLLDQLKNAGPSKTDPS 1757
            E+ +++++    + Q +                        +D L+ +L++  P +T P 
Sbjct: 1200 EQRQQLLQKASTETQVEKSADDEAADT--------------IDILIKKLRSVDPQQTIPG 1245

Query: 1758 SA 1759
            S+
Sbjct: 1246 SS 1247

>AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1260

 Score =  275 bits (704), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 145/409 (35%), Positives = 247/409 (60%), Gaps = 16/409 (3%)

Query: 1292 PRPQK-KLKQLHWEKLDATDNSIW-KTNKAEKFADDLYEKGVLTDLEKAFAA-----REI 1344
            P  Q+ KLKQ+HW+K+D    ++W + N+    +  L   GV  ++E  F       +  
Sbjct: 765  PTSQRVKLKQIHWDKIDNIKETVWNEHNERISTSTKLETFGVFKEIEDLFKVVPATPKTA 824

Query: 1345 KSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEF 1404
             S +  +     KI  LS D++Q FGINLH++++   ++++  +L C  + L    VIEF
Sbjct: 825  SSNSPTQTTRNGKIRLLSNDLAQLFGINLHIFSHYSTEELIDMVLLCHAEILQNQRVIEF 884

Query: 1405 LSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSY 1464
             SK +I  +  +  R +APY T++         K P+KDP  L+RAD++YL+L  NL+SY
Sbjct: 885  FSKDDINHIPQSTQRMFAPYETNYL------TGKTPDKDPAVLERADRIYLELFYNLRSY 938

Query: 1465 WGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSK 1524
            W +R + L V+ T++++Y ++L KL+++D A  +++ S+ LK +F +I+ +GNYMN+  K
Sbjct: 939  WAARSKYLLVLLTYERDYYDILYKLQRIDDATKAIRSSKKLKQLFFIIIEIGNYMNN--K 996

Query: 1525 QAQGFKLATLQRLTFIKDST-NSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIE 1583
            QA G +L+++ +L F K S  N+++F++ +E+I+R+ YP  ++F  +LE V D+  I ++
Sbjct: 997  QALGIQLSSINKLAFTKTSKDNNLSFIHVIERIIRTRYPELHNFAEDLEKVQDMANIIVQ 1056

Query: 1584 QLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVK 1643
             +  + +EF + I N+ERS+  G LSDSS+FHP+D+ L+K    +  ARKK ELL D+  
Sbjct: 1057 HVQQEAQEFRERISNLERSLTVGALSDSSRFHPKDQFLSKTASSIQHARKKAELLIDQST 1116

Query: 1644 LTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEE 1692
            LT+ +F +L+  +GED++               +  +KKA  +NI+ EE
Sbjct: 1117 LTMGDFEKLVSYWGEDTKDIQSRNTFFQKFLDFVALFKKASKENIEREE 1165

>Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} similar to
            Ashbya gossypii AGL364C
          Length = 1306

 Score =  275 bits (704), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 149/416 (35%), Positives = 247/416 (59%), Gaps = 16/416 (3%)

Query: 1297 KLKQLHWEKLDATDNSIWKTNKAE-KFADDLYEKGVLTDLEKAF-----AAREIKSLASK 1350
            KLKQ+HW+K+D    ++W  +K     + +L   GV  ++E+ F     A +   ++ + 
Sbjct: 815  KLKQIHWDKIDDISKTVWSDDKERVSVSSELANFGVFKEIEELFKIVPAAPKVGNTMFTA 874

Query: 1351 KKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLSKPEI 1410
            +     K++ LS D++QQFGINL++++N  V+++V+K+L CD + +   SVIEF SK +I
Sbjct: 875  QNTRNGKVTLLSNDLAQQFGINLYIFSNYSVEELVEKVLLCDTEVMKNQSVIEFFSKDDI 934

Query: 1411 VEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSYWGSRMR 1470
              +  ++ R +APY T++           PEKD   L RAD++YL+L  NL+SYW  R +
Sbjct: 935  NHIPQSIQRMFAPYETNYL------TGDKPEKDSRSLDRADRIYLELFYNLRSYWAPRAK 988

Query: 1471 ALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQAQGFK 1530
             L  + T++K+Y ++L KL+++D   ++++ S+ LK +  +I+ VGNYMN+  KQA G +
Sbjct: 989  YLLALLTYEKDYYDILYKLQRIDDGTTAIKTSKRLKPLLFIIIEVGNYMNN--KQALGIQ 1046

Query: 1531 LATLQRLTFIKDST-NSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQLVSDC 1589
            L++L +L F K S  N+++F++ +E IVR NYP  + F+ +LE +LDV  I ++ +  + 
Sbjct: 1047 LSSLNKLAFTKTSKDNNLSFIHVIESIVRLNYPDLHGFVNDLEKILDVSNIIVQHVQQEA 1106

Query: 1590 KEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLTIMEF 1649
            +EF + I  +ERS+  G LSDSSKFHP+D+ L      +  A KK +LL  +  LT+ EF
Sbjct: 1107 QEFYEKISTLERSLRVGVLSDSSKFHPKDKFLINTESNISHAMKKADLLKQQCTLTMGEF 1166

Query: 1650 LRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVYERHKKMVE 1705
             +LM  +GED                    +KKA  +NI+  E  +V E  + ++E
Sbjct: 1167 DKLMVFWGEDPNNVFSKNTFFQKFLDFALLFKKANKENIE-REVRRVCESRRYLLE 1221

>Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  274 bits (700), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 149/432 (34%), Positives = 249/432 (57%), Gaps = 31/432 (7%)

Query: 1292 PRP-QKKLKQLHWEKLDATDNSIWKTN-KAEKFADDLYEKGVLTDLEKAFAAREIKSLA- 1348
            P P +K+LKQ+HW+K++   +++W+   + ++    L   G+ + +E  F  +    +A 
Sbjct: 870  PVPTEKRLKQIHWDKVEDIKDTLWEDGLQRQETIRGLQTDGIFSQIEDIFKMKSPTKIAN 929

Query: 1349 --------------SKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRD 1394
                           K   +L KISFLSRD++QQFGINLHM++ L   + V K+LKCD D
Sbjct: 930  KTSAISSTVLSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLKCDND 989

Query: 1395 FLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLY 1454
             +   ++++F  K E+V +  +L   Y PYS    G           K  ++LQRAD+++
Sbjct: 990  IVQNVNILKFFCKEELVNIPKSLLNKYEPYSRGENG-----------KAASDLQRADRIF 1038

Query: 1455 LQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILA 1514
            L+L INL+ YW  R ++L  ++T++++Y +L+ KL+ +D  +S L  S+  KN+  +I  
Sbjct: 1039 LELCINLRFYWNVRSKSLLTLSTYERDYYDLIFKLQNIDDGISHLNRSDKFKNLMFIITE 1098

Query: 1515 VGNYMNDTSKQAQGFKLATLQRLTFIKDSTN-SMTFLNYVEKIVRSNYPSFNDFLTELEP 1573
            +GN+MN   +  +G KL +L +L F++ ST+ +M+FL+++EKI+R  YP    F+ +L+ 
Sbjct: 1099 IGNHMN--KRIVKGIKLKSLTKLVFVRSSTDQTMSFLHFIEKIIRIKYPDIYGFVDDLKK 1156

Query: 1574 VLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARK 1633
            V D+ KIS+E +  +C EF   I N+    + G LS+     P+D+++ KV   +  AR 
Sbjct: 1157 VEDLGKISLEHIEIECHEFHNKIENLVTQFQTGKLSNEENLDPRDQIVKKVKFKINRARI 1216

Query: 1634 KGELLGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEE 1693
            K ELL D+ KLT+++  +LM+ YGED                 +T +KK   +NI+ EE 
Sbjct: 1217 KSELLMDQCKLTLIDLNKLMRYYGEDPNDKESKNEFFQPFIEFLTMFKKCAKENIEKEEM 1276

Query: 1694 EQVYERHKKMVE 1705
            E+VYE+ K ++E
Sbjct: 1277 ERVYEQRKNLLE 1288

 Score = 35.0 bits (79), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 27/39 (69%)

Query: 679 AIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLL 717
           ++ +L D++Q+DE+ARR++ E   L KK+  +  + DL+
Sbjct: 511 SVNKLLDSLQSDEIARRAVTEIDDLNKKISHLNEKLDLV 549

>KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1389

 Score =  273 bits (699), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 152/420 (36%), Positives = 255/420 (60%), Gaps = 16/420 (3%)

Query: 1297 KLKQLHWEKLDATDNSIW-KTNKAEKFADDLYEKGVLTDLEKAFAAREIKSLASKKKEDL 1355
            KLKQ+HW+KL+    +IW +  + +  A  L   G L ++ + F  R  +SL  K K + 
Sbjct: 920  KLKQIHWDKLEDVSETIWSQEGERQDAARHLESSGFLDEIAELF--RVNQSLPIKAKSET 977

Query: 1356 ----DKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLSKPEIV 1411
                DK+S L RD++QQFGINLHM++NL VD+ V K+L CDRD ++  SV+EF ++ ++ 
Sbjct: 978  SSGKDKVSILPRDLAQQFGINLHMFSNLSVDEFVNKVLHCDRDVVNNQSVLEFFAREDLS 1037

Query: 1412 EVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSYWGSRMRA 1471
             +  ++A    PY+TD       +  +AP  D  +L+RAD+++L+L  NL+SYW  R   
Sbjct: 1038 IIPRSIASKLEPYATDH------QPNEAPLLDREKLERADRIFLELCYNLRSYWRPRSLC 1091

Query: 1472 LTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQAQGFKL 1531
            L  ++T++K+Y +L+ KL++VD A++ ++ S  LK+   +I+ +GNYMN   KQA G +L
Sbjct: 1092 LLTLSTYEKDYFDLIYKLQRVDDAINIIKNSAKLKDTLMMIIEIGNYMN--RKQAGGIRL 1149

Query: 1532 ATLQRLTFIKDSTN-SMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQLVSDCK 1590
            ++LQ+LTF+K S + +M+ L+ VE+ +R    S   F+ +L  VLD+  + + Q+  D  
Sbjct: 1150 SSLQKLTFVKSSKDKNMSLLHAVERFLRVKCRSAYGFVEDLSRVLDLGNLMVGQIEQDFH 1209

Query: 1591 EFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLTIMEFL 1650
            E++Q I  V++S+E G LS    FHP+DR+L KV P +  A +K  LL ++  LT+    
Sbjct: 1210 EYTQRISGVKQSLEQGRLSKPENFHPEDRLLIKVGPKIAGATRKASLLRNQFVLTMRALE 1269

Query: 1651 RLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVYERHKKMVEDQQKK 1710
             LM++YGED                 ++++KK   +N + E  E++Y + K++++++ K+
Sbjct: 1270 NLMKLYGEDPSNIDSKNEFFQHFINFVSQFKKVAKENEEKEAVERIYIQRKELLQNRSKE 1329

>Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  272 bits (696), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 149/431 (34%), Positives = 247/431 (57%), Gaps = 30/431 (6%)

Query: 1292 PRPQKKLKQLHWEKLDATDNSIWK-TNKAEKFADDLYEKGVLTDLEKAFAAREIKSLASK 1350
            P P+++LKQ+HW++++   +++W+   + ++   +L   GV + +E  F  R    +ASK
Sbjct: 871  PSPERRLKQIHWDRVEDVKDTLWEDAFQRQETIRELQTDGVFSQIEDIFKMRSPAKIASK 930

Query: 1351 KK---------------EDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDF 1395
                              +L K+SFLSRD++QQFGINLHM++ L   + V K+L CD D 
Sbjct: 931  NNAGSSTALSSNNGKSLNELKKVSFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDI 990

Query: 1396 LHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYL 1455
            +   ++++F  K E+  +  +L   Y PYS   EG K+V D          LQRAD+++L
Sbjct: 991  IQNVNILKFFCKEELTNIPKSLLNKYEPYSQGKEG-KAVSD----------LQRADRIFL 1039

Query: 1456 QLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAV 1515
            +L INL+SYW  R + L  ++T++++Y +LL KL+K+D  +S L  S   KN+  +I  +
Sbjct: 1040 ELCINLRSYWNVRSKNLLTLSTYERDYYDLLFKLQKIDDGISHLNLSPKFKNLMFIITEI 1099

Query: 1516 GNYMNDTSKQAQGFKLATLQRLTFIKDSTN-SMTFLNYVEKIVRSNYPSFNDFLTELEPV 1574
            GN+MN   K  +G KL +L +L F++ S + +M+FL+++EKI+R  YP    F+ +L+ +
Sbjct: 1100 GNHMN--KKIVKGIKLKSLTKLAFVRSSVDQNMSFLHFIEKIIRIKYPDLYGFVDDLKKI 1157

Query: 1575 LDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKK 1634
             D+ KIS+E +  +C EF   I N+    + G LS      P+D+++ KV   +  A+ K
Sbjct: 1158 EDLGKISLEHIELECHEFYNRIENLVTQFQTGKLSKEENLDPRDQIVKKVKFKINRAKIK 1217

Query: 1635 GELLGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEE 1694
             ELL  + KLT+++  +LM+ YGED                 +  +KK   +NI+ EE E
Sbjct: 1218 SELLMGQCKLTLIDLNKLMKYYGEDPSDKESKNDFFQPFIEFLAMFKKCAKENIEKEEME 1277

Query: 1695 QVYERHKKMVE 1705
            +VYE+ K ++E
Sbjct: 1278 RVYEQRKSLLE 1288

>TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717
            YIL159W
          Length = 1642

 Score =  270 bits (689), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 142/427 (33%), Positives = 250/427 (58%), Gaps = 14/427 (3%)

Query: 1290 NYPRPQKKLKQLHWEKLDATDNSIWKTNKAEK-FADDLYEKGVLTDLEKAFAAREI---K 1345
            N  +  KKLKQ+HW +++    +IWK N  ++    +L   GV   ++ +F  +++   K
Sbjct: 1135 NIQKEDKKLKQIHWIRVNEVAETIWKDNDRDRGIFMELECVGVFDRVKSSFKLKDVIKKK 1194

Query: 1346 SLASKKKEDLDKI-SFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEF 1404
            +    K +D  ++ SFLSRD++QQFGINLH++A+  V ++++K+L+CD D     +++EF
Sbjct: 1195 NTDEAKTKDKQQLKSFLSRDLAQQFGINLHLFASCEVSELLEKVLRCDNDINKNITILEF 1254

Query: 1405 LSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSY 1464
             +K E   +S ++ARNYAPY  D++            KD +EL+RAD+++L+L  NL++Y
Sbjct: 1255 FNKEEFTHISGSVARNYAPYGVDYQT------NNEATKDASELERADRIFLELFYNLRAY 1308

Query: 1465 WGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSK 1524
            W  R + L ++ T++K+Y +L+ KL+++D AV  L  S   K    ++L +GN+MN   K
Sbjct: 1309 WAERSQCLLLLHTYEKDYFDLMFKLQRIDDAVQKLMNSTRFKKFLYIVLEIGNFMN--KK 1366

Query: 1525 QAQGFKLATLQRLTFIKDS-TNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIE 1583
             A+G  +++L +L FIK S  N+++FL+++EK +R+ +P    F+ +L  V ++  +S++
Sbjct: 1367 PAEGILISSLTKLVFIKSSENNNLSFLHFIEKTIRTQFPEVYGFIDDLSKVAELGNVSLD 1426

Query: 1584 QLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVK 1643
             +  +CKEF   +     +V  G LS     HP+D++L KV   +  A+ K   L D+  
Sbjct: 1427 HITMECKEFCTHVNTTVYAVTKGKLSHPEDLHPRDQILKKVKYKISKAKTKSNFLRDQQI 1486

Query: 1644 LTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVYERHKKM 1703
            LT    +++++ YGED                  T +KK   +NI  EE E++YE+ K M
Sbjct: 1487 LTNHSIVKVLKYYGEDPNDRDSKDDFFKNIAEFATLFKKCAKENIYNEEAERLYEQRKYM 1546

Query: 1704 VEDQQKK 1710
            ++++ +K
Sbjct: 1547 LDNKLQK 1553

>YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,
            nucleates the formation of linear actin filaments,
            involved in cell processes such as budding and mitotic
            spindle orientation which require the formation of
            polarized actin cables, functionally redundant with BNI1
          Length = 1375

 Score =  266 bits (680), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 142/431 (32%), Positives = 254/431 (58%), Gaps = 30/431 (6%)

Query: 1292 PRPQKKLKQLHWEKLDATDNSIWK-TNKAEKFADDLYEKGVLTDLEKAFAAREIKSLASK 1350
            P  +K+LKQ+HW+K++   +++W+ T + ++   +L   G+ + +E  F  +    +A+K
Sbjct: 872  PPTEKRLKQIHWDKVEDIKDTLWEDTFQRQETIKELQTDGIFSQIEDIFKMKSPTKIANK 931

Query: 1351 K---------------KEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDF 1395
            +                 +L KISFLSRD++QQFGINLHM++ L   + V K+L CD D 
Sbjct: 932  RNAESSIALSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDI 991

Query: 1396 LHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYL 1455
            +   ++++F  K E+V +  ++   Y PYS   +G K+V D          LQRAD+++L
Sbjct: 992  VQNVNILKFFCKEELVNIPKSMLNKYEPYSQGKDG-KAVSD----------LQRADRIFL 1040

Query: 1456 QLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAV 1515
            +L INL+ YW +R ++L  ++T++++Y +L+ KL+K+D A+S L  S   K++  +I  +
Sbjct: 1041 ELCINLRFYWNARSKSLLTLSTYERDYYDLIFKLQKIDDAISHLNRSPKFKSLMFIITEI 1100

Query: 1516 GNYMNDTSKQAQGFKLATLQRLTFIKDSTN-SMTFLNYVEKIVRSNYPSFNDFLTELEPV 1574
            GN+MN   +  +G KL +L +L F++ S + +++FL+++EK++R  YP    F+ +L+ +
Sbjct: 1101 GNHMN--KRIVKGIKLKSLTKLAFVRSSIDQNVSFLHFIEKVIRIKYPDIYGFVDDLKNI 1158

Query: 1575 LDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKK 1634
             D+ KIS+E + S+C EF + I ++    + G LS      P+D+++ KV   +  A+ K
Sbjct: 1159 EDLGKISLEHVESECHEFHKKIEDLVTQFQVGKLSKEENLDPRDQIIKKVKFKINRAKTK 1218

Query: 1635 GELLGDEVKLTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEE 1694
             ELL  + KLT+++  +LM+ YGED +               +  +KK   +NI+ EE E
Sbjct: 1219 SELLIGQCKLTLIDLNKLMKYYGEDPKDKESKNEFFQPFIEFLAMFKKCAKENIEKEEME 1278

Query: 1695 QVYERHKKMVE 1705
            +VYE+ K +++
Sbjct: 1279 RVYEQRKSLLD 1289

>Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (REAL)
          Length = 1375

 Score =  261 bits (667), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 137/422 (32%), Positives = 249/422 (59%), Gaps = 26/422 (6%)

Query: 1297 KLKQLHWEKLDATDNSIWK-TNKAEKFADDLYEKGVLTDLEKAFAAREIKSLASKKKEDL 1355
            +LKQ+HW+K++   +++W+ T + ++   +L   G+ + +E  F  ++   +ASKK  + 
Sbjct: 881  RLKQIHWDKVEEIKDTLWEDTTQRQETLKELQTDGIFSQIEDIFKMKDPVKIASKKNGNS 940

Query: 1356 -----------DKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEF 1404
                         +SFLSRD++QQFGINLHM++ +   + VKK+L CD + +   ++++F
Sbjct: 941  STSISSNNGKSSNVSFLSRDLAQQFGINLHMFSQVSDMEFVKKVLNCDNNIIMNVNILKF 1000

Query: 1405 LSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSY 1464
              K E+V +  ++   Y PYS   +G KSV D          LQRAD+++L+L INL+SY
Sbjct: 1001 FCKEELVSIPKSMLSKYEPYSQG-KGGKSVSD----------LQRADRIFLELCINLRSY 1049

Query: 1465 WGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSK 1524
            W +R ++L  ++T++++Y +L+ KL+K+D  +  L  S   K++  +I  +GN+MN   K
Sbjct: 1050 WNARSKSLLTLSTYERDYYDLIFKLQKIDDGILQLNRSVKFKSLMFIITEIGNHMN--KK 1107

Query: 1525 QAQGFKLATLQRLTFIKDSTN-SMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIE 1583
              +G KL +L +L F++ S + +++FL+++EK++R+ YP    F+ +L+ + D+ K+S+E
Sbjct: 1108 MVKGIKLKSLTKLAFVRSSADQNLSFLHFIEKVIRTKYPDIYGFVDDLKRIEDLGKVSLE 1167

Query: 1584 QLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVK 1643
             +  +C+EF   +       + G LS+     P+D+++ KV   +  A+ K +LL D+ K
Sbjct: 1168 HVELECREFQNKVEYAVTQFQTGKLSNEENLDPRDQIVKKVKFKINRAKTKSDLLVDQCK 1227

Query: 1644 LTIMEFLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVYERHKKM 1703
            LT+++  +LM+ YGED                 +  +KK   +NI+ EE E+VYE+ K +
Sbjct: 1228 LTLIDLSKLMKYYGEDPNDKESKNEFFQPFIEFLAMFKKCAKENIEKEEMERVYEQRKNL 1287

Query: 1704 VE 1705
            +E
Sbjct: 1288 LE 1289

>KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5.717
            YIL159W
          Length = 1324

 Score =  256 bits (655), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 138/417 (33%), Positives = 240/417 (57%), Gaps = 27/417 (6%)

Query: 1297 KLKQLHWEKLDATDNSIWK-TNKAEKFADDLYEKGVLTDLEKAFAAREIK------SLAS 1349
            +LKQ+HWEK++  ++++W  + + E+ A +L   G+   +   F  + IK      + AS
Sbjct: 852  RLKQIHWEKVEDIESTLWHDSARREETAKELKLDGIFDQVMDTFQVKNIKMKKRDTTTAS 911

Query: 1350 KKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLSKPE 1409
            KK+      + L R+++QQFGINLHM+++L  D+ V+K+L+C+ D +   SV+EF +K E
Sbjct: 912  KKQNG----TLLPRNLAQQFGINLHMFSSLGTDEFVEKVLECNSDIVSNVSVLEFFNKEE 967

Query: 1410 IVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSYWGSRM 1469
            +  +  +L + + PY+   E +KS            EL+RAD+++ +L   L SYW  R 
Sbjct: 968  LTSIPTSLIQKFTPYA---ENIKS----------KFELERADRIFFELCFQLHSYWRERS 1014

Query: 1470 RALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQAQGF 1529
              L ++ T++K+Y +L+ KL+KVD  +  L  S   ++   +I+ +GNYMN   K   G 
Sbjct: 1015 NCLLILNTYEKDYYDLMYKLKKVDDGIQRLLSSSKFRDFLYIIIEIGNYMN--KKTVNGI 1072

Query: 1530 KLATLQRLTFIKDST-NSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQLVSD 1588
            ++ +L +L F+K S  N+++FL+++EKI+R  YP    F+ EL  + D+ K+SI+QL  D
Sbjct: 1073 RIGSLNKLVFVKSSLDNNVSFLHFIEKIIRVKYPDIYSFINELRIIQDLGKLSIDQLEYD 1132

Query: 1589 CKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLTIME 1648
             +EF   I  +   +E G LS + +  P+D++L K    +  A+ K EL+  ++KL   +
Sbjct: 1133 SQEFCSKINKMSNDLEKGKLSKADRIDPRDQLLKKTKYKVLRAKSKSELMRHQLKLLGHD 1192

Query: 1649 FLRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVYERHKKMVE 1705
            + ++M+ +GED+                I  +KK   +NI+ EE E+VYE+ +KM +
Sbjct: 1193 YAKIMRYFGEDASDRDSKNAFFTNIFEFIQVFKKCSKENIEKEEMERVYEQRQKMFD 1249

 Score = 37.4 bits (85), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 109/219 (49%), Gaps = 11/219 (5%)

Query: 523 ILEYCQWSMIFINHLCSCSSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYE 582
           I EY    M  IN +       N++  +  KL++  + ++  ++  LD   + EQI  Y+
Sbjct: 323 ITEYLSSCMFLINSIIEGFPLQNEKYSVLEKLKDVELPKLFFELSALDSKVIQEQIYRYK 382

Query: 583 NNKLDDLNTLLESNNKNANINLQDPT--SMLRNLWDACKGTENEKLLISLMQHLF--LSS 638
            N   D N  L+  N+N  +++ D +  + L  L +  K T  E+ + +L+  +   L +
Sbjct: 383 KN---DENIRLKIINENP-LSIPDISYGATLMLLIEKSKSTPLEEPIGALLDSVLKILDT 438

Query: 639 SQFIEEKKDPVKLSRQLK-LLDSLVTNVSVS--STDQEASMNMAIQRLYDAMQTDEVARR 695
             + E  K    +S  L  L+D L + +S +  +   +  +  +I+RL D +++DEVARR
Sbjct: 439 RTYSESIKLFASVSSLLTYLVDKLDSTISSAENANSLKPVLQDSIERLIDNLESDEVARR 498

Query: 696 SILESRTLTKKLEEVQAERDLLSQKLKNAEHGLVGQLQD 734
           ++ E R     ++++  E   L ++  +++  ++ QL++
Sbjct: 499 AMKELRESETVIKDLNTEIHNLKREKNSSKEDILEQLEE 537

>TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1451

 Score =  255 bits (651), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 136/425 (32%), Positives = 248/425 (58%), Gaps = 14/425 (3%)

Query: 1294 PQKKLKQLHWEKLDATDNSIWKTNKAE-KFADDLYEKGVLTDLEKAFAARE--IKSLASK 1350
            P K +KQ+HWEK+  T  S+W+ +        +L   G+ +++E  F +++  IK    K
Sbjct: 966  PTKNMKQIHWEKVSRTGASLWEDDDQRLSIIKELEHTGIFSEVEDIFYSKDAVIKRRNPK 1025

Query: 1351 KKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLSKPEI 1410
             +     ++ L R+++QQFGINLHM++ +   D+ +K+L+CD       SVIEF +  ++
Sbjct: 1026 DQTQNKVLTLLPRELAQQFGINLHMFSQISPQDLFEKVLQCDISINQNLSVIEFFNNEDL 1085

Query: 1411 VEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSYWGSRMR 1470
              +  N+ R + PYS D++   S      P KD +EL R D ++L L  NL+SYW  R +
Sbjct: 1086 TNIPSNICRTFEPYSIDYKTPGS-----KPTKDISELSRVDHIFLLLCYNLRSYWKERSQ 1140

Query: 1471 ALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQAQGFK 1530
             L ++ T++K+Y +L+ KL ++D+A+++++ S+ LK+V  +I+A+GN+MN   K   G +
Sbjct: 1141 CLLMLLTYEKDYYDLMFKLERLDEAINAIKNSQRLKSVLYIIVAIGNFMN--KKGVDGIR 1198

Query: 1531 LATLQRLTFIKDSTNS-MTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQLVSDC 1589
            L++L +LT+IK ++ S  +FL+++E+++R  YP    F ++L  V ++  ++++ L  + 
Sbjct: 1199 LSSLNKLTYIKSNSESKASFLHFIERLIRVRYPELYYFTSDLRKVENLGNVTLDHLQLEY 1258

Query: 1590 KEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLTIMEF 1649
             + S  I  V RS++ G LS+    HPQD +L KV   +  A  K  +L D+  LT ++ 
Sbjct: 1259 DDLSSKINTVHRSIQKGQLSNKKNLHPQDNILDKVKYKVIRAANKRTILQDKFTLTNIDL 1318

Query: 1650 LRLMQIYGEDSEXXXXXXXXXXXXXXXITEYKKAQNQNIKAEEEEQVYERHKKMVEDQQK 1709
             +L+  +GED +               +T ++K   +NI+ EE ++VYE+ +++++    
Sbjct: 1319 EKLLVYFGEDPDDMNNKITFFKSISEFLTLFRKCAKENIEKEEADRVYEQRRQLLD---S 1375

Query: 1710 KLQEQ 1714
            K+Q Q
Sbjct: 1376 KIQAQ 1380

 Score = 35.4 bits (80), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 111/213 (52%), Gaps = 19/213 (8%)

Query: 543 NINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNANI 602
           NI  +  +  +L+ C I  ++  +K L+ D++I +I+ Y+  K++++    E + K+A +
Sbjct: 478 NIVNKFDMIIRLKECKIHDLLALMKNLNNDELITEIEKYQ--KMENI-IYQEKSPKDALL 534

Query: 603 NLQDPTSMLRNLWDACKGTENEKLLISLMQHLF-LSSSQFIEEKKDPVKLSRQL--KLLD 659
                 S L+ L    + T+ E  ++ ++  L  +  S+  +E  + +K S+ +   LLD
Sbjct: 535 KNISYGSQLQQLITQTRDTQLETPIMMILDSLLKIIQSRTTKESGEIIKTSKVILDNLLD 594

Query: 660 SLVTN--------VSVSSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKL---- 707
           S+  N         S+S++D  + MN ++    D++ +D+VARR++ E + L K+L    
Sbjct: 595 SIFNNKLTSGSSSTSLSTSDTASIMNNSVTEFLDSLYSDDVARRAMDEMKQLQKELATLR 654

Query: 708 EEVQAERDLLSQKLKNAEHGLVGQLQDELAQRD 740
           E++ +  D     + N  +  + +L++E  Q+D
Sbjct: 655 EQIVSTEDKEDTDI-NKLYIKIDKLKEETGQKD 686

>AFR354C Chr6 complement(1078269..1081901) [3633 bp, 1210 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YEL031W
            (SPF1)
          Length = 1210

 Score = 35.4 bits (80), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 1850 LRGSNTPSKRNSL-LDEHKEKLRARRRKTNSDLHSGTRLQFVGETVPEKEVEPITGEPDG 1908
            L G +TP  + S+ L   +EKL+      NS LH GT++  V  T PEK    I   PDG
Sbjct: 307  LSGESTPLLKESVKLRSSEEKLQVEGLDKNSVLHGGTKVLQV--TAPEKGSSSIPAPPDG 364

>SAKL0G10296g Chr7 (876462..878243) [1782 bp, 593 aa] {ON} similar to
            uniprot|P32916 Saccharomyces cerevisiae YDR292C SRP101
            Signal recognition particle (SRP) receptor - alpha
            subunit contain GTPase domains involved in SRP- dependent
            protein targeting interacts with SRP102p
          Length = 593

 Score = 33.9 bits (76), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query: 1041 LIERQDTQSNFSGTSAGPGSFLEALTQKYATGQKSASPRDQSTRMKDNIFINRIKQTNVA 1100
            L+ +  +QSN SG S   G+F     QK+  G K+ + +D +T ++   F  ++   NVA
Sbjct: 245  LLSKNKSQSNTSGNSPTAGAF--GFLQKHLLGNKTITEKDLATILEK--FKQKLMTKNVA 300

Query: 1101 PPFLDELTDKVAE 1113
            P     L  +V++
Sbjct: 301  PEVAAYLATQVSQ 313

>Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar to
            Saccharomyces cerevisiae YBL005W
          Length = 943

 Score = 33.5 bits (75), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 31/47 (65%), Gaps = 8/47 (17%)

Query: 1312 SIWKTNKAEKFADDLYEKGVLTDLEKAFAAREIKSLASKKKEDLDKI 1358
             IWK  +AEK       KG++++LEK+F ++ I S  +K +E+LD++
Sbjct: 117  GIWK--RAEKL------KGMISELEKSFKSQAIYSAIAKLQEELDRL 155

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 178,429,742
Number of extensions: 7485872
Number of successful extensions: 35626
Number of sequences better than 10.0: 240
Number of HSP's gapped: 36718
Number of HSP's successfully gapped: 345
Length of query: 1946
Length of database: 53,481,399
Length adjustment: 125
Effective length of query: 1821
Effective length of database: 39,148,149
Effective search space: 71288779329
Effective search space used: 71288779329
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 74 (33.1 bits)