Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0A005801.81ON68968931670.0
NDAI0F042301.81ON70156415080.0
YNL272C (SEC2)1.81ON75956514140.0
Suva_14.701.81ON75152514000.0
Smik_14.651.81ON79052813930.0
KAFR0D039601.81ON66453913770.0
Skud_14.681.81ON75252713830.0
TDEL0C062001.81ON70054513111e-172
SAKL0C02596g1.81ON73452812921e-168
Kpol_2000.671.81ON82460812551e-162
CAGL0J08228g1.81ON75252312271e-158
KLTH0F02354g1.81ON73353512061e-155
Ecym_10851.81ON70552211981e-155
KNAG0F004601.81ON65452911771e-152
AFR670W1.81ON71753311821e-152
Kwal_33.133891.81ON69456911781e-152
ZYRO0F16698g1.81ON77956311801e-151
TBLA0A054301.81ON79555111741e-150
TPHA0B045001.81ON73353711381e-145
KLLA0C02299g1.81ON6582978351e-101
KAFR0H023308.694ON149998761.6
SAKL0B11946g2.616ON84662761.8
Smik_11.2602.515ON47590742.7
Smik_6.4366.257ON188761743.2
NDAI0G026408.315ON220107705.3
KLLA0F24090g2.150ON98571708.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0A00580
         (689 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON...  1224   0.0  
NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1...   585   0.0  
YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON} ...   549   0.0  
Suva_14.70 Chr14 complement(121375..123630) [2256 bp, 751 aa] {O...   543   0.0  
Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {O...   541   0.0  
KAFR0D03960 Chr4 (776847..778841) [1995 bp, 664 aa] {ON} Anc_1.8...   535   0.0  
Skud_14.68 Chr14 complement(115311..117569) [2259 bp, 752 aa] {O...   537   0.0  
TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1...   509   e-172
SAKL0C02596g Chr3 complement(238404..240608) [2205 bp, 734 aa] {...   502   e-168
Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON} (1441...   488   e-162
CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} simil...   477   e-158
KLTH0F02354g Chr6 complement(193705..195906) [2202 bp, 733 aa] {...   469   e-155
Ecym_1085 Chr1 complement(170657..172774) [2118 bp, 705 aa] {ON}...   466   e-155
KNAG0F00460 Chr6 complement(64086..66050) [1965 bp, 654 aa] {ON}...   457   e-152
AFR670W Chr6 (1668415..1670568) [2154 bp, 717 aa] {ON} Syntenic ...   459   e-152
Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {...   458   e-152
ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weak...   459   e-151
TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa] ...   456   e-150
TPHA0B04500 Chr2 (1059147..1061348) [2202 bp, 733 aa] {ON} Anc_1...   442   e-145
KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {...   326   e-101
KAFR0H02330 Chr8 complement(445031..449530) [4500 bp, 1499 aa] {...    34   1.6  
SAKL0B11946g Chr2 complement(1025700..1028240) [2541 bp, 846 aa]...    34   1.8  
Smik_11.260 Chr11 complement(435500..436927) [1428 bp, 475 aa] {...    33   2.7  
Smik_6.436 Chr6 complement(710034..715697) [5664 bp, 1887 aa] {O...    33   3.2  
NDAI0G02640 Chr7 complement(604606..605268) [663 bp, 220 aa] {ON...    32   5.3  
KLLA0F24090g Chr6 complement(2243449..2246406) [2958 bp, 985 aa]...    32   8.1  

>NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON}
           Anc_1.81 YNL272C
          Length = 689

 Score = 1224 bits (3167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/689 (88%), Positives = 607/689 (88%)

Query: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60
           MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF
Sbjct: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60

Query: 61  EKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADA 120
           EKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADA
Sbjct: 61  EKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADA 120

Query: 121 RKDKYTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNNRYSIIQP 180
           RKDKYTVEVLNTKLVEQLHEKD                    EDENNSLIGNNRYSIIQP
Sbjct: 121 RKDKYTVEVLNTKLVEQLHEKDNLLETLNLQLKNLKKVLQTVEDENNSLIGNNRYSIIQP 180

Query: 181 DXXXXXXXXXXXXXXXXXXXSYSQNISNMANGXXXXXXXXXXRYDLPLYEEFLKFIAVIP 240
           D                   SYSQNISNMANG          RYDLPLYEEFLKFIAVIP
Sbjct: 181 DSATTSSSTTSLEKITTTVSSYSQNISNMANGIIYSPIISSIRYDLPLYEEFLKFIAVIP 240

Query: 241 HCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSGV 300
           HCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSGV
Sbjct: 241 HCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSGV 300

Query: 301 NETFQMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIEHA 360
           NETFQMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIEHA
Sbjct: 301 NETFQMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIEHA 360

Query: 361 RMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMKXX 420
           RMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMK  
Sbjct: 361 RMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMKSI 420

Query: 421 XXXXXXXXXXXXXAIRQTKTEDRRSKRMSFIGGLTKNSSAINTAQVESTTSMEITGLPTT 480
                        AIRQTKTEDRRSKRMSFIGGLTKNSSAINTAQVESTTSMEITGLPTT
Sbjct: 421 SSKDSSRFSVVTSAIRQTKTEDRRSKRMSFIGGLTKNSSAINTAQVESTTSMEITGLPTT 480

Query: 481 NIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPDDKLEPASIEANIKITKKQ 540
           NIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPDDKLEPASIEANIKITKKQ
Sbjct: 481 NIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPDDKLEPASIEANIKITKKQ 540

Query: 541 IEKDVESIISENNQGESFDFXXXXXXXXXXXXXXXXXXIAGESETKVHASQDNSEHQSAN 600
           IEKDVESIISENNQGESFDF                  IAGESETKVHASQDNSEHQSAN
Sbjct: 541 IEKDVESIISENNQGESFDFESSASTSGATEASSEEKSIAGESETKVHASQDNSEHQSAN 600

Query: 601 ALEQETKNNFEEVTKKDIEQESESERKPKEAGDETLTHEPNSISPKIEEENKEDTASSKA 660
           ALEQETKNNFEEVTKKDIEQESESERKPKEAGDETLTHEPNSISPKIEEENKEDTASSKA
Sbjct: 601 ALEQETKNNFEEVTKKDIEQESESERKPKEAGDETLTHEPNSISPKIEEENKEDTASSKA 660

Query: 661 SNEDDENGTAASSINETDDVLDNYTDAND 689
           SNEDDENGTAASSINETDDVLDNYTDAND
Sbjct: 661 SNEDDENGTAASSINETDDVLDNYTDAND 689

>NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1.81
           YNL272C
          Length = 701

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/564 (52%), Positives = 384/564 (68%), Gaps = 34/564 (6%)

Query: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60
           M E SEESKRIS QV++LSTQLIESI KQS LEEKLN AN+ I SQ+ SL++   L+ + 
Sbjct: 1   MPETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKS 60

Query: 61  EKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADA 120
            +L+ S   + +E++  + ++ RE +LRE+AE EVEKLSKEVEDLTATLFDEANNMVADA
Sbjct: 61  IELEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADA 120

Query: 121 RKDKYTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNNRYSIIQP 180
           RK+ +  E+LN++L+ QL EKD                    E ENN      RYS+I P
Sbjct: 121 RKEAHAKEILNSRLMGQLREKDNLLETLTLQLKSLKKVLQNVETENN------RYSMILP 174

Query: 181 DXXXXXXXXXXXXXXXXXXXSYSQNISNMANGXXXXXXXXXXRYDLPLYEEFLKFIAVIP 240
           D                   S+SQ    M NG          RYDL LYEEFLKFIAVIP
Sbjct: 175 DSATISGASLDKVTTRTSS-SFSQQ--PMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIP 231

Query: 241 HCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSGV 300
           HC++IKDTSSDSKLIRRL+ DEI+PVLK+DNA+GLGW+V+KT+LSTMMEGLV+VEPLSG+
Sbjct: 232 HCKSIKDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGI 291

Query: 301 NETFQMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIEHA 360
           NE +QMG++T P       + ++Q  +PK+FKFP +SPP+A+ +PC+FCGE R+DIIEHA
Sbjct: 292 NEMYQMGHTTPPLGMNTQEEADAQRKVPKMFKFPSSSPPVAVRDPCAFCGEERNDIIEHA 351

Query: 361 RMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTM--- 417
           RMY+LKTQ  Q+DGT+++ NT+PLCHWCLFK+RQTCEIFAFLRSLKT +WNLEKV +   
Sbjct: 352 RMYLLKTQTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAI 411

Query: 418 ------KXXXXXXXXXXXXXXXAIRQTKTEDRRSKRMSFIGGLTK-NSSAINTAQVE--- 467
                 K                    K+E+++SKRMSF+ GL + +SS I  A+VE   
Sbjct: 412 SKYGSSKFSEVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVEPHG 471

Query: 468 ------STTSMEITGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDP 521
                 + + +E  G PTTNIQRAW+QLCKLRSILHWAH+GIWS+DDS+++K+GPE+   
Sbjct: 472 NHNNNNTNSPIENIGQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEVFTQ 531

Query: 522 DDKLEPASIEANIKITKKQIEKDV 545
           D++         I +T + I +D+
Sbjct: 532 DEEF------TTIDMTAEYIAQDM 549

>YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON}
           SEC2Guanyl-nucleotide exchange factor for the small
           G-protein Sec4p; essential for post-Golgi vesicle
           transport and for autophagy; associates with the
           exocyst, via exocyst subunit Sec15p, on secretory
           vesicles
          Length = 759

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/565 (49%), Positives = 376/565 (66%), Gaps = 20/565 (3%)

Query: 5   SEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEFEKLK 64
           SEE+KR+S QVT+LSTQLIES+DKQS LEE+LN + K IASQ+ +++ Y+ LK ++  LK
Sbjct: 4   SEEAKRVSIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLKEDYNTLK 63

Query: 65  ISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADARKDK 124
               D+  E+   +  I +E ELR  AE+E +KL+KEVEDLTA+LFDEANNMVADARK+K
Sbjct: 64  RELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEK 123

Query: 125 YTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNNRYSIIQPDXXX 184
           Y +E+LN +L EQL EKD                    ++E+     +NRYS I      
Sbjct: 124 YAIEILNKRLTEQLREKDTLLDTLTLQLKNLKKVMHSLDNESTVTNNSNRYSTI-----L 178

Query: 185 XXXXXXXXXXXXXXXXSYSQNISNMANGXXXXXXXXXXRYDLPLYEEFLKFIAVIPHCRT 244
                           SYS    ++ +G          RYD+ LY EFLKF+A +P C  
Sbjct: 179 SDSATSSSTSLNKVPTSYSLASQDIYSGIVYSPSISSIRYDISLYNEFLKFVAALPRCEN 238

Query: 245 IKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSGVNETF 304
           IK TS++SKLIRRLVNDEI P+LK+DNASG+GW+V+KT+LS +++GLVVVEPLSGVN T+
Sbjct: 239 IKATSTESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVVEPLSGVNATY 298

Query: 305 QMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIEHARMYV 364
           Q+G ++  P  +A+      S+MPK+FKFPL SPP+A+H  CSFCGESRDDIIEHARMY+
Sbjct: 299 QIGYNSSSPAKQAT------SNMPKMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYI 352

Query: 365 LKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMKXXXXXX 424
           LKT +K +DG   VTNT+PLCHWCL K+RQTCEIFAFLRSLK G W+LEK+T +      
Sbjct: 353 LKTLHKTDDGKEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLTTQNITKED 412

Query: 425 XXXXXXXXXAIR---QTKTEDRRSKRMSFIGGLTKNSSAINTAQVE--STTSMEITGLPT 479
                      +   +  ++D+++KR+SF+ GL  NSS  N  ++E  S+ +    G PT
Sbjct: 413 LEKFSEVTKHTKRDGRVSSQDKKTKRLSFMAGLGINSSTKNKPKMEIFSSETNAKPGQPT 472

Query: 480 TNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPDDKLEPASIEANIK---I 536
           TNIQRAW+QLCKLR ILHW H+GIW++DDSI+SKIGP ++D  D+ +  +I   ++   +
Sbjct: 473 TNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLVEDDSDEDQNDAISVRLQDKAL 532

Query: 537 TKKQIEKDVESIISENNQ-GESFDF 560
            K+  ++   S  +E +Q  ++FDF
Sbjct: 533 WKQDAKRPFSSSSAEESQKSDAFDF 557

>Suva_14.70 Chr14 complement(121375..123630) [2256 bp, 751 aa] {ON}
           YNL272C (REAL)
          Length = 751

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/525 (52%), Positives = 351/525 (66%), Gaps = 20/525 (3%)

Query: 3   EQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEFEK 62
           E SEE+KRIS QVT+LSTQLIES+DKQS LEE+LN + K IA Q+ ++D Y+ LK +++ 
Sbjct: 2   EASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIAGQKAAIDNYNKLKTDYDT 61

Query: 63  LKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADARK 122
           LK +  ++  E+      I +E +LR  AE E +KL++EVEDLTA+LFDEAN+MVADARK
Sbjct: 62  LKKTLLERDNEVMKLNGNIAKETQLRTKAEDESDKLNREVEDLTASLFDEANHMVADARK 121

Query: 123 DKYTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNNRYSIIQPDX 182
           +KY +E+LN +L EQL EKD                    ++E+     + RYS I    
Sbjct: 122 EKYAIEILNKRLTEQLREKDALLETLTLQLKNLKKVMHSLDNESTVTNNSGRYSTI---- 177

Query: 183 XXXXXXXXXXXXXXXXXXSYSQNISNMANGXXXXXXXXXXRYDLPLYEEFLKFIAVIPHC 242
                             S S    ++ +G          RYD  LY EFLKF+A +PHC
Sbjct: 178 -LSDSATSSSTSLNKVPTSNSFTSQDLYSGIVYSPTISSIRYDSNLYNEFLKFVAALPHC 236

Query: 243 RTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSGVNE 302
             IK TSS+SKLIRRLVNDEI P+LK+DNASG+GW+V+KT+LS +++G+VVVEPLSGVN 
Sbjct: 237 ENIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGMVVVEPLSGVNA 296

Query: 303 TFQMG-NSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIEHAR 361
           T+Q+G NS+ P    A N       MPK+FKFPL SPP+A+H  CSFCGESRDDIIEHAR
Sbjct: 297 TYQIGYNSSSPVKQAAPN-------MPKMFKFPLDSPPVAVHAACSFCGESRDDIIEHAR 349

Query: 362 MYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMK--- 418
           MYVLKT +K +DGT  VTNT+PLCHWCL KVRQTCEIFAFLRSLK G W+LEKVTM+   
Sbjct: 350 MYVLKTLHKADDGTEHVTNTYPLCHWCLLKVRQTCEIFAFLRSLKVGAWHLEKVTMQNIV 409

Query: 419 XXXXXXXXXXXXXXXAIRQTKTEDRRSKRMSFIGGLTKNSSAINTAQVESTTSMEIT--- 475
                          A  +    D+ +KR+SF+ GL  NSS  +  +VE  +S E+T   
Sbjct: 410 KGDLERFSEVTKRTKADGRVSPHDKMAKRLSFMAGLGINSSTKSKPRVEVPSS-EMTVKP 468

Query: 476 GLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKD 520
           G PTTNIQRAWIQLCKLR ILHW+H+GIW++DDSI+SKIGP + D
Sbjct: 469 GHPTTNIQRAWIQLCKLRCILHWSHIGIWAVDDSISSKIGPFVDD 513

>Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {ON}
           YNL272C (REAL)
          Length = 790

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/528 (50%), Positives = 359/528 (67%), Gaps = 22/528 (4%)

Query: 3   EQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEFEK 62
           + SEE+KRIS QVT+LSTQLIES+DKQS LEE+LN + K I+SQ+ ++  Y+ LK ++E 
Sbjct: 2   DASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYEA 61

Query: 63  LKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADARK 122
           LK +  ++  E++  +  + +E ELR  AE E +KL+KEVEDLTA+LFDEANNMV+DARK
Sbjct: 62  LKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDARK 121

Query: 123 DKYTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNNRYSIIQPDX 182
           +KY +E+LN +L EQL EKD                    ++E+     +NRYS I  D 
Sbjct: 122 EKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILNDS 181

Query: 183 XXXXXXXXXXXXXXXXXXSYSQNISNMANGXXXXXXXXXXRYDLPLYEEFLKFIAVIPHC 242
                             S      +M +G          RYD+ LY EFLKF+A +P+C
Sbjct: 182 ATSSSTSLNKVPTLNSSAS-----QDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNC 236

Query: 243 RTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSGVNE 302
             IK TSS+SKLIRRLVNDEI P+LK+DNASG+GW+V+KT+LS +++GLVV+EPLSGVN 
Sbjct: 237 DNIKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNA 296

Query: 303 TFQMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIEHARM 362
           T+Q+G ++  P  +A+       +MP++FKFPL SPP+A+H  CSFCGESRDDIIEHARM
Sbjct: 297 TYQIGYNSSSPVKQAT------PNMPRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARM 350

Query: 363 YVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMKXXXX 422
           Y+LKT +K +DGT  VTNT+PLCHWCL K+RQTCEIFAFLRSLK G W+LEK+  +    
Sbjct: 351 YILKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQ---S 407

Query: 423 XXXXXXXXXXXAIRQTKT------EDRRSKRMSFIGGLTKNSSAINTAQVE--STTSMEI 474
                        ++TKT      +D+++KR+SF+ GL  NSS+ +  ++E  S+ +   
Sbjct: 408 ITKGDLGKFSEVTKRTKTDGRVSSQDKKAKRLSFMAGLGINSSSKSKQKMEVFSSEANAK 467

Query: 475 TGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPD 522
            G PTTNIQRAW+QLCKLR ILHW+H+GIW++DDSI+SKIGP + D D
Sbjct: 468 PGQPTTNIQRAWLQLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDED 515

>KAFR0D03960 Chr4 (776847..778841) [1995 bp, 664 aa] {ON} Anc_1.81
           YNL272C
          Length = 664

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/539 (49%), Positives = 367/539 (68%), Gaps = 24/539 (4%)

Query: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60
           M + +EE+ RIS QVT+LSTQL+ESI ++S+LEEKL H  K+  SQ+ S+ KY  LK ++
Sbjct: 1   MDDLAEENNRISAQVTSLSTQLMESIQRESELEEKLKHLKKVALSQEGSIAKYDILKADY 60

Query: 61  EKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADA 120
           +KLK +  ++ +E+ N +V ++ E +LR +AE EV  LS+EVEDLTA+LF EAN+MVADA
Sbjct: 61  DKLKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADA 120

Query: 121 RKDKYTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNNRYSIIQP 180
           R++K+  E+LNTKLVEQL EKD                    EDEN +    N+ S I P
Sbjct: 121 RREKHITEILNTKLVEQLREKDTLLQTLDLQLKNLKKVLQNFEDENVT----NKASSIAP 176

Query: 181 DXXXXXXXXXXXXXXXXXXXSYSQNISNMANGXXXXXXXXXXRYDLPLYEEFLKFIAVIP 240
           D                   S S  + + +N           RYDL LY EFLKFIAV+P
Sbjct: 177 D--------FLGSEQKSASASLSNEVGDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLP 228

Query: 241 HCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSGV 300
           +C+ +KDTSS+SKL+RRL+NDEI P+L++D+A+G+GW+ +K++L+ M++GLVV+EPLSGV
Sbjct: 229 YCKNLKDTSSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGV 288

Query: 301 NETFQMGN---STQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDII 357
           NE +Q+G+   S Q       +K ES      LF +P  SPP+A+HEPCSFCGE+RDDI+
Sbjct: 289 NENYQLGHVSSSDQSNRPSMESKRESH-----LFNYPTDSPPVAVHEPCSFCGENRDDIL 343

Query: 358 EHARMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTM 417
           EHARM+VLKTQ+K EDG+I VTN++PLC WCL KVRQTCEIFAFLRSLK G WNLEKVT+
Sbjct: 344 EHARMHVLKTQSKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTL 403

Query: 418 KXXXXXXXXXXXXXXXAI---RQTKTEDRRSKRMSFIGGLTKNSSAINTAQVE-STTSME 473
                           AI   +  K+++++ KR SF+ GL  N+S+  T QVE   +++ 
Sbjct: 404 NSIAKGESNKFTEVTRAIKSNKHGKSDEKKLKRKSFMVGLGINASSNLTPQVEVGASTIG 463

Query: 474 ITGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPDDKLEPASIEA 532
             G PTTNIQRAW+QLCKLRS+LHW ++GIWS+D+SI+ KIGP++KD ++++   +++ 
Sbjct: 464 NAGQPTTNIQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDDNNEITGTTVDV 522

>Skud_14.68 Chr14 complement(115311..117569) [2259 bp, 752 aa] {ON}
           YNL272C (REAL)
          Length = 752

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/527 (51%), Positives = 353/527 (66%), Gaps = 24/527 (4%)

Query: 5   SEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEFEKLK 64
           SEE+KRIS QVT+LSTQLIES+DKQS LEE+LN + K IASQ+ +++ Y+ L+ +   LK
Sbjct: 4   SEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHNTLK 63

Query: 65  ISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADARKDK 124
            +  ++  E+      I +E +LR  AE E +KL++EVEDLTA+LFDEAN MVADAR++K
Sbjct: 64  KTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADARREK 123

Query: 125 YTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNNRYSIIQPDXXX 184
           Y +E+LN +L EQL EKD                    ++E+     +NRYS I  D   
Sbjct: 124 YAIEILNKRLTEQLREKDVLLETLTLQLKNLKKVMHSLDNESTVTNNSNRYSTILSDSAT 183

Query: 185 XXXXXXXXXXXXXXXXSYSQNISNMANGXXXXXXXXXXRYDLPLYEEFLKFIAVIPHCRT 244
                           S      +M +G          RYD+ LY EFLKF+A +P C  
Sbjct: 184 SSSTSLNKVPTLNSFAS-----QDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCEN 238

Query: 245 IKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSGVNETF 304
           IK TSS+SKLIRRLVNDEI P+LK+DNASG+GW+V+KT+LS +++GLV+VEPLSGVN T+
Sbjct: 239 IKATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATY 298

Query: 305 QMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIEHARMYV 364
            +G ++  P        +S ++MPK+FKFPL SPP+A+H  CSFCGESRDDIIEHARMYV
Sbjct: 299 HIGYNSSSP------VKQSTANMPKMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYV 352

Query: 365 LKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMKXXXXXX 424
           LKT +K +DGT  VTNT+PLCHWCL K+RQTCEIFAFLRSLK G W+LEK+ M+      
Sbjct: 353 LKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQ---NIA 409

Query: 425 XXXXXXXXXAIRQTKTEDR------RSKRMSFIGGLTKNSSAINTAQVESTTSMEIT--- 475
                      ++TKTEDR      +SKR+SF+ GL  NS+A +  ++E  +S EI    
Sbjct: 410 KGDLVKFSEVTQRTKTEDRVSSHDKKSKRLSFMAGLGINSTAKSKPKMEVFSS-EINAKP 468

Query: 476 GLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPD 522
           G PTTNIQRAW+QLCKLR ILHW H+GIW++DDSI+SKIGP + D D
Sbjct: 469 GQPTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLVDDED 515

>TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1.81
           YNL272C
          Length = 700

 Score =  509 bits (1311), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 276/545 (50%), Positives = 359/545 (65%), Gaps = 27/545 (4%)

Query: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60
           M E  EES+R+S Q+++LSTQLIESIDKQ +LEE+LN A + I SQ+ SLD Y++LK +F
Sbjct: 1   MGESVEESRRVSVQISSLSTQLIESIDKQFQLEEQLNQAKRTIQSQRNSLDSYNDLKSKF 60

Query: 61  EKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADA 120
           + ++ S + + + ++  K ++ +E+ LR  AE+ V+ L+KE+EDLTA+LFDEAN MVA A
Sbjct: 61  DGVESSLQTKNQIIEELKEELVKEKTLRTTAERNVDDLNKEIEDLTASLFDEANKMVATA 120

Query: 121 RKDKYTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNNRYSIIQP 180
           RK+ YT+E+ N KL EQL EKD                    E E+ +  G +R S +  
Sbjct: 121 RKESYTIEIKNNKLKEQLDEKDMILETLNLQLKNLKKVIQNLEKESTTHSG-SRSSFVGN 179

Query: 181 DXXXXXXXXXXXXXXXXXXXS----YSQNISNMANGXXXXXXXXXXRYDLPLYEEFLKFI 236
           D                   S    YS NI+++             RYDL LY EFLKFI
Sbjct: 180 DNSTSSISLNKTSTSNSDELSLGPIYSPNITSV-------------RYDLNLYTEFLKFI 226

Query: 237 AVIPHCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEP 296
           AV+P+C T+KDTSSDSKL+RRLVNDEI P L+LDNASGLGWIVR+T++S MMEGLVVVEP
Sbjct: 227 AVLPYCETLKDTSSDSKLLRRLVNDEIQPALRLDNASGLGWIVRRTLMSLMMEGLVVVEP 286

Query: 297 LSGVNETFQMGNSTQPPNAEASNKNESQSSM-PKLFKFPLTSPPIALHEPCSFCGESRDD 355
           LSG+NE FQ G ++  P   +S+ N S       LF +P  SPPIA+H+ CSFC E+RDD
Sbjct: 287 LSGLNENFQYGYTS--PVLPSSSFNPSMGGKDSHLFSYPSDSPPIAVHDKCSFCSEARDD 344

Query: 356 IIEHARMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKV 415
           +IEHARMYVLKTQ + EDG+++VTN+FPLC +CL KVRQTCEIFAFLRSLK G WNLEKV
Sbjct: 345 VIEHARMYVLKTQTRIEDGSLVVTNSFPLCRYCLLKVRQTCEIFAFLRSLKLGAWNLEKV 404

Query: 416 TM-KXXXXXXXXXXXXXXXAIRQTKTEDRRSKRMSFIGGLTKNSSAINTAQVESTTSMEI 474
           T+ K                 +  + E++R +RMS I G  KN S+    QV+    ++ 
Sbjct: 405 TLTKIAKGESSEFSQVSNGNHKGPQKEEKRLQRMSLITG--KNQSSKLAPQVD--IPVDQ 460

Query: 475 TGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPDDK-LEPASIEAN 533
            G PTTNIQRAW+QLCKLR  LHWAH+GIWS++D++T KIGP +K+ D+   EP S   N
Sbjct: 461 IGAPTTNIQRAWLQLCKLRITLHWAHIGIWSVEDAVTQKIGPFVKEEDENDDEPISPNEN 520

Query: 534 IKITK 538
             +TK
Sbjct: 521 PPLTK 525

>SAKL0C02596g Chr3 complement(238404..240608) [2205 bp, 734 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 734

 Score =  502 bits (1292), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 257/528 (48%), Positives = 341/528 (64%), Gaps = 9/528 (1%)

Query: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60
           MS+Q EESKR+S Q+++LSTQLIES+DKQS+LEE+L  A K IASQ  S   Y +L+ + 
Sbjct: 1   MSDQ-EESKRVSMQLSSLSTQLIESVDKQSRLEEQLRKAKKTIASQSESAASYESLREQL 59

Query: 61  EKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADA 120
           EK +     + +E    + K+  E   R+ A+ ++++L+KEVEDLTA+LFDEANNMVADA
Sbjct: 60  EKAQQELASRSRESAELERKLAAETTARKMAQDKIDQLNKEVEDLTASLFDEANNMVADA 119

Query: 121 RKDKYTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNNRYSIIQP 180
           R++K+ VEV N+KL EQLHEKD                    EDEN+SL    R S    
Sbjct: 120 RREKHDVEVRNSKLHEQLHEKDALLETLEMQLKNLKKVLYSLEDENSSLAKTKRNSAF-- 177

Query: 181 DXXXXXXXXXXXXXXXXXXXSYSQNISNMANGXXXXXXXXXXRYDLPLYEEFLKFIAVIP 240
                                 S    + A G          RYDL LY EFLKF+A++P
Sbjct: 178 -LSSDTATSSNVSLEKTATGGTSLGELSGAGGVLFSPVLQSLRYDLGLYNEFLKFVAMLP 236

Query: 241 HCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSGV 300
            CR+IK T+++SKL+RRL++DEI PVL+LDNASGLGW+VR++++S M++GLVVVEPLSGV
Sbjct: 237 ICRSIKGTTTESKLLRRLMHDEIQPVLRLDNASGLGWLVRRSLMSLMIDGLVVVEPLSGV 296

Query: 301 NETFQMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIEHA 360
           NET++MG S+   +A+  N +  Q     L+ +P  SPP+A+HE C+FC ESR+DI+EH 
Sbjct: 297 NETYRMGYSSPQLHAQ-QNAHFGQERAAHLYNYPTDSPPVAIHEACAFCSESRNDILEHG 355

Query: 361 RMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMKXX 420
           R+YVLKT  + EDGT   TN +PLCH+CL KVRQTCEIFAFLRSLK GVW+LEKVT+   
Sbjct: 356 RLYVLKTLQRNEDGTTETTNQYPLCHYCLLKVRQTCEIFAFLRSLKEGVWHLEKVTLTSI 415

Query: 421 XXXXXXXXXXXXXAIRQTKT-EDRRSKRMSFIGGLTKNSSAINTAQVESTTSMEI-TGLP 478
                            +   ED +SKRMSF+ GL++ S+      VE   +    +G P
Sbjct: 416 ATGGSSKFSEVTKTPHTSAAKEDAKSKRMSFMAGLSRPSTTKLMPTVEGAPNFAGQSGQP 475

Query: 479 TTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPDDKLE 526
            TNIQRAW QLCKLR+ LHWAH+G+WSI+DS+  +IGP +  P++K E
Sbjct: 476 VTNIQRAWAQLCKLRASLHWAHIGVWSIEDSVALRIGPLM--PEEKTE 521

>Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON}
           (144161..146635) [2475 nt, 825 aa]
          Length = 824

 Score =  488 bits (1255), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 269/608 (44%), Positives = 372/608 (61%), Gaps = 35/608 (5%)

Query: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60
           M + S+ESKR S Q+T LSTQL+ESI+KQ++LE+KL  + + I  QQ ++++Y++LKV++
Sbjct: 1   MEDSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKY 60

Query: 61  EKLKISSEDQQKELDNFKVKI-------RRERELRENAEQEVEKLSKEVEDLTATLFDEA 113
           ++L        K  +  KVKI       + E +LR +AEQ+V++L+KEVE+LTA+LFDEA
Sbjct: 61  DQL-------DKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEA 113

Query: 114 NNMVADARKDKYTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNN 173
           NNMVADAR+    +++ N KLVE LHEKD                    +++  ++  +N
Sbjct: 114 NNMVADARRGAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSN 173

Query: 174 RYSIIQPDXXXXXXXXXXXXXXXXXXXSYSQNISNMANGXXXXXXXXXXRYDLPLYEEFL 233
           R                          + + NI  ++N           RYDL LY EFL
Sbjct: 174 R----NSLISTTSASSSSVSLKKTITSNSTTNIDLLSNAIYTPKVPAV-RYDLYLYNEFL 228

Query: 234 KFIAVIPHCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVV 293
           KFIAV+P C +IK T+S+SKL+RRL+NDEI PVL+LDNASGLGWIV++T+++ M+EGLVV
Sbjct: 229 KFIAVLPFCESIKHTTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVV 288

Query: 294 VEPLSGVNETFQMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESR 353
           +EPLSGVNE ++  +S    N  ++N  +  S    LFK+P  SPPIA+HEPC+FCGE+R
Sbjct: 289 IEPLSGVNENYRFSSSAPVSNVNSNNDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENR 348

Query: 354 DDIIEHARMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLE 413
           +D++EHARMY+LKTQ K ED T+ +TN FPLC  CL KVRQTCEIFAFLRSLK G WNLE
Sbjct: 349 NDVLEHARMYMLKTQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLE 408

Query: 414 KVTMKXXXXXXXXXXXXXXXA---IRQTKTEDRRS----KRMSFIGGLTKNSSAINTAQV 466
           KVT+                A   I ++K E++      KR S + G    SS  NT   
Sbjct: 409 KVTLSTIAKGDSKKFSSVTAATSSISKSKIEEKFDSKLMKRRSIMAGFGI-SSISNTTTT 467

Query: 467 ESTTSMEI---TGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPDD 523
           +S TS+ +   +GLPTTNIQRAW+ L KLRS+LHWAH+GIW+ D+++T+K+ PE+ + + 
Sbjct: 468 KSETSVGVVDQSGLPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPELSESNQ 527

Query: 524 ---KLEPASIEANIKITKKQIEKDVESII--SENNQGESFDFXXXXXXXXXXXXXXXXXX 578
              +LE   I ANI  T ++    V   +  S+N   E FDF                  
Sbjct: 528 NGTELEDQQILANINNTSEESFTSVRESVEPSDNEDDEPFDFETNESTIQDAVPANAEVN 587

Query: 579 IAGESETK 586
             GE+ET+
Sbjct: 588 DGGETETE 595

>CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} similar
           to uniprot|P17065 Saccharomyces cerevisiae YNL272c SEC2
           protein transport protein
          Length = 752

 Score =  477 bits (1227), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 248/523 (47%), Positives = 333/523 (63%), Gaps = 14/523 (2%)

Query: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60
           MS+  EES RIS QV+ LSTQLIESID+QS+LE++L  A  II  Q+  + ++  LK + 
Sbjct: 1   MSDPIEESNRISVQVSTLSTQLIESIDRQSELEKRLRDAQIIINKQKHVMHEFETLKQKN 60

Query: 61  EKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADA 120
           ++L    +  ++++     ++  E+  R  AE+EV+KL +EVEDLTA+LFDEANNMV+DA
Sbjct: 61  KELSDGQQSFEEKIRALSAQLEEEKSKRLAAEKEVDKLGQEVEDLTASLFDEANNMVSDA 120

Query: 121 RKDKYTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNNRYSIIQP 180
           R++K+ +E+ N++L E L EKD                    + E  S I  N  S I  
Sbjct: 121 RREKHDIEIQNSRLQETLKEKDTVLETLNLQLKNLKKVLQTVDSE--SSINANIRSPIST 178

Query: 181 DXXXXXXXXXXXXXXXXXXXSYSQNISNMANGXXXXXXXXXXRYDLPLYEEFLKFIAVIP 240
           +                   S S N S + +           RYD  LY EFLKF+AV+P
Sbjct: 179 ENSTTTSASGNKLTRRQSQLSISHNESPLFS-----PYVTTLRYDQSLYNEFLKFLAVLP 233

Query: 241 HCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSGV 300
              ++K TS++SKL++RLV+DEI PVLK+DNASG+GW+VRK++L++MMEG VVVEPLSG+
Sbjct: 234 SSSSLKATSTESKLLKRLVSDEIQPVLKIDNASGIGWLVRKSLLTSMMEGQVVVEPLSGI 293

Query: 301 NETFQMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIEHA 360
           NE +Q+G  T+    E  ++NE +  MP +F FPL SPPIA+ +PC+FC E RDDIIEHA
Sbjct: 294 NEAYQLGYETK----EHVSQNEGEE-MPHMFNFPLNSPPIAVRDPCAFCAEQRDDIIEHA 348

Query: 361 RMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMKXX 420
           RMYV+KT NK+ DG+  +TN+FPLCHWCL KVRQTCEIFAFLRSLK G W+LEKVT+   
Sbjct: 349 RMYVMKTFNKENDGSTTITNSFPLCHWCLMKVRQTCEIFAFLRSLKLGTWHLEKVTLNTI 408

Query: 421 XXXXXXX--XXXXXXAIRQTKTEDRRSKRMSFIGGLTKNSSAINTAQVESTTSMEITGLP 478
                              T  E+++S R SFI  L K S   ++  VE+       G P
Sbjct: 409 SKGESLSKFSEVTKSTNGSTSNEEKKSNRKSFIPSLPKGSPKKSSPVVETHIDTTKAGQP 468

Query: 479 TTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDP 521
           T+NIQRAW+ LCKLRS+LHWAHVGIW+++DSI+ K+GP    P
Sbjct: 469 TSNIQRAWVHLCKLRSMLHWAHVGIWNMEDSISLKMGPITDHP 511

>KLTH0F02354g Chr6 complement(193705..195906) [2202 bp, 733 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 733

 Score =  469 bits (1206), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 245/535 (45%), Positives = 338/535 (63%), Gaps = 34/535 (6%)

Query: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60
           M+E+ EESKR+S QV++LSTQLIESIDKQS LEE+L  A K+IASQ+ SL  Y +L+ + 
Sbjct: 1   MTEE-EESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQL 59

Query: 61  EKLK--ISSEDQQKELDNFKVK--IRRERELRENAEQEVEKLSKEVEDLTATLFDEANNM 116
           E+ +  + SE  Q    N K++  ++  R  +  AE E+++L+KEVEDLTA+LFDEANNM
Sbjct: 60  EQAESNLKSERSQ----NIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNM 115

Query: 117 VADARKDKYTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNNRYS 176
           VADAR++ ++V+V N+KL EQL EK+                    E+E+N  + +N+ S
Sbjct: 116 VADARRETHSVQVKNSKLAEQLQEKETLLETLEIQLKNLKKVLYNLEEESNDRLKSNQAS 175

Query: 177 IIQPDXXXXXXXXXXXXXXXXXXXSYSQNISNMANGXXXXXXXX-------XXRYDLPLY 229
           +   D                   S  +   N  NG                 RYDL LY
Sbjct: 176 VAAEDSVASSSE------------SALEKTMNALNGTASPPSPALFSPLLKSLRYDLVLY 223

Query: 230 EEFLKFIAVIPHCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMME 289
            EFLKFIA +P C +I+D++S SKL+RRL++DEI PVL+LDNASG+GW +R+ ++S M++
Sbjct: 224 NEFLKFIAALPQCASIRDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMID 283

Query: 290 GLVVVEPLSGVNETFQMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFC 349
           G +VVEP+SG+NET+++G+ +    A    +   Q S P L+ +P  SPP+A+  PCSFC
Sbjct: 284 GSIVVEPVSGINETYRVGHMSSQVEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFC 343

Query: 350 GESRDDIIEHARMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGV 409
            ESR+DI+EH R+YVLKT  K E+G    ++ FPLCH+CL KVRQTCEIFAFLRSLK+G 
Sbjct: 344 SESRNDILEHGRLYVLKTLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGA 403

Query: 410 WNLEKVTM-KXXXXXXXXXXXXXXXAIRQTKTE----DRRSKRMSFIGGLTKNSSAINTA 464
           W+LE VT+ K                  ++  +    DR+SKRMSF+ GL+K      + 
Sbjct: 404 WHLEAVTISKTNNAFSVQTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSKTLPLKTSY 463

Query: 465 QVESTTSM-EITGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEI 518
            VES +   E    PTTNIQRAW QLCKLRS LHWAH+GIW+++D + +K+GP +
Sbjct: 464 TVESASPCPEQITTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVV 518

>Ecym_1085 Chr1 complement(170657..172774) [2118 bp, 705 aa] {ON}
           similar to Ashbya gossypii AFR670W
          Length = 705

 Score =  466 bits (1198), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 239/522 (45%), Positives = 334/522 (63%), Gaps = 15/522 (2%)

Query: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60
           M+EQ EESKRIS QV++LSTQLIESIDKQS+LEE LN A K +++Q+ S+ ++ +LK + 
Sbjct: 10  MTEQQEESKRISIQVSSLSTQLIESIDKQSRLEEHLNQAKKALSAQKDSISQFDSLKQQL 69

Query: 61  EKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADA 120
              K      ++EL   + ++   +E+R  AE+  EKL+KE+EDLT +LFDEAN+MVA+A
Sbjct: 70  SDTKKQLAYTEEELAVKRRELVEAQEVRVAAERAAEKLNKEIEDLTTSLFDEANSMVANA 129

Query: 121 RKDKYTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNNRYSIIQP 180
           RK+K+ VEVLN+KL EQL EKD                    EDE+N+L  + R SII  
Sbjct: 130 RKEKHDVEVLNSKLQEQLREKDMLLDTLSIQLRNLKEVLYKVEDEHNTL-NSYRQSIIME 188

Query: 181 DXXXXXXXXXXXXXXXXXXXSYSQNISNMANGXXXXXXXXXXRYDLPLYEEFLKFIAVIP 240
                                   +  N+             RYD+PLY E+L+F+AV+P
Sbjct: 189 GSNGSNASLDKEALGNPGLIYDHHHHMNLL----FSPLAQSLRYDIPLYTEYLRFLAVLP 244

Query: 241 HCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSGV 300
            C+ IKDT  DSK +RRLV DEI PVL+LD ASGLGW+VR+ +++ M++GLVVVEPLSG+
Sbjct: 245 MCKGIKDTRHDSKFLRRLVLDEIQPVLRLDAASGLGWLVRRNLMNLMIDGLVVVEPLSGI 304

Query: 301 NETFQMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIEHA 360
           NET+++G ++  P + +    E  ++  K+F +P  SPP+A+ +PC+FC ESR+DI+EH 
Sbjct: 305 NETYRIGYAS--PQSNSHKVTEVDNA--KMFNYPSNSPPVAIQDPCAFCSESRNDILEHG 360

Query: 361 RMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMKXX 420
           R+YVLKT  K EDG+      +PLCH+CL KVRQTCEIFAFLRSLK+G WNLE VT+   
Sbjct: 361 RLYVLKTLQKNEDGSTTSETQYPLCHYCLLKVRQTCEIFAFLRSLKSGAWNLENVTLSCA 420

Query: 421 XXXXXXXXXXXXXAIRQTKTEDR----RSKRMSFIGGLTKNSSAIN-TAQVESTTSM-EI 474
                        +   + +        SKR+SF+ GL++ SS+   T ++E+ T   E 
Sbjct: 421 RPGSDEFTKVDRNSTTNSASNKEANSTSSKRLSFMSGLSRTSSSTRMTPRIETVTDFSER 480

Query: 475 TGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGP 516
            GLP+TN+QR+W+ LCKLR+ LHW H+G+W+++DSI  K+ P
Sbjct: 481 KGLPSTNVQRSWVHLCKLRASLHWCHIGVWTLEDSIQLKVAP 522

>KNAG0F00460 Chr6 complement(64086..66050) [1965 bp, 654 aa] {ON}
           Anc_1.81 YNL272C
          Length = 654

 Score =  457 bits (1177), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 242/529 (45%), Positives = 329/529 (62%), Gaps = 24/529 (4%)

Query: 5   SEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEFEKLK 64
           ++ESKRIS Q+T++STQL+ESI  QS LEEKLN ANK  A+ +     Y  LK    KL+
Sbjct: 16  ADESKRISLQITSMSTQLMESIQNQSLLEEKLNRANKAAAALKEQTVHYDELKGRVAKLE 75

Query: 65  ISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADARKDK 124
            S  ++ +E+   K  +  E+  R  +++ VE+L  EVEDLTA+LF EANNMVADARK+K
Sbjct: 76  ASLTNRDEEMAALKSALAEEKSKRAASDKSVEELQSEVEDLTASLFSEANNMVADARKEK 135

Query: 125 YTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNNRYSIIQPDXXX 184
           +T E+LN KL+E ++EKD                    +  + S  G  R S+   D   
Sbjct: 136 HTTEILNRKLLEAVNEKDNALETMKIQLKHLRKMLEKVDVGSPSATG--RSSMTSADTDT 193

Query: 185 XXXXXXXXXXXXXXXXSYSQNISNMANGXXXXXXXXXXRYDLPLYEEFLKFIAVIPHCRT 244
                           S +Q+ S+ A            RYDL LY EFLKF+  +P C  
Sbjct: 194 NSLKGIVTR-------SSNQSQSDTAPLVVYSPSVGSVRYDLSLYSEFLKFLVSLPRCTQ 246

Query: 245 IKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSGVNETF 304
           I+DT S+SKL+RRL+NDEI P+L++D+A G+GW+ +K++++ M+EG+V++EP SGVNE +
Sbjct: 247 IRDTESESKLVRRLINDEIAPILRIDSAPGIGWMAKKSLMNVMLEGMVIIEPNSGVNENY 306

Query: 305 QMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIEHARMYV 364
           Q G+S+  P+    +  +SQ   P LF +P  SPPIA  E C+ CGESR DI EH R++ 
Sbjct: 307 QHGHSS--PSISQHSLGKSQ---PHLFSYPADSPPIASFESCALCGESRSDIYEHERLHK 361

Query: 365 LKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMKXXXXXX 424
           +K Q K++DGT+ V N +PLC WCL +VRQTCEIF+FLRSLKTGVW LE +  +      
Sbjct: 362 MKIQQKRDDGTLEVVNLYPLCLWCLLRVRQTCEIFSFLRSLKTGVWGLETIKTRGSPTSA 421

Query: 425 XXXXXXXXXA-IRQTKTED--RRSKRMSFIGGL-----TKNSSAINTAQV--ESTTSMEI 474
                    A IR+ KT++   R+KRMS++ GL     T +SSA N   +   STT  + 
Sbjct: 422 KSKKFDLNNAPIRRNKTKNSANRTKRMSWMAGLGLNTPTSSSSAPNDVSLMEPSTTFTDK 481

Query: 475 TGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPDD 523
            GLP TNI+RAW+QLCKLRSILHWAH+GIWS+ D++  KIGP   DPDD
Sbjct: 482 NGLPNTNIKRAWLQLCKLRSILHWAHIGIWSVSDALDLKIGPITTDPDD 530

>AFR670W Chr6 (1668415..1670568) [2154 bp, 717 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL272C (SEC2)
          Length = 717

 Score =  459 bits (1182), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 234/533 (43%), Positives = 341/533 (63%), Gaps = 26/533 (4%)

Query: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60
           MSEQ EE++RIS QV++LSTQLIESIDKQS+LEE+L HA K +A+Q+  + +  + + E 
Sbjct: 10  MSEQ-EENRRISVQVSSLSTQLIESIDKQSRLEEQLQHAKKALAAQKDVVKQCESARGEA 68

Query: 61  EKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADA 120
           ++L+    D+  EL+    ++   R+ R  AE  VE+L+KE+EDLT +LFDEAN MV+ A
Sbjct: 69  QQLRSQLADRDTELERQGEELEEARKARLAAELAVERLNKEIEDLTTSLFDEANRMVSKA 128

Query: 121 RKDKYTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNNRYSIIQP 180
           RK+K+ VE  N +L EQL EKD                    EDE N+   + R S++  
Sbjct: 129 RKEKHVVEQHNARLQEQLREKDMLLDTLTIQLKNLKDVLYKVEDEQNT--RSRRQSVMD- 185

Query: 181 DXXXXXXXXXXXXXXXXXXXSYSQNISNM-ANGXXXXXXXXXXRYDLPLYEEFLKFIAVI 239
                                Y+    NM ++G          RYD+P+Y E+L+F+AV+
Sbjct: 186 --------SVNPSHTSLDVDGYASAFDNMLSSGLLFTPAVQSLRYDIPMYTEYLRFLAVL 237

Query: 240 PHCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSG 299
           P C++I+DT  DSK +RRLV+DEI PVL+LD+A+GLGW+VR+ +++ M+EGLVVVEPLSG
Sbjct: 238 PMCKSIRDTRHDSKFLRRLVSDEIQPVLRLDSATGLGWLVRRNLMNLMIEGLVVVEPLSG 297

Query: 300 VNETFQMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIEH 359
           +NET++MG ++  P   + +K+ S+ +  K+F +P+ SPP+A+  PC+FC E+R+DI+EH
Sbjct: 298 INETYRMGYAS--PQTHSHSKS-SEPAAVKMFTYPVNSPPVAIEAPCAFCSEARNDILEH 354

Query: 360 ARMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMKX 419
            R+YVLKT  K E G ++  N +PLCH+CL KVRQTCEIFAFLRSLKTG WNLE VT+  
Sbjct: 355 GRLYVLKTLQKTETGELLTENQYPLCHFCLLKVRQTCEIFAFLRSLKTGSWNLENVTLSC 414

Query: 420 XXXXXXX------XXXXXXXAIRQTKTEDRRSKRMSFIGGLTK-NSSAINTAQVESTTSM 472
                                 R   +    SKR+SF+  L++ ++++  T ++E+ T  
Sbjct: 415 AKQESDAFTQIPNSVQASPVIHRDENSITSSSKRLSFMSSLSRVSTTSKTTPRIEAVTDF 474

Query: 473 -EITGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPDDK 524
            E  GLP TN+QR+W+ LCKLR+ LHW+H+G+W++DD++ +K+ P    P+DK
Sbjct: 475 NEKKGLPPTNVQRSWVHLCKLRASLHWSHIGVWTLDDAVQTKVVP--LSPEDK 525

>Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {ON}
           YNL272C (SEC2) - GDP/GTP exchange factor for Sec4p
           [contig 118] FULL
          Length = 694

 Score =  458 bits (1178), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 248/569 (43%), Positives = 354/569 (62%), Gaps = 26/569 (4%)

Query: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60
           M+E+ EESKR+S QV++LSTQLIESIDKQS LEE+L  A K+I+SQ+ +L  Y ++    
Sbjct: 1   MTEE-EESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRL 59

Query: 61  EKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADA 120
           E+ +   E  + +    K  ++  +   E A+ EV +L+KEVE+LTA+LFDEANNMVADA
Sbjct: 60  EETEAELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADA 119

Query: 121 RKDKYTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNNRYSIIQP 180
           RK+ ++++V N KL EQL EK                     E+E+NS + +NR  ++  
Sbjct: 120 RKETHSIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDT 179

Query: 181 DXXXXXXXXXXXXXXXXXXXSYSQNISNMANGXXXXXXXXXXRYDLPLYEEFLKFIAVIP 240
                                 +++ +N+             RYDL LY EFLKFIA +P
Sbjct: 180 SDNSTVSSAIALENTMHALNGTARSPNNV----LFSPVLKSLRYDLNLYNEFLKFIAALP 235

Query: 241 HCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSGV 300
              +IKDT+S+SKL+RRLV+DEI P+L+LDNASGLGW  ++++++ MM+GLVVVEP+SG+
Sbjct: 236 TSASIKDTASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGI 295

Query: 301 NETFQMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIEHA 360
           NET+++ +++   N +       Q     L+ +P  SPP+A+ +PCSFC ESR+DI+EH 
Sbjct: 296 NETYRVSHASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHG 355

Query: 361 RMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMKXX 420
           R+YVL+T  K E+GT  V + FPLCH+CL KVRQTCEIFAFLRSLK+G W+LE VT+   
Sbjct: 356 RLYVLRTLQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDAN 415

Query: 421 XXXXXXXXXXXXX-------AIRQTKTEDRRSKRMSFIGGLTKNSSAINTAQVEST--TS 471
                               + R+ K+ DR+SKR+S + GLTK+  +  +  +E T  ++
Sbjct: 416 SQRSSTEFKSQSKLSTPERGSERKVKS-DRKSKRLSIMAGLTKSFPSKTSYAIEETPGSN 474

Query: 472 MEITGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPDDKLEPASIE 531
            ++T  PTTNIQ AW QLCKLRS LHW H+GIWSI DS+ +K+GP +  PD      S E
Sbjct: 475 SQVTT-PTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGP-MTFPD------SAE 526

Query: 532 ANIKITKKQIEKDVESIISENNQGESFDF 560
           A +  +  ++   ++S+ S NN  + FDF
Sbjct: 527 A-VASSSNEVLTHLQSLASSNN--DEFDF 552

>ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weakly
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 779

 Score =  459 bits (1180), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 247/563 (43%), Positives = 339/563 (60%), Gaps = 63/563 (11%)

Query: 1   MSEQSE--ESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKV 58
           MSE SE  ES+R+S Q+ +LSTQLIESI++QS LE++LN ANKII     ++ +Y  LK 
Sbjct: 1   MSEPSEVEESRRVSTQIMSLSTQLIESIERQSTLEKELNQANKIIEGHGGAMQEYEKLKK 60

Query: 59  EFEKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVA 118
            F +L+    ++  +L+  + ++R+++E R  A+   +KL+ EVE+LTA+LFDEANNMVA
Sbjct: 61  NFAELEKRESNKDAQLNKLREELRKQKEARTEADSNADKLNHEVEELTASLFDEANNMVA 120

Query: 119 DARKDKYTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNNRYSII 178
           DARK  +  E+ N KLVEQLHE+D                    +D++ +          
Sbjct: 121 DARKASHATELRNAKLVEQLHERDALLETLNLQLRHLKKVIQTLDDDSMA---------- 170

Query: 179 QPDXXXXXXXXXXXXXXXXXXXSYSQNISNMAN-------GXXXXXXXXXXRYDLPLYEE 231
                                 S S+N+S+          G          RYDL LY E
Sbjct: 171 ----SEQVKTLANASDNANLAASLSKNLSSSHGRQIEAPLGPIFSPNITAVRYDLGLYHE 226

Query: 232 FLKFIAVIPHCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGL 291
           FLKF+AV+P  + IKDT+SDSKL+RRLVNDEI PVLKL+NASGLGWI+++T+++ M+EGL
Sbjct: 227 FLKFLAVLPDYQDIKDTASDSKLLRRLVNDEIQPVLKLENASGLGWILKRTLVNLMIEGL 286

Query: 292 VVVEPLSGVNETFQMG---------------NSTQPPNAEAS--------NKNESQSS-M 327
           V VEP+SG+NE  Q G               NS    N+ A+         +N S+SS M
Sbjct: 287 VAVEPISGLNEMHQYGYASPMLNQHSKMGGNNSNSLENSPATTSNTSTTTKRNHSRSSSM 346

Query: 328 PK---LFKFPLTSPPIALHEPCSFCGESRDDIIEHARMYVLKTQNKQEDGTIMVTNTFPL 384
            K   LF +P  SPP+AL E C+ CGE RDD++EHAR+++LKTQ++ +DGT+ V NTFPL
Sbjct: 347 TKSLNLFNYPSDSPPVALREKCAICGECRDDLVEHARLHILKTQSRADDGTVTVNNTFPL 406

Query: 385 CHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMKXXXXXXXXXXXXXXXA-------IRQ 437
           C +C+ K+RQTCEIFAFLRSLK G W LEKV++                         R 
Sbjct: 407 CKYCVLKIRQTCEIFAFLRSLKLGAWKLEKVSLTSVSKGDSKEFSQVSMVNSNEDKPNRD 466

Query: 438 TKTEDRRSKRMSFIGGLTKNSSAINTAQVESTTSMEIT--GLPTTNIQRAWIQLCKLRSI 495
           +K E+R++ R SF+ G+    +A+N+     T  + ++  G PTTNIQ AWIQLC+LRS+
Sbjct: 467 SKKENRKTARKSFMAGM----NALNSKNTTVTPEVPVSQAGAPTTNIQWAWIQLCRLRSM 522

Query: 496 LHWAHVGIWSIDDSITSKIGPEI 518
           LHW H+GIW++DD ITSKIGP +
Sbjct: 523 LHWTHIGIWNVDDCITSKIGPLV 545

>TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa]
           {ON} Anc_1.81 YNL272C
          Length = 795

 Score =  456 bits (1174), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 254/551 (46%), Positives = 340/551 (61%), Gaps = 48/551 (8%)

Query: 1   MSEQ--SEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKV 58
           MSEQ  ++ES+R++ QVT LSTQL+ESI KQS+LE+KLN ANK +A+Q+ +++K S +K 
Sbjct: 1   MSEQEIADESQRVTDQVTLLSTQLMESISKQSQLEDKLNQANKKLAAQKLTIEKNSQIKA 60

Query: 59  EFEKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVA 118
               L+ ++ D + +L     ++ +ER+LRE AE E   L+KEVEDLTA+LFDEAN+MVA
Sbjct: 61  TGSALQKNANDLESQLKIANAELVKERQLREKAEGECTALNKEVEDLTASLFDEANHMVA 120

Query: 119 DARKDKYTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNNRYSII 178
           DARK+K  VE+ NTKL+EQL EKD                    +DE+++   N+  S +
Sbjct: 121 DARKEKAAVELRNTKLMEQLKEKDTVLETLELQLKNLKKVLQEFQDEDSNNKRNSMLSEV 180

Query: 179 QPDXXXXXXXXXXXXXXXXXXXS-----YSQNISNMANGXXXXXXXXXXRYDLPLYEEFL 233
                                 S     YS NIS++             RYDLPLY EFL
Sbjct: 181 TIHSGSSQRAGSPTIISTTNSESFANIIYSPNISDI-------------RYDLPLYGEFL 227

Query: 234 KFIAVIPHCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVV 293
           KF+AV+P  + IK T++DSKL+RRLVNDEI PVL+LDNA GLGW+V++T+L+ MMEGLV+
Sbjct: 228 KFVAVLPFVKNIKQTTNDSKLLRRLVNDEIQPVLRLDNADGLGWVVKRTLLTQMMEGLVM 287

Query: 294 VEPLSGVNETF--------QMGNSTQPPNAEASNKNESQSSMPK---LFKFPLTSPPIAL 342
           VEPLSGVNE +           N+T     + S K+ + SS  K   LF FP  SPP+A+
Sbjct: 288 VEPLSGVNELYTHSRNRRSATSNNTTGSTRDISGKDTNGSSNQKNSHLFNFPTNSPPVAV 347

Query: 343 HEPCSFCGESRDDIIEHARMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFL 402
           HEPC+FC E RDD ++HAR+++LKTQ++ E G I VTN FPLC  C+ KVRQT EIFAFL
Sbjct: 348 HEPCAFCNEKRDDSVQHARIHLLKTQSRSETGKITVTNQFPLCQSCVLKVRQTGEIFAFL 407

Query: 403 RSLKTGVWNLEKVTMKXXXXXXXXXXXXXXXA-IRQTKTEDRRSKRMSFIGGL--TKNSS 459
           RSL  G W LEK+ +                +  +  + E +++KR SFI GL   + +S
Sbjct: 408 RSLALGTWKLEKIAIANLSKSDPTKIKGSPASPTKDKEKEKKKAKRKSFIKGLNMAQTAS 467

Query: 460 AINTAQVE--------------STTSMEITGLPTTNIQRAWIQLCKLRSILHWAHVGIWS 505
            +N A                 S T ++  G PTTNIQRAW+QLCKLR +LHW+H+GIWS
Sbjct: 468 VLNPATSNPFFQQTQTNPVGDTSLTDVDTFGQPTTNIQRAWLQLCKLRCMLHWSHMGIWS 527

Query: 506 IDDSITSKIGP 516
           +DDSI +K  P
Sbjct: 528 LDDSIEAKFAP 538

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 58/112 (51%), Gaps = 24/112 (21%)

Query: 593 NSEHQSANALEQETKNNFEEVTKKDIEQESESERKPKEAGDETLTHEPNSISP----KIE 648
           N++H S+N   + +  + E  T  + EQESES      A D+TLT    SI+P     IE
Sbjct: 660 NTQHVSSNVQNRNSTASAENPTMLEDEQESESSIA---ANDDTLTK---SITPVDDQNIE 713

Query: 649 EE-----NKEDTASSKASN-------EDDENGTAASSIN--ETDDVLDNYTD 686
            E     ++EDT+++ ++        E +E  T  +S N  + DD+LD+Y D
Sbjct: 714 HESTISSDREDTSATNSTGIINSVNGETNEPSTQLTSDNDNQNDDILDSYID 765

>TPHA0B04500 Chr2 (1059147..1061348) [2202 bp, 733 aa] {ON} Anc_1.81
           YNL272C
          Length = 733

 Score =  442 bits (1138), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 232/537 (43%), Positives = 341/537 (63%), Gaps = 12/537 (2%)

Query: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60
           MS  S+E KR+S Q+T+LSTQL+ESI+KQS LE+KL  + KII  Q+ ++ +Y+ L++++
Sbjct: 1   MSGNSDEDKRVSVQLTSLSTQLLESIEKQSSLEDKLRQSRKIIEEQKTTITQYNELRIKY 60

Query: 61  EKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADA 120
           ++L  +   ++ +L   + +++ E+  +  AE++V++L+KEVE+LTA+LFDEANNMVADA
Sbjct: 61  DQLDKNFSKKKVDLQRLEQQLQAEKLGKAEAERKVDELNKEVEELTASLFDEANNMVADA 120

Query: 121 RKDKYTVEVLNTKLVEQLHEKDXXXXXXXXXXXXXXXXXXXXEDENNSLIGNNRYSIIQP 180
           RK+  ++E  N KL EQL EKD                    + E++  I NN    ++ 
Sbjct: 121 RKETDSIETKNKKLTEQLLEKDTILETLNLQLKNLKTVLQDLQTESSMSIINNGNISLKG 180

Query: 181 DXXXXXXXXXXXXXXXXXXXSYS--QNISNMANGXXXXXXXXXXRYDLPLYEEFLKFIAV 238
           D                   + +  Q+   + N           RYD  LY EFLKF+AV
Sbjct: 181 DVPLSNENGGSSSHSLKKMSTTTSFQSQQEVVNYAIFTPKITNIRYDTFLYNEFLKFVAV 240

Query: 239 IPHCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLS 298
           +PHC +IK+TS++SKL+RRL++DEI+PVL+LD ++GLGW+ ++T+++ ++EGLVV+EPLS
Sbjct: 241 LPHCNSIKNTSAESKLLRRLISDEIHPVLRLDTSNGLGWLTKRTLMNQIVEGLVVIEPLS 300

Query: 299 GVNETFQMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIE 358
           G+NET++   +    +   S+    Q +  K+F FP  SPPIA+ +PC+FC ESR D I 
Sbjct: 301 GINETYRQS-ALYEVSISKSSIKSDQITKAKMFNFPADSPPIAVRDPCAFCDESRSDCIG 359

Query: 359 HARMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTM- 417
           HARMY+LKTQ + +D T+ +TN +PLC  CL KVRQTC+IFAFLRSLK+GVW LEKVT+ 
Sbjct: 360 HARMYMLKTQTRNDDDTLSITNQYPLCQACLIKVRQTCDIFAFLRSLKSGVWQLEKVTLS 419

Query: 418 ---KXXXXXXXXXXXXXXXAIRQTKTEDRRSKRMSFIGGLTKNSSAINTAQVESTTSMEI 474
              K                  +   ++++ KR S I  L K+ S+   A+++ T  +E 
Sbjct: 420 TISKGDTSSFLKVAENQFKQNEKATAQEKKQKRKSIISSLGKSHSSYVNAKLDCT--VEP 477

Query: 475 TGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEI---KDPDDKLEPA 528
            GLP+TNIQRAW+QLCKLRSILHW+H+GI + +D +TS   P     K   DKLEP+
Sbjct: 478 VGLPSTNIQRAWLQLCKLRSILHWSHIGISNTEDCVTSTFAPVATNNKVVADKLEPS 534

>KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 658

 Score =  326 bits (835), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 143/297 (48%), Positives = 207/297 (69%), Gaps = 15/297 (5%)

Query: 223 RYDLPLYEEFLKFIAVIPHCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKT 282
           RYD+PLY E+LKF+AV+P C  ++ T+S+SKL+RRL+N EI+PVL+LDNASG+GW+V++ 
Sbjct: 207 RYDVPLYTEYLKFLAVLPQCENLQQTTSESKLLRRLINYEISPVLRLDNASGVGWLVKRN 266

Query: 283 ILSTMMEGLVVVEPLSGVNETFQMGNSTQ--PPNAEASNKNESQSSMPKLFKFPLTSPPI 340
           +++ MMEGLV +EP+SG+NET++ G S+   P + E  NK+        LF  P+ SPP+
Sbjct: 267 LMNLMMEGLVSIEPISGINETYRTGYSSPSIPDSPEVENKDS------HLFSRPVNSPPV 320

Query: 341 ALHEPCSFCGESRDDIIEHARMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFA 400
           A+ EPC+FCGE+R+DI+EH R+Y+ KT  K E+G   +TN FP+CH+CL K+RQ CEIFA
Sbjct: 321 AMVEPCAFCGENRNDILEHGRLYIFKTYQKLENGKNELTNQFPVCHYCLLKLRQVCEIFA 380

Query: 401 FLRSLKTGVWNLEKVTMKXXXXXXXXXXXXXXXAIRQTKTEDRRSKRMSFIGGLTKNSSA 460
           FLRSL++G W+LEKV +                A R       +SKR+S   GL ++ S+
Sbjct: 381 FLRSLRSGAWHLEKVALASIHQGKVNAYSEVTKASRPK----MKSKRLSIFQGLKQSQSS 436

Query: 461 INTAQVESTTSM-EITGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGP 516
             T  +E+     +  GLPTTNIQR+W +L +LR+ L W+H+G+WS+D+S+ + I P
Sbjct: 437 --TPIIENGPQFADKNGLPTTNIQRSWARLSQLRASLQWSHIGVWSLDESVATDIAP 491

 Score =  137 bits (345), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 82/142 (57%), Positives = 108/142 (76%), Gaps = 8/142 (5%)

Query: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60
           M++Q EESKRIS QVT+LSTQLIESIDKQS+LEE+L  A K I++QQ   + Y+ LK E 
Sbjct: 1   MADQ-EESKRISLQVTSLSTQLIESIDKQSQLEEQLLVAKKTISTQQNIANSYNELKQEL 59

Query: 61  EKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADA 120
           + LK+     Q E D  K K +++ E+  +AE++V  L++E+EDLTA+LFDEANNMVADA
Sbjct: 60  QSLKL-----QYETD--KTKFKKQEEICADAEKKVATLNQEIEDLTASLFDEANNMVADA 112

Query: 121 RKDKYTVEVLNTKLVEQLHEKD 142
           RK++  VE+LN+KL EQL EKD
Sbjct: 113 RKEQNAVEILNSKLKEQLKEKD 134

>KAFR0H02330 Chr8 complement(445031..449530) [4500 bp, 1499 aa] {ON}
           Anc_8.694 YPL167C
          Length = 1499

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 51/98 (52%), Gaps = 7/98 (7%)

Query: 588 HASQDNSEHQSANALEQETKN-NFEEVTKKDIEQESESERKPKEAGDETLTHEPNSISPK 646
           H+ +D  +  SA    +E  N  F+   KK+     E  RKP EA +E    +PN+++ +
Sbjct: 346 HSFKDFYDAASAKTTSKENPNPTFDTYLKKN--PIFEKIRKPYEAINELWPEQPNTLNSQ 403

Query: 647 IEEENKE---DTASSKASNEDDENGTAASSINETDDVL 681
              EN+    DT+  + +  DDE G AA+++NE   +L
Sbjct: 404 TISENENEVIDTSFQQYTILDDE-GDAANNMNEDYGML 440

>SAKL0B11946g Chr2 complement(1025700..1028240) [2541 bp, 846 aa]
           {ON} weakly similar to and weakly similar to YMR053C
           uniprot|P46679 Saccharomyces cerevisiae YMR053C STB2
           Protein that binds Sin3p in a two-hybrid assay and is
           part of a large protein complex with Sin3p and Stb1p
          Length = 846

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 39/62 (62%), Gaps = 3/62 (4%)

Query: 76  NFKVKIRRERELRENAEQEVEKLSKEVEDL---TATLFDEANNMVADARKDKYTVEVLNT 132
           +F++ IR  ++  E+++ +++ L KE E+L    A LF +  ++ + A K KY + VL+T
Sbjct: 681 DFEIPIRDLKKNYEDSKADLDNLEKETENLECKRALLFKDMKDLDSLASKFKYDIRVLDT 740

Query: 133 KL 134
           ++
Sbjct: 741 RM 742

>Smik_11.260 Chr11 complement(435500..436927) [1428 bp, 475 aa] {ON}
           YKR005C (REAL)
          Length = 475

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 47/90 (52%), Gaps = 10/90 (11%)

Query: 604 QETKNNFEEVTKKDIEQESESERKPKEAGDETLTHEPNSISPKIEEENKEDTASSKASNE 663
           Q+TK++F+   K D + E +   K + + D+TL+  P+ +      EN   T + K  N+
Sbjct: 123 QDTKSSFDMFKKIDTDDEIQILHK-RGSNDKTLSESPSDVD---RSENHSGTNTKKQGND 178

Query: 664 DDENGT------AASSINETDDVLDNYTDA 687
            ++NGT      A S I + +D +DN  D+
Sbjct: 179 SEDNGTKEINEDACSVIFDENDSIDNSLDS 208

>Smik_6.436 Chr6 complement(710034..715697) [5664 bp, 1887 aa] {ON}
           YPL231W (REAL)
          Length = 1887

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%)

Query: 3   EQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEFEK 62
           E  E+ +++SQ V  ++     + D Q  +EE L    K I++Q    D  S+ +VEFEK
Sbjct: 514 EPREKVRKLSQYVQEMALGGPITKDSQPTIEEDLTRVYKAISAQADKQDISSSTRVEFEK 573

Query: 63  L 63
           L
Sbjct: 574 L 574

>NDAI0G02640 Chr7 complement(604606..605268) [663 bp, 220 aa] {ON}
           Anc_8.315 YLR119W
          Length = 220

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 52/107 (48%), Gaps = 17/107 (15%)

Query: 22  LIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEFEKLKISSEDQQKELDNFKV-- 79
           L E  DK S+   K +  N  I+  Q    +  +L   F++L++  +D +KEL+++KV  
Sbjct: 67  LTEHADKLSEYVTKFHPLNDTISDIQTLKQRLRDLHERFDELQLKRDDIKKELEDYKVVE 126

Query: 80  --KIRRERE-------------LRENAEQEVEKLSKEVEDLTATLFD 111
              +++ ++             LR N E  +++L  E  +L  +++D
Sbjct: 127 SMYVKKWQDFHHLIQEKYSDDALRRNVEMYLKRLDNECTNLEVSMYD 173

>KLLA0F24090g Chr6 complement(2243449..2246406) [2958 bp, 985 aa]
           {ON} similar to uniprot|P53920 Saccharomyces cerevisiae
           YNL123W shows protein sequence similarity to the
           mammalian Omi/HtrA2 family of serine proteases
          Length = 985

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 13/71 (18%)

Query: 354 DDIIEHARM------YVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKT 407
           DD IE  +        ++K  N  +  T  +T+ +   HWC        E   + R+ KT
Sbjct: 453 DDFIEVMKTIPDEKRVIVKFHNLTDVQTQRITSVYIDRHWC-------SEFRIYTRNDKT 505

Query: 408 GVWNLEKVTMK 418
           G+W+ EK+T K
Sbjct: 506 GIWDYEKITEK 516

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.125    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,961,518
Number of extensions: 2851034
Number of successful extensions: 30465
Number of sequences better than 10.0: 1348
Number of HSP's gapped: 29801
Number of HSP's successfully gapped: 2191
Length of query: 689
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 572
Effective length of database: 40,065,477
Effective search space: 22917452844
Effective search space used: 22917452844
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)