Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_YGOB_YDR119W-A8.273ON74743621e-46
KLTH0G13442g8.273ON74742581e-30
SAKL0H16786g8.273ON74751755e-18
TBLA0F030308.273ON75581112e-08
KLLA0F19371g8.273ON80701052e-07
Ecym_42978.273ON7476983e-06
CAGL0B01875g8.273ON7430983e-06
Kpol_YGOB_YDR119W-A8.273ON7531973e-06
Skud_4.3808.273ON6666931e-05
Smik_4.3648.273ON6566912e-05
TDEL0F040008.273ON6240894e-05
ZYRO0D06908g8.273ON7766887e-05
YDR119W-A (COX26)8.273ON6666879e-05
Suva_2.2808.273ON6666825e-04
TPHA0A017408.273ON7938760.005
NDAI0J012908.273ON7531750.006
KNAG0H031708.273ON7167740.010
KAFR0B054408.273ON6666720.014
KAFR0B027608.273ON7933650.25
NCAS0B037708.273ON6063601.0
KLLA0F19382gsingletonON7544591.6
TDEL0E025605.372ON46956584.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_YGOB_YDR119W-A
         (74 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74 a...   144   1e-46
KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa] {...   103   1e-30
SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa] {...    72   5e-18
TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}...    47   2e-08
KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some s...    45   2e-07
Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON} s...    42   3e-06
CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar ...    42   3e-06
Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON} A...    42   3e-06
Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A ...    40   1e-05
Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A ...    40   2e-05
TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273...    39   4e-05
ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON...    39   7e-05
YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}  COX26Putat...    38   9e-05
Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A ...    36   5e-04
TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}...    34   0.005
NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.27...    33   0.006
KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}...    33   0.010
KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa] {O...    32   0.014
KAFR0B02760 Chr2 (565868..566107) [240 bp, 79 aa] {ON} Anc_8.273...    30   0.25 
NCAS0B03770 Chr2 complement(674509..674691) [183 bp, 60 aa] {ON}       28   1.0  
KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some s...    27   1.6  
TDEL0E02560 Chr5 (493910..495319) [1410 bp, 469 aa] {ON} Anc_5.3...    27   4.2  

>Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74
          aa] {ON} ANNOTATED BY YGOB -
          Length = 74

 Score =  144 bits (362), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 74/74 (100%), Positives = 74/74 (100%)

Query: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT 60
          MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT
Sbjct: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT 60

Query: 61 IMLGWPFGVRAIVH 74
          IMLGWPFGVRAIVH
Sbjct: 61 IMLGWPFGVRAIVH 74

>KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa]
          {ON} conserved hypothetical protein
          Length = 74

 Score =  103 bits (258), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 50/74 (67%), Positives = 60/74 (81%)

Query: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT 60
          MLSSQIL+SVA LQGVAA+  S++ SRV+ K PSSRAR+WAVIEAKR+VP + MW   M 
Sbjct: 1  MLSSQILKSVATLQGVAASQVSRSASRVVLKGPSSRARKWAVIEAKRLVPAIGMWGAFMG 60

Query: 61 IMLGWPFGVRAIVH 74
           +LGWPF VRA+VH
Sbjct: 61 AVLGWPFAVRALVH 74

>SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa]
          {ON} similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A Pi
          Length = 74

 Score = 72.0 bits (175), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 49/75 (65%), Gaps = 3/75 (4%)

Query: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSR-ARQWAVIEAKRIVPTVAMWATSM 59
          M SSQ+LRS AA+   A   ASK  S+V+ +A   R    WA+ EAKR+VPT+ +W  SM
Sbjct: 1  MFSSQVLRSTAAISRSAV--ASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASM 58

Query: 60 TIMLGWPFGVRAIVH 74
            +LGWPF V+ IVH
Sbjct: 59 AAVLGWPFAVKKIVH 73

>TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 75

 Score = 47.4 bits (111), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 35/58 (60%), Gaps = 5/58 (8%)

Query: 13 LQGVAATSASKAGSRVMFKAPSSRA---RQWAVIEAKRIVPTVAMWATSMTIMLGWPF 67
           Q  A +SAS A  R+  +   +R+     WAV E KRIVP +A WAT +++ LGWPF
Sbjct: 3  FQHAARSSASMA--RMQLRRSFTRSYTQESWAVTEVKRIVPNIAFWATLLSVSLGWPF 58

>KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 80

 Score = 45.1 bits (105), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 3/70 (4%)

Query: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT 60
          M  ++ LRS A    +A   A++  ++   ++       WAV EA+R+ PT+ M+ T + 
Sbjct: 1  MFFTKALRSTAT---IAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIV 57

Query: 61 IMLGWPFGVR 70
           +LGWPF VR
Sbjct: 58 SVLGWPFLVR 67

>Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON}
          similar to Saccharomyces cerevisiae YDR119W-A
          Length = 74

 Score = 42.4 bits (98), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 8/76 (10%)

Query: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSR--ARQWAVIEAKRIVPTVAMWATS 58
          ML S+IL++V+    +  +  S  G+R   +A +S+     W V E KR+VPT+ +W  +
Sbjct: 1  MLYSRILKAVST---IPKSPMSNIGAR---RAATSKHIGEPWMVTETKRLVPTILIWGGT 54

Query: 59 MTIMLGWPFGVRAIVH 74
          MT +L WP   R  + 
Sbjct: 55 MTGILLWPIIFRVYIE 70

>CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar
          to uniprot|Q2V2P9 Saccharomyces cerevisiae YDR119wa
          Length = 74

 Score = 42.4 bits (98), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 40 WAVIEAKRIVPTVAMWATSMTIMLGWPFGV 69
          W + E KR+ PT+  WA+ +T+ LGWPFG+
Sbjct: 38 WTIAEIKRLTPTLIGWASFLTVTLGWPFGI 67

>Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 75

 Score = 42.0 bits (97), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 37 ARQWAVIEAKRIVPTVAMWATSMTIMLGWPF 67
             WAV EAKR+ PT+  W T++T +L WPF
Sbjct: 35 GESWAVTEAKRVFPTIIGWGTTLTAILSWPF 65

>Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 40.4 bits (93), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 12/66 (18%)

Query: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT 60
          M  SQ+LRS A     AA      G RV           W + E +R++P V  W+ +++
Sbjct: 1  MFFSQVLRSSAR----AAPIKRYTGGRV--------GESWVITEGRRLIPEVLQWSAALS 48

Query: 61 IMLGWP 66
          I LGWP
Sbjct: 49 ICLGWP 54

>Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A
          (REAL)
          Length = 65

 Score = 39.7 bits (91), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 12/66 (18%)

Query: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT 60
          M  S++LRS A     AA      G RV           W + E +R++P V  W+ +++
Sbjct: 1  MFFSEVLRSSAR----AAPIKRYTGGRV--------GESWVITEGRRLIPEVFQWSATLS 48

Query: 61 IMLGWP 66
          I LGWP
Sbjct: 49 ICLGWP 54

>TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 62

 Score = 38.9 bits (89), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 34 SSRARQWAVIEAKRIVPTVAMWATSMTIMLGWPFGVRAIV 73
          +  ++ WAV EAKR+ P +  W   +   LGWPF ++  +
Sbjct: 20 NHNSQSWAVSEAKRLTPAILGWGGFLAGCLGWPFAIKHFM 59

>ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON}
          similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A
          Length = 77

 Score = 38.5 bits (88), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 9/66 (13%)

Query: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT 60
          M  +Q+LR+       +A SA+K  ++ + K  SS   QW ++EA+R+      WA S++
Sbjct: 1  MFFTQVLRN-------SAVSATKQAAKQISK--SSAGEQWGLLEARRLSRGAVEWAVSLS 51

Query: 61 IMLGWP 66
          ++L WP
Sbjct: 52 LILAWP 57

>YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}
          COX26Putative protein of unknown function; copurifies
          with respiratory chain supercomplexes composed of
          Complex III (ubiquinol-cytochrome c reductase) and
          Complex IV (cytochrome c oxidase)
          Length = 66

 Score = 38.1 bits (87), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 12/66 (18%)

Query: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT 60
          M  SQ+LRS A     AA      G R+           W + E +R++P +  W+  ++
Sbjct: 1  MFFSQVLRSSAR----AAPIKRYTGGRI--------GESWVITEGRRLIPEIFQWSAVLS 48

Query: 61 IMLGWP 66
          + LGWP
Sbjct: 49 VCLGWP 54

>Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 36.2 bits (82), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 29/66 (43%), Gaps = 12/66 (18%)

Query: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT 60
          M  SQ+LRS A     AA      G RV           W + E++R++P V  W   + 
Sbjct: 1  MFFSQVLRSSAR----AAPIKRYTGGRV--------GEAWMITESRRLIPEVFQWGAVIC 48

Query: 61 IMLGWP 66
            LGWP
Sbjct: 49 TCLGWP 54

>TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 79

 Score = 33.9 bits (76), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 31 KAPSSR--ARQWAVIEAKRIVPTVAMWATSMTIMLGWP 66
          K P S      W + EAKR+ P +  W ++MT +L WP
Sbjct: 27 KTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTVLLWP 64

>NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 75

 Score = 33.5 bits (75), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 36 RARQWAVIEAKRIVPTVAMWATSMTIMLGWP 66
          R   W   E +R+ PT+  W+T + ++LGWP
Sbjct: 32 RGLPWVSSEIQRVAPTILRWSTFLVVVLGWP 62

>KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 71

 Score = 33.1 bits (74), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT 60
          M  SQ+ +S+  +        + +G RV    P      +   E KR +P VA+W + + 
Sbjct: 1  MFRSQVSKSLQRMSKPIGLRYASSGGRV---GPG-----FYRTEIKRRIPQVALWGSGLF 52

Query: 61 IMLGWPF 67
          ++L WPF
Sbjct: 53 LVLEWPF 59

>KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa]
          {ON} Anc_8.273 YDR119W-A
          Length = 66

 Score = 32.3 bits (72), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 9/66 (13%)

Query: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT 60
          M + Q+ R++   +  AATS + A               +  ++AK+ V T+A W T + 
Sbjct: 1  MPNKQLFRTLNFARFYAATSKTHA---------QHIGPPYLYLKAKQDVKTIAAWGTFLL 51

Query: 61 IMLGWP 66
          + LGWP
Sbjct: 52 VALGWP 57

>KAFR0B02760 Chr2 (565868..566107) [240 bp, 79 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 79

 Score = 29.6 bits (65), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 9/33 (27%), Positives = 21/33 (63%)

Query: 40 WAVIEAKRIVPTVAMWATSMTIMLGWPFGVRAI 72
          W ++E KR +  +  +  +++++  WPF +RA+
Sbjct: 35 WGLMEFKRQIVLIPGFLLTLSVLCFWPFSIRAV 67

>NCAS0B03770 Chr2 complement(674509..674691) [183 bp, 60 aa] {ON}
          Length = 60

 Score = 27.7 bits (60), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT 60
          M+ + ILR+ A   G    S+ +A +R     P +  R W   E KR+ PT+ +WA+ + 
Sbjct: 1  MIFNTILRNTARRAGA---SSRQAFTRSYTVGPLTGVR-WLKGEVKRVTPTLGVWASILI 56

Query: 61 IML 63
            L
Sbjct: 57 TTL 59

>KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 75

 Score = 27.3 bits (59), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/44 (25%), Positives = 22/44 (50%)

Query: 27 RVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMTIMLGWPFGVR 70
          RV++ +       W   E +R+ P +  +A  +  M+ WP+ V+
Sbjct: 18 RVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWPYWVK 61

>TDEL0E02560 Chr5 (493910..495319) [1410 bp, 469 aa] {ON} Anc_5.372
           YDR329C
          Length = 469

 Score = 26.9 bits (58), Expect = 4.2,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 2   LSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWAT 57
           LSS I  SV  ++ ++A++ASK    V  K   S+A  W  ++ K ++  V +  T
Sbjct: 121 LSSGISTSVTEVENLSASTASK----VENKTQKSKAELWNELKTKSLIKMVTVSYT 172

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.125    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 4,782,722
Number of extensions: 108420
Number of successful extensions: 401
Number of sequences better than 10.0: 23
Number of HSP's gapped: 400
Number of HSP's successfully gapped: 23
Length of query: 74
Length of database: 53,481,399
Length adjustment: 46
Effective length of query: 28
Effective length of database: 48,206,763
Effective search space: 1349789364
Effective search space used: 1349789364
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)