Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_YGOB_YCL058W-A1.7ON1051055201e-69
Kwal_33.13015singletonOFF1051055201e-69
KLTH0F00528g1.7ON1041052927e-35
SAKL0C00506g1.7ON105941781e-17
KAFR0D001601.7ON111951277e-10
Kpol_2002.101.7ON111911269e-10
Skud_3.51.7ON1131061233e-09
Smik_3.161.7ON113821223e-09
NDAI0A001601.7ON1231141224e-09
YCL058W-A (ADF1)1.7ON1131071206e-09
Suva_3.1541.7ON113831154e-08
TBLA0A049501.7ON1131031112e-07
KNAG0C002401.7ON1261101095e-07
NCAS0B090901.7ON119931078e-07
ZYRO0F18436g1.7ON112941051e-06
TPHA0E039901.7ON11682954e-05
CAGL0B00374g1.7ON12170937e-05
TDEL0C069501.7ON111111893e-04
KLLA0C00528g1.7ON11676790.008
AFR743CA1.7ON10143700.13
NCAS0A142107.364ON60045710.18
TDEL0H005107.519ON128747670.79
KAFR0K02390na 1ON91076651.4
Kpol_1067.75.47ON67457613.8
TBLA0B076605.143ON78131614.2
KLLA0B03520g7.546ON140153607.1
KAFR0F017201.163ON86637597.3
KLTH0H02926g6.269ON151970598.4
Smik_10.1791.319ON71336589.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_YGOB_YCL058W-A
         (105 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON} ANN...   204   1e-69
Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig ...   204   1e-69
KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved...   117   7e-35
SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly si...    73   1e-17
KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7 YC...    54   7e-10
Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON} (19162.....    53   9e-10
Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)    52   3e-09
Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A (R...    52   3e-09
NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7 YC...    52   4e-09
YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}  ADF1Transcr...    51   6e-09
Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A...    49   4e-08
TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....    47   2e-07
KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7 YC...    47   5e-07
NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {...    46   8e-07
ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa] ...    45   1e-06
TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON...    41   4e-05
CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar t...    40   7e-05
TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {...    39   3e-04
KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no simila...    35   0.008
AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}...    32   0.13 
NCAS0A14210 Chr1 (2797110..2798912) [1803 bp, 600 aa] {ON}             32   0.18 
TDEL0H00510 Chr8 complement(75081..78944) [3864 bp, 1287 aa] {ON...    30   0.79 
KAFR0K02390 Chr11 complement(493521..496253) [2733 bp, 910 aa] {...    30   1.4  
Kpol_1067.7 s1067 complement(14038..16062) [2025 bp, 674 aa] {ON...    28   3.8  
TBLA0B07660 Chr2 (1811844..1814189) [2346 bp, 781 aa] {ON} Anc_5...    28   4.2  
KLLA0B03520g Chr2 (317409..321614) [4206 bp, 1401 aa] {ON} simil...    28   7.1  
KAFR0F01720 Chr6 complement(336855..339455) [2601 bp, 866 aa] {O...    27   7.3  
KLTH0H02926g Chr8 complement(259800..264359) [4560 bp, 1519 aa] ...    27   8.4  
Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061...    27   9.8  

>Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 105

 Score =  204 bits (520), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 105/105 (100%), Positives = 105/105 (100%)

Query: 1   MGLKGPSKKLPTSKPRGSKNVIKKHQKIRTKLKVEQANKEVFLISELNKREDTKRQSSPL 60
           MGLKGPSKKLPTSKPRGSKNVIKKHQKIRTKLKVEQANKEVFLISELNKREDTKRQSSPL
Sbjct: 1   MGLKGPSKKLPTSKPRGSKNVIKKHQKIRTKLKVEQANKEVFLISELNKREDTKRQSSPL 60

Query: 61  ESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105
           ESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL
Sbjct: 61  ESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105

>Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig
           123] FULL
          Length = 105

 Score =  204 bits (520), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 105/105 (100%), Positives = 105/105 (100%)

Query: 1   MGLKGPSKKLPTSKPRGSKNVIKKHQKIRTKLKVEQANKEVFLISELNKREDTKRQSSPL 60
           MGLKGPSKKLPTSKPRGSKNVIKKHQKIRTKLKVEQANKEVFLISELNKREDTKRQSSPL
Sbjct: 1   MGLKGPSKKLPTSKPRGSKNVIKKHQKIRTKLKVEQANKEVFLISELNKREDTKRQSSPL 60

Query: 61  ESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105
           ESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL
Sbjct: 61  ESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105

>KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score =  117 bits (292), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 64/105 (60%), Positives = 81/105 (77%), Gaps = 1/105 (0%)

Query: 1   MGLKGPSKKLPTSKPRGSKNVIKKHQKIRTKLKVEQANKEVFLISELNKREDTKRQSSPL 60
           M  KG  KK P S    SK VI+KHQKIRTKLKVEQANKE FLISELN+RE   +++  L
Sbjct: 1   MARKGSGKK-PRSTRDVSKGVIRKHQKIRTKLKVEQANKESFLISELNEREHNTKRTPAL 59

Query: 61  ESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105
           ESLK S L++D +KD++ QK++E Q+++TD N++ QLELISGFSL
Sbjct: 60  ESLKVSDLIEDREKDKSMQKKMEEQKQSTDNNIIEQLELISGFSL 104

>SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly
           similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 105

 Score = 73.2 bits (178), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/94 (48%), Positives = 64/94 (68%), Gaps = 6/94 (6%)

Query: 14  KPRGSKNVIKKHQKIRTKLKVEQANKEVFLISELNKRE--DTKRQSSPLESLKPSRLVKD 71
           KP G    IKK QK RT+++VEQ NK+ FL+S+LN      TK +  P ++L+   L +D
Sbjct: 16  KPSGG---IKKSQKKRTRIQVEQLNKQEFLLSDLNMTNAGSTKTKEKP-KTLQAKALAQD 71

Query: 72  IKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105
            KKD+  + +LE QRK T++N+L QLE+ISGFSL
Sbjct: 72  QKKDKETRDKLEKQRKDTNDNMLAQLEMISGFSL 105

>KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 111

 Score = 53.5 bits (127), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 62/95 (65%), Gaps = 3/95 (3%)

Query: 14  KPRGSKNVIKKHQKIRTKLKVEQANKEVFL-ISELNK--REDTKRQSSPLESLKPSRLVK 70
           K +  KNVI + ++ + KL VE+ N++    + ELNK  ++D +R S    +L+  +L+ 
Sbjct: 17  KIKSRKNVISQSERKKNKLIVEKFNQQTITNVQELNKDLKKDKRRLSKTKNALETKKLLH 76

Query: 71  DIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105
           D  +D   ++ +E++ K T++++L+Q+E+ISGFSL
Sbjct: 77  DQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111

>Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON}
           (19162..19497) [336 nt, 112 aa]
          Length = 111

 Score = 53.1 bits (126), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 60/91 (65%), Gaps = 4/91 (4%)

Query: 19  KNVIKKHQKIRTKLKVEQANKEVFLISEL----NKREDTKRQSSPLESLKPSRLVKDIKK 74
           KNVI + +K R K+K+E+ NKE  L S++    N+  + + + +   +L+  +L +D  K
Sbjct: 21  KNVISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQSEGNKERALESQKLQQDNVK 80

Query: 75  DQNAQKQLESQRKATDENVLRQLELISGFSL 105
           D+    ++E+ +K TD+++L+Q+EL++GFSL
Sbjct: 81  DRETIAKIEASKKETDDSMLKQIELMTGFSL 111

>Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)
          Length = 113

 Score = 52.0 bits (123), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 64/106 (60%), Gaps = 13/106 (12%)

Query: 5   GPSKKLPTSKPRGSKNVIKKHQKIRTKLKVEQANK--EVF---LISELNKREDTKRQSSP 59
           G  KK+   +P      I   ++ RTKL+VE+ NK  E+    L+ E   +E TK+++  
Sbjct: 16  GVGKKVQKKRP------ISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQEPTKKRAKS 69

Query: 60  LESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105
             +LK   LVKD  KD   ++Q+++++  T++++L Q+E+ISGFSL
Sbjct: 70  --TLKAEELVKDQAKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113

>Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 51.6 bits (122), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 54/82 (65%), Gaps = 7/82 (8%)

Query: 29  RTKLKVEQANK--EVF---LISELNKREDTKRQSSPLESLKPSRLVKDIKKDQNAQKQLE 83
           RTKL+VE+ NK  E+    L+ E   +E  KR++    +LK   L+KD +KD   ++ ++
Sbjct: 34  RTKLQVEKLNKSSEMMIPTLLRETGAQEPAKRKTES--TLKAGDLIKDQEKDSKVREHIQ 91

Query: 84  SQRKATDENVLRQLELISGFSL 105
            ++  T++N+L+Q+E+ISGFSL
Sbjct: 92  MEKSKTNDNMLKQIEMISGFSL 113

>NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 123

 Score = 51.6 bits (122), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 66/114 (57%), Gaps = 21/114 (18%)

Query: 8   KKLPTS----KPRGS---KNVIKKHQKIRTKLKVEQANKEVFL---ISELN--------K 49
           ++LPT     KP+      NVIK+  + + K+KV   NKE  L   +SELN        +
Sbjct: 11  RRLPTGRKIRKPKNHTNKNNVIKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQ 70

Query: 50  REDTKRQSSPLESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGF 103
           ++D+ R+ S   SL    L+ D KKD  A  ++++++K  ++++LRQ+E+ISGF
Sbjct: 71  KQDSLRKGS---SLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGF 121

>YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}
           ADF1Transcriptional repressor encoded by the antisense
           strand of the FYV5 gene; negatively regulates
           transcription of FYV5 by binding to the promoter on the
           sense strand
          Length = 113

 Score = 50.8 bits (120), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 65/107 (60%), Gaps = 7/107 (6%)

Query: 4   KGPSKKLPTSKPRGSKNVIKKHQKIRTKLKVEQANK--EVFLISELNKREDTKRQSSPLE 61
           KG  K +   K    K  I   ++ RTKL+VE+ NK  E  + + L  RE + ++ + L+
Sbjct: 9   KGVGKNVGVGKKVQKKRSISTAERKRTKLQVEKLNKSSETMIPTLL--REASTQEPAKLK 66

Query: 62  ---SLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105
              +LK   L+KD +KD   ++Q+ +++  T++++L+Q+E+ISGFSL
Sbjct: 67  AETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113

>Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 48.9 bits (115), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 54/83 (65%), Gaps = 9/83 (10%)

Query: 29  RTKLKVEQANKEV-----FLISELNKRE-DTKRQSSPLESLKPSRLVKDIKKDQNAQKQL 82
           RTKL+VE+ NK        L+ E +K++ D K+  S LE+     LVKD  +D   ++ +
Sbjct: 34  RTKLQVERLNKSSETMIPTLLKEASKQDLDKKKTRSTLEA---EELVKDQARDSKVREHI 90

Query: 83  ESQRKATDENVLRQLELISGFSL 105
           E+++  T++++L+Q+E+ISGFSL
Sbjct: 91  ETEKSKTNDSMLKQIEMISGFSL 113

>TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 113

 Score = 47.4 bits (111), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 63/103 (61%), Gaps = 5/103 (4%)

Query: 4   KGPSKKLPTSKPRGSKNVIKKHQKIRTKLKVEQANKEVFLISEL-NKREDTKRQSSPLES 62
           K PS+KL   K     N I    K R KL+VE+ NK+  L+S++ N    +K  +  + +
Sbjct: 15  KTPSRKLGKVKA----NKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKELAKNVNT 70

Query: 63  LKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105
           L   +L KD +KD+    ++++++K T+++++ Q+E+ISGFSL
Sbjct: 71  LSSKQLKKDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113

>KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 126

 Score = 46.6 bits (109), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 61/110 (55%), Gaps = 11/110 (10%)

Query: 7   SKKLPTSKPRGSKNVIKKHQKIRTKLKVEQANKEVFLISELNK---REDTKRQSSPLE-- 61
           +K++   K RGS   I   ++ R KL+VE+ N+    + E N    R +  + +  +E  
Sbjct: 17  TKRVQKHKKRGSPKTIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQ 76

Query: 62  ------SLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105
                 SL   +L +D  KD+  Q+Q+  ++K TD+++L Q+E+ISGFSL
Sbjct: 77  NRTVHRSLDVEKLAQDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126

>NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 119

 Score = 45.8 bits (107), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 62/93 (66%), Gaps = 5/93 (5%)

Query: 18  SKNVIKKHQKIRTKLKVEQANKEVFL----ISELNKREDTKRQSSPLESLKPSR-LVKDI 72
           +KN I    + + K +VE+ NK+  L    + +L K+++  ++  PL+S+  +R L++D 
Sbjct: 27  NKNSISFSDRKKAKHQVEKLNKKENLLPMNVLDLQKKKNLSKKPEPLKSILHARSLLQDQ 86

Query: 73  KKDQNAQKQLESQRKATDENVLRQLELISGFSL 105
           KKD+  + ++ +++KATD+++ +Q+E+ISGF+ 
Sbjct: 87  KKDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119

>ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa]
           {ON} similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 112

 Score = 45.1 bits (105), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (59%), Gaps = 5/94 (5%)

Query: 14  KPRGSKNVIKKHQKIRTKLKVEQANKEVFLISELNK--REDTKRQSSPLESLKPSRLVKD 71
           KP+ S   I    K RTK KVE+ + +  L SE+ K  R  + + S+   SL    L +D
Sbjct: 22  KPKKS---ISHSDKKRTKSKVEKLDAKGLLPSEIFKLNRSASSKTSNGSSSLLARNLEQD 78

Query: 72  IKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105
            K DQ+ + +  +++K TD N+L+Q+E+ISGFSL
Sbjct: 79  RKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112

>TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 116

 Score = 41.2 bits (95), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 52/82 (63%), Gaps = 9/82 (10%)

Query: 30  TKLKVEQANK-EVFL---ISELNKREDTKR--QSSPLESLKPSRLVKDIKKDQNAQKQLE 83
           TK KVE+ NK EV     I+ LN     KR  Q+S LE+     L KD  KD+   +++E
Sbjct: 38  TKHKVEKLNKLEVISSDDINALNALNGKKREKQTSVLEA---KTLAKDNLKDRQLIEKIE 94

Query: 84  SQRKATDENVLRQLELISGFSL 105
           S++K T+ ++L+Q+E++SGFSL
Sbjct: 95  SKKKETNASLLQQIEMMSGFSL 116

>CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar to
           CA0039|IPF3998 Candida albicans and KLLA0C00528g
           Kluyveromyces lactis
          Length = 121

 Score = 40.4 bits (93), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 8/70 (11%)

Query: 40  EVFLISELN----KREDTKRQSSPLESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLR 95
           E+ +I ELN      E  KRQ++    L  + LVKD K+D+  ++ +E     T+ ++L+
Sbjct: 56  ELKIIQELNDNKIAEEPKKRQTA----LDMNCLVKDQKRDKKVREHIEKINSETNSDMLK 111

Query: 96  QLELISGFSL 105
           QLEL+SGFSL
Sbjct: 112 QLELMSGFSL 121

>TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 111

 Score = 38.9 bits (89), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 56/111 (50%), Gaps = 6/111 (5%)

Query: 1   MGLKGPSKKLPTSKPRGSKNV---IKKHQKIRTKLKVEQANKEVFLISE---LNKREDTK 54
           M +K   KK      +  KN    I +    +TK +VE  N++   +SE   LN     K
Sbjct: 1   MAVKNNFKKTGKGVQKNQKNCKKAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVK 60

Query: 55  RQSSPLESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105
             +    +L+   L KD +KDQ  +++ +++++    N+ +Q+E ISGFSL
Sbjct: 61  GSARKANTLENRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111

>KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no
           similarity
          Length = 116

 Score = 35.0 bits (79), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 46/76 (60%), Gaps = 5/76 (6%)

Query: 32  LKVEQANKEVFLISEL--NKREDTKRQSSPLESLKPSRLVKDIKKDQNAQKQLESQRKAT 89
           ++V Q +K    I+++  NK +   R S+ LE  K   + +  K+D+   K+ + ++KAT
Sbjct: 44  MQVRQLDKLDLSIADIVPNKAQKKPRSSASLEGQK---VREHYKEDKEVVKKHDKEKKAT 100

Query: 90  DENVLRQLELISGFSL 105
           ++ +  QLELISGFSL
Sbjct: 101 EKKIEDQLELISGFSL 116

>AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL058W-A
          Length = 101

 Score = 31.6 bits (70), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 28/43 (65%)

Query: 63  LKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105
           L+ + L +D + D  AQ+Q   +R   D+ V++QLE I+GFSL
Sbjct: 59  LQAASLAQDQRSDAQAQQQRAQERSNVDKKVVQQLEAIAGFSL 101

>NCAS0A14210 Chr1 (2797110..2798912) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score = 32.0 bits (71), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 48  NKREDTKRQSSPLESLKPSRLVKDIKKDQNAQKQLESQRKATDEN 92
           N  E+  R ++PL+SL+P   ++D +K Q   KQL+S      EN
Sbjct: 93  NAIENEARSTAPLDSLQPPNYIQDEEKIQAVLKQLQSVLGNNPEN 137

>TDEL0H00510 Chr8 complement(75081..78944) [3864 bp, 1287 aa] {ON}
            Anc_7.519 YPR164W
          Length = 1287

 Score = 30.4 bits (67), Expect = 0.79,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 48   NKREDTKRQSSPLESLKPSRLVKDIKKDQNAQKQLESQRKATDENVL 94
            ++ ED+K  S P  ++K  + VKDIK D+ A+K       ATD++V+
Sbjct: 1197 DQPEDSKSSSQPYRTIKLDKGVKDIKYDRVAEKLYV---LATDDSVI 1240

>KAFR0K02390 Chr11 complement(493521..496253) [2733 bp, 910 aa] {ON}
           
          Length = 910

 Score = 29.6 bits (65), Expect = 1.4,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 1/76 (1%)

Query: 20  NVIKKHQKIRTKLKVEQANKEVFLISELNKREDTK-RQSSPLESLKPSRLVKDIKKDQNA 78
           N+ K+  +   K + EQA KE   + E   +E+ K  Q  P E ++    VK+   DQ A
Sbjct: 825 NLHKEENQEAHKQEQEQAPKEDRKVEEQVPKEEVKVEQQVPSEEMQVEEQVKEQLIDQQA 884

Query: 79  QKQLESQRKATDENVL 94
           + + + +    DE  +
Sbjct: 885 ENRSQQEEVQNDEQAV 900

>Kpol_1067.7 s1067 complement(14038..16062) [2025 bp, 674 aa] {ON}
           complement(14038..16062) [2025 nt, 675 aa]
          Length = 674

 Score = 28.1 bits (61), Expect = 3.8,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 36  QANKEVFLISELNKREDTKRQSSPLESLKPSRLVKDIKKDQNAQKQLESQRKATDEN 92
           ++ +  +LIS++  R+    + S L S  PSR+  D+ +D N   +L  +  ATD N
Sbjct: 377 ESTETSYLISKIYGRQ---LKGSNLISNHPSRVCADVSEDWNILIELNGEYFATDNN 430

>TBLA0B07660 Chr2 (1811844..1814189) [2346 bp, 781 aa] {ON}
           Anc_5.143 YGR197C
          Length = 781

 Score = 28.1 bits (61), Expect = 4.2,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 21/31 (67%)

Query: 45  SELNKREDTKRQSSPLESLKPSRLVKDIKKD 75
           S  N  E++ R++  + SL+P + +K++KKD
Sbjct: 748 SSHNTSENSLRKTKSVHSLRPIKSIKNLKKD 778

>KLLA0B03520g Chr2 (317409..321614) [4206 bp, 1401 aa] {ON} similar to
            uniprot|P17883 Saccharomyces cerevisiae YPR189W SKI3
            dsRNA virus protection family member contains 8 copies of
            the tetratricopeptide (TPR) domain
          Length = 1401

 Score = 27.7 bits (60), Expect = 7.1,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 6/53 (11%)

Query: 42   FLISELNKREDTKRQSSPLESLKPSRLVKDIKKD-----QNAQKQLESQRKAT 89
            F I E N+ E+    +  L++  PS L+KD  KD     Q   K+LE ++  T
Sbjct: 1275 FFILE-NRPEELAELAKQLKTFSPSVLIKDTHKDISFLLQEIDKRLEKKKDIT 1326

>KAFR0F01720 Chr6 complement(336855..339455) [2601 bp, 866 aa] {ON}
           Anc_1.163 YJL176C
          Length = 866

 Score = 27.3 bits (59), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 19/37 (51%)

Query: 38  NKEVFLISELNKREDTKRQSSPLESLKPSRLVKDIKK 74
           N E  L SE + R D  R   P ES KPS  + D+ K
Sbjct: 434 NIEPPLTSEFSTRHDAPRGIFPFESYKPSVQLPDMAK 470

>KLTH0H02926g Chr8 complement(259800..264359) [4560 bp, 1519 aa] {ON}
            similar to uniprot|Q12280 Saccharomyces cerevisiae
            YPL242C IQG1 Essential protein required for determination
            of budding pattern promotes localization of axial markers
            Bud4p and Cdc12p
          Length = 1519

 Score = 27.3 bits (59), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 32   LKVEQANKEVFLISELNKREDTKRQSSPLESLKPSRLVKDIKKDQNAQKQLESQRKATDE 91
             K+  ++ EV+ +   ++R+  K + S  +S   S+LV  + KD+ A+ +L S  K  + 
Sbjct: 1445 FKISTSDGEVYAVEMNDERKGDKTKRSGTDSFAFSKLVDTLAKDKAAKLELFS--KKVEF 1502

Query: 92   NVLRQLELIS 101
            NV   L L++
Sbjct: 1503 NVPNLLNLVA 1512

>Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061W
           (REAL)
          Length = 713

 Score = 26.9 bits (58), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 69  VKDIKKDQNAQKQLESQRKATDENVLRQLELISGFS 104
            K I KD + +K+ E+Q K  D  ++RQ +L+  FS
Sbjct: 568 CKIISKDVDLRKKFEAQNKKWDAQIIRQSKLMERFS 603

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.126    0.322 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,487,871
Number of extensions: 395074
Number of successful extensions: 3086
Number of sequences better than 10.0: 249
Number of HSP's gapped: 3054
Number of HSP's successfully gapped: 280
Length of query: 105
Length of database: 53,481,399
Length adjustment: 75
Effective length of query: 30
Effective length of database: 44,881,449
Effective search space: 1346443470
Effective search space used: 1346443470
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 59 (27.3 bits)