Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_YGOB_matalpha21.121ON110965002e-66
Kwal_33.12995singletonOFF110965002e-66
Kwal_YGOB_HMalpha21.2ON110965002e-66
Kwal_33.matalpha2singletonOFF110965002e-66
KLTH0F00396g1.2ON108681485e-13
ZYRO0F15818g1.121ON225741414e-11
ZYRO0F18568g1.2ON225741414e-11
KLLA0C00374g1.2ON223781371e-10
TBLA0A076001.2ON230541186e-08
Suva_3.135singletonON119451146e-08
Suva_3.74singletonON119451146e-08
Suva_3.751.121ON119451146e-08
YCR096C (HMRA2)singletonOFF119451146e-08
Kpol_2002.31.2ON223811187e-08
NDAI0A001101.2ON211451178e-08
TBLA0A070501.121ON261541181e-07
TDEL0C070001.2ON237541171e-07
KNAG0C001601.2ON203541161e-07
Suva_3.1471.2ON210451152e-07
Skud_3.1181.121ON210451152e-07
YCR039C (MATALPHA2)1.121ON210451152e-07
YCL067C (HMLALPHA2)1.2ON210451152e-07
Skud_102.1singletonON185451152e-07
Smik_95.1singletonON185451152e-07
Smik_3.1421.121ON228451152e-07
TPHA0E040701.2ON231461152e-07
TPHA0E036101.121ON231461152e-07
KAFR0D007201.121ON206451124e-07
NCAS0B091401.2ON205451124e-07
CAGL0B00264g1.2ON210451091e-06
CAGL0B01265g1.121ON186451081e-06
Ecym_11151.121ON230491082e-06
Ecym_10021.2ON230491082e-06
Kpol_1043.242.337ON52746800.016
YGL096W (TOS8)6.170ON27643730.098
NCAS0A15350na 1ON10333690.17
NCAS0B085601.122ON10333690.17
TPHA0C036202.337ON54840700.31
Skud_7.1816.170ON27459680.47
CAGL0H02959g6.170ON25943680.48
NDAI0B032902.337ON59547680.55
NCAS0D035706.170ON25745670.62
Suva_7.1726.170ON27061670.73
AFL202C2.337ON48170670.80
KLLA0B10450g6.170ON38953670.81
KLLA0D10043g2.337ON48846670.81
Kwal_27.110926.170ON22980651.1
KNAG0M005006.170ON29859651.2
TBLA0B070702.337ON64546661.2
KAFR0A043706.170ON40961651.3
CAGL0E00341gna 1ON13033641.4
Kpol_1036.566.170ON26558641.5
TPHA0B025806.170ON26471641.5
KAFR0G001801.122ON13137631.8
Smik_7.1816.170ON27443641.9
ZYRO0D13596g5.567ON44946642.0
ZYRO0A07194g2.337ON49738642.2
Ecym_33782.337ON49146632.3
TDEL0F018106.170ON25663622.8
NDAI0A006701.122ON9545603.0
NDAI0H00100na 1ON9545603.0
KNAG0C01625na 1ON14033613.3
SAKL0E06402g2.337ON49146623.4
NDAI0I013206.170ON40959623.5
Smik_4.7285.567ON34625623.5
TPHA0F005004.74ON47728623.6
Kpol_2002.481.122ON9076593.7
Kpol_408.2singletonON9076593.7
Kpol_1058.2na 1ON9076593.7
YDR451C (YHP1)5.567ON35325623.7
Skud_4.7275.567ON34825623.8
Suva_2.6265.567ON35735624.0
TDEL0A043205.567ON33025614.1
KNAG0C007951.122ON10747604.1
KNAG0B034605.567ON44935614.3
YPL177C (CUP9)6.170ON30670614.7
CAGL0L07436g2.337ON51546615.5
Skud_16.1036.170ON29555606.1
CAGL0C01551g6.170ON22153606.5
Suva_16.1326.170ON29255597.2
TDEL0G026802.337ON51137607.4
AFL049C6.170ON25743598.0
TBLA0C037406.170ON29355598.3
KLTH0F09636g2.337ON48425599.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_YGOB_HMalpha2
         (110 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON} (...   197   2e-66
Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C ...   197   2e-66
Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON} ANNO...   197   2e-66
Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF} (m...   197   2e-66
KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {...    62   5e-13
ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa] ...    59   4e-11
ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa] ...    59   4e-11
KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON} uniprot|Q...    57   1e-10
TBLA0A07600 Chr1 (1882710..1882771,1882865..1882958,1883018..188...    50   6e-08
Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}...    49   6e-08
Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...    49   6e-08
Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...    49   6e-08
YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}  ...    49   6e-08
Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353...    50   7e-08
NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  sil...    50   8e-08
TBLA0A07050 Chr1 (1728941..1729002,1729096..1729189,1729249..172...    50   1e-07
TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {...    50   1e-07
KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2 YC...    49   1e-07
Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}...    49   2e-07
Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}...    49   2e-07
YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}  M...    49   2e-07
YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}  HML...    49   2e-07
Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)        49   2e-07
Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)          49   2e-07
Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}...    49   2e-07
TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 ...    49   2e-07
TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 ...    49   2e-07
KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating ...    48   4e-07
NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {...    48   4e-07
CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly si...    47   1e-06
CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar...    46   1e-06
Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa] ...    46   2e-06
Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa...    46   2e-06
Kpol_1043.24 s1043 (47321..48904) [1584 bp, 527 aa] {ON} (47321....    35   0.016
YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}  TOS8Homeodo...    33   0.098
NCAS0A15350 Chr1 (3019029..3019088,3019146..3019367,3019420..301...    31   0.17 
NCAS0B08560 Chr2 (1643716..1643775,1643833..1644054,1644107..164...    31   0.17 
TPHA0C03620 Chr3 complement(785783..787429) [1647 bp, 548 aa] {O...    32   0.31 
Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W (...    31   0.47 
CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some si...    31   0.48 
NDAI0B03290 Chr2 (841165..842952) [1788 bp, 595 aa] {ON} Anc_2.3...    31   0.55 
NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.17...    30   0.62 
Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W (...    30   0.73 
AFL202C Chr6 complement(56150..57595) [1446 bp, 481 aa] {ON} Syn...    30   0.80 
KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some s...    30   0.81 
KLLA0D10043g Chr4 (849549..851015) [1467 bp, 488 aa] {ON} simila...    30   0.81 
Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C...    30   1.1  
KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}...    30   1.2  
TBLA0B07070 Chr2 complement(1677335..1679272) [1938 bp, 645 aa] ...    30   1.2  
KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {O...    30   1.3  
CAGL0E00341g Chr5 (29668..29775,29840..30076,30143..30190) [393 ...    29   1.4  
Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON} (15399...    29   1.5  
TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.17...    29   1.5  
KAFR0G00180 Chr7 complement(60883..61254,61328..61351) [396 bp, ...    29   1.8  
Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W (...    29   1.9  
ZYRO0D13596g Chr4 complement(1138485..1139834) [1350 bp, 449 aa]...    29   2.0  
ZYRO0A07194g Chr1 complement(587457..588950) [1494 bp, 497 aa] {...    29   2.2  
Ecym_3378 Chr3 complement(718342..719817) [1476 bp, 491 aa] {ON}...    29   2.3  
TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON...    28   2.8  
NDAI0A00670 Chr1 complement(124998..125033,125093..125308,125369...    28   3.0  
NDAI0H00100 Chr8 complement(758..793,853..1068,1129..1164) [288 ...    28   3.0  
KNAG0C01625 Chr3 complement(322219..322248,322306..322698) [423 ...    28   3.3  
SAKL0E06402g Chr5 (521232..522707) [1476 bp, 491 aa] {ON} simila...    28   3.4  
NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {O...    28   3.5  
Smik_4.728 Chr4 complement(1282412..1283452) [1041 bp, 346 aa] {...    28   3.5  
TPHA0F00500 Chr6 complement(119121..120554) [1434 bp, 477 aa] {O...    28   3.6  
Kpol_2002.48 s2002 complement(103569..103598,103652..103813,1038...    27   3.7  
Kpol_408.2 s408 complement(1157..1186,1240..1401,1457..1537) [27...    27   3.7  
Kpol_1058.2 s1058 (4720..4800,4856..5017,5071..5100) [273 bp, 90...    27   3.7  
YDR451C Chr4 complement(1361120..1362181) [1062 bp, 353 aa] {ON}...    28   3.7  
Skud_4.727 Chr4 complement(1281176..1282222) [1047 bp, 348 aa] {...    28   3.8  
Suva_2.626 Chr2 complement(1112880..1113953) [1074 bp, 357 aa] {...    28   4.0  
TDEL0A04320 Chr1 complement(765442..766434) [993 bp, 330 aa] {ON...    28   4.1  
KNAG0C00795 Chr3 complement(141421..141450,141508..141732,141810...    28   4.1  
KNAG0B03460 Chr2 (669607..670956) [1350 bp, 449 aa] {ON} Anc_5.5...    28   4.3  
YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}  ...    28   4.7  
CAGL0L07436g Chr12 (820507..822054) [1548 bp, 515 aa] {ON} simil...    28   5.5  
Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {O...    28   6.1  
CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {O...    28   6.5  
Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {O...    27   7.2  
TDEL0G02680 Chr7 complement(512112..513647) [1536 bp, 511 aa] {O...    28   7.4  
AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON} Sy...    27   8.0  
TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON...    27   8.3  
KLTH0F09636g Chr6 complement(834845..836299) [1455 bp, 484 aa] {...    27   9.9  

>Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON}
          (matalpha2) - mating type alpha2 protein [contig MAT]
          FULL
          Length = 110

 Score =  197 bits (500), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%)

Query: 1  MGRQLVSEMLFLADAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYL 60
          MGRQLVSEMLFLADAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYL
Sbjct: 1  MGRQLVSEMLFLADAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYL 60

Query: 61 TRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPID 96
          TRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPID
Sbjct: 61 TRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPID 96

>Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C
          (HMRA2) - Regulatory protein MATa2p (no known
          function); sequence is the same as the last 119
          residues of MATalpha2p [contig 123] FULL
          Length = 110

 Score =  197 bits (500), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%)

Query: 1  MGRQLVSEMLFLADAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYL 60
          MGRQLVSEMLFLADAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYL
Sbjct: 1  MGRQLVSEMLFLADAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYL 60

Query: 61 TRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPID 96
          TRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPID
Sbjct: 61 TRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPID 96

>Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON}
          ANNOTATED BY YGOB - This is Kwal_33.12995
          Length = 110

 Score =  197 bits (500), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%)

Query: 1  MGRQLVSEMLFLADAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYL 60
          MGRQLVSEMLFLADAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYL
Sbjct: 1  MGRQLVSEMLFLADAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYL 60

Query: 61 TRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPID 96
          TRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPID
Sbjct: 61 TRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPID 96

>Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF}
          (matalpha2) - mating type alpha2 protein [contig MAT]
          FULL
          Length = 110

 Score =  197 bits (500), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%)

Query: 1  MGRQLVSEMLFLADAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYL 60
          MGRQLVSEMLFLADAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYL
Sbjct: 1  MGRQLVSEMLFLADAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYL 60

Query: 61 TRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPID 96
          TRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPID
Sbjct: 61 TRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPID 96

>KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa]
          {ON} conserved hypothetical protein
          Length = 108

 Score = 61.6 bits (148), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 42/68 (61%), Gaps = 2/68 (2%)

Query: 29 AARGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRR 88
           A G Q+  K+       LE WF  N  +PY  + QI  LS+ TNLS KQI+NWMSNRRR
Sbjct: 34 VASGKQR--KFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRR 91

Query: 89 KSKKNPID 96
          KS+K  ID
Sbjct: 92 KSRKESID 99

>ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score = 58.9 bits (141), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 45/74 (60%), Gaps = 2/74 (2%)

Query: 20  ILSFKFLNSAARGNQ--KVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSK 77
           I++   LNSA R N+  +  + P +I+  LE+WF+ N  HPYL    +  L   T LS  
Sbjct: 128 IVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGP 187

Query: 78  QIRNWMSNRRRKSK 91
           QI+NW+SNRRRK K
Sbjct: 188 QIKNWVSNRRRKEK 201

>ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score = 58.9 bits (141), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 45/74 (60%), Gaps = 2/74 (2%)

Query: 20  ILSFKFLNSAARGNQ--KVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSK 77
           I++   LNSA R N+  +  + P +I+  LE+WF+ N  HPYL    +  L   T LS  
Sbjct: 128 IVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGP 187

Query: 78  QIRNWMSNRRRKSK 91
           QI+NW+SNRRRK K
Sbjct: 188 QIKNWVSNRRRKEK 201

>KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON}
           uniprot|Q9HDS5 Kluyveromyces lactis HMLALPHA2 Mating-
           type protein ALPHA2
          Length = 223

 Score = 57.4 bits (137), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 48/78 (61%)

Query: 14  DAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTN 73
           +++  KIL+   ++S     +K  ++P +    LENW+ +N  +PYL    ++ +S+ T 
Sbjct: 133 ESVNIKILTQDLMHSNNNEFKKGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTT 192

Query: 74  LSSKQIRNWMSNRRRKSK 91
           L+  QI+NW++NRRRK K
Sbjct: 193 LTKTQIKNWLANRRRKDK 210

>TBLA0A07600 Chr1
           (1882710..1882771,1882865..1882958,1883018..1883554)
           [693 bp, 230 aa] {ON} Anc_1.2 YCL067C silenced copy of
           alpha2 gene at HML locus
          Length = 230

 Score = 50.1 bits (118), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 38  KYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           + P +  + LE WF  N SHPYL    +  L+ +++LS  Q++NW+SNRRRK +
Sbjct: 173 RLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226

>Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}
          YCR096C (REAL)
          Length = 119

 Score = 48.5 bits (114), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (68%)

Query: 47 LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
          LE+WF  N  +PYL  K +  L + T+LS  QI+NW+SNRRRK K
Sbjct: 53 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 97

>Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
          YCR039C (REAL)
          Length = 119

 Score = 48.5 bits (114), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (68%)

Query: 47 LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
          LE+WF  N  +PYL  K +  L + T+LS  QI+NW+SNRRRK K
Sbjct: 53 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 97

>Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
          YCL067C (REAL)
          Length = 119

 Score = 48.5 bits (114), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (68%)

Query: 47 LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
          LE+WF  N  +PYL  K +  L + T+LS  QI+NW+SNRRRK K
Sbjct: 53 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 97

>YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}
          HMRA2Silenced copy of a2 at HMR; similarity to Alpha2p;
          required along with a1p for inhibiting expression of
          the HO endonuclease in a/alpha HO/HO diploid cells with
          an active mating-type interconversion system
          Length = 119

 Score = 48.5 bits (114), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (68%)

Query: 47 LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
          LE+WF  N  +PYL  K +  L + T+LS  QI+NW+SNRRRK K
Sbjct: 53 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 97

>Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353)
           [672 nt, 224 aa]
          Length = 223

 Score = 50.1 bits (118), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 3/81 (3%)

Query: 11  FLADAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSE 70
           F+ + + + +++ K +N  +    ++ K   N+ + LE W+  N  +PYL  K IS L +
Sbjct: 126 FVFNIVTQDMMNKKKMNIKSYRGHRLPK--QNVKL-LERWYIQNVENPYLDDKSISELMK 182

Query: 71  RTNLSSKQIRNWMSNRRRKSK 91
            T+LS  QI+NW+SNRRRK K
Sbjct: 183 ITSLSKVQIKNWVSNRRRKEK 203

>NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  silent
           copy of MATalpha2 gene at HMLalpha
          Length = 211

 Score = 49.7 bits (117), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (66%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           LE+W+  +   PYL  K + +L E T LS  QI+NW+SNRRRK K
Sbjct: 149 LEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKEK 193

>TBLA0A07050 Chr1
           (1728941..1729002,1729096..1729189,1729249..1729878)
           [786 bp, 261 aa] {ON}  MATalpha2 gene at MAT locus
          Length = 261

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 38  KYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           + P +  + LE WF  N SHPYL    +  L+ +++LS  Q++NW+SNRRRK +
Sbjct: 173 RLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226

>TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {ON}
           Anc_1.122 YCR039C silenced copy of alpha2 gene at T.
           delbrueckii HML locus
          Length = 237

 Score = 49.7 bits (117), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%)

Query: 38  KYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           + P      LE WF+ N S PYL ++ +  L   T+LS  QI+NW+SNRRRK K
Sbjct: 160 RLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213

>KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2
           YCL067C silent copy of mating type alpha2 gene at HML
           locus
          Length = 203

 Score = 49.3 bits (116), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 34/54 (62%)

Query: 38  KYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           ++  N +  LE+W+  +   PYL ++ +  L  +T LS  QIRNW+SNRRRK K
Sbjct: 136 RFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKEK 189

>Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}
           (REAL)
          Length = 210

 Score = 48.9 bits (115), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (68%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           LE+WF  N  +PYL  K +  L + T+LS  QI+NW+SNRRRK K
Sbjct: 144 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188

>Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}
           YCR039C (REAL)
          Length = 210

 Score = 48.9 bits (115), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (68%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           LE+WF  N  +PYL  K +  L + T+LS  QI+NW+SNRRRK K
Sbjct: 144 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188

>YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}
           MATALPHA2Homeobox-domain protein that, with Mcm1p,
           represses a-specific genes in haploids; acts with A1p to
           repress transcription of haploid-specific genes in
           diploids; one of two genes encoded by the MATalpha
           mating type cassette
          Length = 210

 Score = 48.9 bits (115), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (68%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           LE+WF  N  +PYL  K +  L + T+LS  QI+NW+SNRRRK K
Sbjct: 144 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188

>YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}
           HMLALPHA2Silenced copy of ALPHA2 at HML; homeobox-domain
           protein that associates with Mcm1p in haploid cells to
           repress a-specific gene expression and interacts with
           a1p in diploid cells to repress haploid-specific gene
           expression
          Length = 210

 Score = 48.9 bits (115), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (68%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           LE+WF  N  +PYL  K +  L + T+LS  QI+NW+SNRRRK K
Sbjct: 144 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188

>Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score = 48.9 bits (115), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (68%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           LE+WF  N  +PYL  K +  L + T+LS  QI+NW+SNRRRK K
Sbjct: 119 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 163

>Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score = 48.9 bits (115), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (68%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           LE+WF  N  +PYL  K +  L + T+LS  QI+NW+SNRRRK K
Sbjct: 119 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 163

>Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}
           YCL067C (REAL)
          Length = 228

 Score = 48.9 bits (115), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (68%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           LE+WF  N  +PYL  K +  L + T+LS  QI+NW+SNRRRK K
Sbjct: 162 LESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 206

>TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 bp,
           231 aa] {ON}   silenced copy of alpha2 at HMLalpha locus
          Length = 231

 Score = 48.9 bits (115), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 32/46 (69%)

Query: 46  HLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           +LE+W+  +  +PYL    I LL  +T+LS  Q++NW+SNRRRK K
Sbjct: 166 YLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEK 211

>TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 bp,
           231 aa] {ON} Anc_1.122 YCR039C MATalpha2 gene at MAT
           locus
          Length = 231

 Score = 48.9 bits (115), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 32/46 (69%)

Query: 46  HLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           +LE+W+  +  +PYL    I LL  +T+LS  Q++NW+SNRRRK K
Sbjct: 166 YLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEK 211

>KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating
           type gene MATalpha2
          Length = 206

 Score = 47.8 bits (112), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 28/45 (62%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           LE W+  +   PYL R+    L  +T LS  QI+NW+SNRRRK K
Sbjct: 146 LERWYTAHIDRPYLNRQSTEYLISKTGLSRVQIKNWVSNRRRKEK 190

>NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {ON}
           Anc_1.2
          Length = 205

 Score = 47.8 bits (112), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 32/45 (71%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           LE+W+  +  +PYL +  + +L + T+LS  QI+NW+SNRRRK K
Sbjct: 145 LEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKEK 189

>CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly
           similar to uniprot|P01367 Saccharomyces cerevisiae
           YCR039c or uniprot|P01367 Saccharomyces cerevisiae
           YCL067c HMLALP 2 mating type regulatory protein
          Length = 210

 Score = 46.6 bits (109), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 30/45 (66%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           LE W+  +  +PYL       L+++TNLS  QI+NW++NRRRK K
Sbjct: 123 LETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQK 167

>CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar to
           uniprot|P01367 Saccharomyces cerevisiae YCR039c or
           uniprot|P01367 Saccharomyces cerevisiae YCL067c HMLALP2
           mating type regulatory protein
          Length = 186

 Score = 46.2 bits (108), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 30/45 (66%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           LE W+  +  +PYL       L+++TNLS  QI+NW++NRRRK K
Sbjct: 123 LETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQK 167

>Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa]
           {ON} similar to YCL067C HMLALPHA2, 1-intron
          Length = 230

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPI 95
           LE+W+  N  +PYL    I +L   T  S  Q++NW++N+RRK K + I
Sbjct: 172 LESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTI 220

>Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa]
           {ON} similar to Saccharomyces cerevisiae YCL067C
           HMLALPHA2; 1-intron
          Length = 230

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPI 95
           LE+W+  N  +PYL    I +L   T  S  Q++NW++N+RRK K + I
Sbjct: 172 LESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTI 220

>Kpol_1043.24 s1043 (47321..48904) [1584 bp, 527 aa] {ON}
           (47321..48904) [1584 nt, 528 aa]
          Length = 527

 Score = 35.4 bits (80), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 29/46 (63%), Gaps = 3/46 (6%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKK 92
           L++ F+LN   P  T K+  +LSE T LS K++R W  NRR K +K
Sbjct: 136 LKSEFNLN---PNPTSKRRKVLSELTGLSEKKVRIWFQNRRAKVRK 178

>YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}
           TOS8Homeodomain-containing protein and putative
           transcription factor found associated with chromatin;
           target of SBF transcription factor; induced during
           meiosis and under cell-damaging conditions; similar to
           Cup9p transcription factor
          Length = 276

 Score = 32.7 bits (73), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRK 89
           L  W H + ++PY T ++   L  +T L+  QI NW  N RR+
Sbjct: 209 LNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRR 251

>NCAS0A15350 Chr1
           (3019029..3019088,3019146..3019367,3019420..3019449)
           [312 bp, 103 aa] {ON} 
          Length = 103

 Score = 31.2 bits (69), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 23/33 (69%)

Query: 59  YLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           +L +K+ + ++E+  LS +Q+R W  N+R +SK
Sbjct: 71  WLNKKERAFVAEKCGLSPRQVRVWFINKRTRSK 103

>NCAS0B08560 Chr2
           (1643716..1643775,1643833..1644054,1644107..1644136)
           [312 bp, 103 aa] {ON}  YCR097W
          Length = 103

 Score = 31.2 bits (69), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 23/33 (69%)

Query: 59  YLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           +L +K+ + ++E+  LS +Q+R W  N+R +SK
Sbjct: 71  WLNKKERAFVAEKCGLSPRQVRVWFINKRTRSK 103

>TPHA0C03620 Chr3 complement(785783..787429) [1647 bp, 548 aa]
          {ON} Anc_2.337 YDL106C
          Length = 548

 Score = 31.6 bits (70), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 2/40 (5%)

Query: 53 LNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKK 92
          L +++P   R+++  LSE T LS K+IR W  NRR K +K
Sbjct: 58 LKNTNPSSKRRKV--LSEVTGLSEKKIRIWFQNRRAKMRK 95

>Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 30.8 bits (68), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%)

Query: 31  RGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRK 89
           +G+ K S  P      L  W   +  +PY T ++   L  +T L+  QI NW  N RR+
Sbjct: 191 KGHGKRSNLPKATVCILNQWLLEHIHNPYPTVQEKRDLLAKTGLTKLQISNWFINARRR 249

>CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some
           similarities with uniprot|P53147 Saccharomyces
           cerevisiae YGL096w TOS8
          Length = 259

 Score = 30.8 bits (68), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRK 89
           L  W + + ++PY T ++   LS +T L+  Q+ NW  N RR+
Sbjct: 176 LNEWLYDHINNPYPTPQEKMELSLKTGLTKIQLSNWFINVRRR 218

>NDAI0B03290 Chr2 (841165..842952) [1788 bp, 595 aa] {ON} Anc_2.337
           YDL106C
          Length = 595

 Score = 30.8 bits (68), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKKN 93
           L+ +F  N       RK IS L   TN+  K +R W  NRR K KKN
Sbjct: 110 LKQYFDQNPIPSLQERKNISKL---TNMPEKNVRIWFQNRRAKLKKN 153

>NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.170
           YGL096W
          Length = 257

 Score = 30.4 bits (67), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 4/45 (8%)

Query: 47  LENWF--HLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRK 89
           L  W   HLN+ +P +  K+  LL E T L+  Q+ NW  N RR+
Sbjct: 195 LNGWLLEHLNNPYPNVQEKK--LLLELTGLTKVQLSNWFINVRRR 237

>Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W
           (REAL)
          Length = 270

 Score = 30.4 bits (67), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 4/61 (6%)

Query: 31  RGNQKVSKYPHNISMHLENWF--HLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRR 88
           +G+ K S  P      L  W   H+N+ +P L  K+  LL++ T L+  QI NW  N RR
Sbjct: 193 KGHGKRSNLPGATVHILNKWLLEHINNPYPTLQEKR-ELLAQ-TGLTKLQISNWFINARR 250

Query: 89  K 89
           +
Sbjct: 251 R 251

>AFL202C Chr6 complement(56150..57595) [1446 bp, 481 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL106C
           (PHO2)
          Length = 481

 Score = 30.4 bits (67), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 32/70 (45%), Gaps = 6/70 (8%)

Query: 26  LNSAARGNQKVSKYPHNISMHLE---NWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNW 82
           L  AA G +  SK        LE     F +N +     RK+IS   E+T L  K +R W
Sbjct: 51  LAEAADGGKPKSKRTRATGEALELLKKEFDINPNPNAQNRKRIS---EQTGLPEKNVRIW 107

Query: 83  MSNRRRKSKK 92
             NRR K +K
Sbjct: 108 FQNRRAKYRK 117

>KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 389

 Score = 30.4 bits (67), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 37  SKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRK 89
           S  P  +   L +W   N  +PY T +    L E+T L+  Q+ NW  N RR+
Sbjct: 254 SNLPKEVINVLNDWLLKNLHNPYPTPQVKRELLEKTGLNPVQLSNWFINVRRR 306

>KLLA0D10043g Chr4 (849549..851015) [1467 bp, 488 aa] {ON} similar
           to uniprot|Q755L6 Ashbya gossypii AFL202C AFL202Cp and
           weakly similar to YDL106C uniprot|P07269 Saccharomyces
           cerevisiae YDL106C PHO2 Homeobox transcription factor
           regulatory targets include genes involved in phosphate
           metabolism binds cooperatively with Pho4p to the PHO5
           promoter phosphorylation of Pho2p facilitates
           interaction with Pho4p
          Length = 488

 Score = 30.4 bits (67), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 3/46 (6%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKK 92
           L+  F LN S     RK+IS   E T L  K +R W  NRR K +K
Sbjct: 112 LKREFQLNPSPNAQNRKRIS---EMTGLPEKNVRIWFQNRRSKYRK 154

>Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C
           (CUP9) - putative DNA binding protein which shows
           similarity in homeobox domain to human proto-oncogene
           PBX1 [contig 31] FULL
          Length = 229

 Score = 29.6 bits (65), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 4/80 (5%)

Query: 12  LADAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWF--HLNSSHPYLTRKQISLLS 69
           LA A      S   L++      + +  P      L NW   HLN  +PY + ++   L 
Sbjct: 98  LARAPTPSQASLAALHTLPTSKPRRTNLPKETVDILNNWLLAHLN--YPYPSPQEKRELL 155

Query: 70  ERTNLSSKQIRNWMSNRRRK 89
            +T LS  Q+ NW  N RR+
Sbjct: 156 IKTGLSKVQLSNWFINVRRR 175

>KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}
           Anc_6.170 YPL177C
          Length = 298

 Score = 29.6 bits (65), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 33  NQKVSKY--PHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRK 89
           ++K S+Y  P +  + L  W   +  +PY T ++   L  +T LS  Q+ NW  N RR+
Sbjct: 175 DRKQSRYNLPKDTVLILNRWLLDHLHNPYPTSQEKRELLIKTGLSKIQLSNWFINVRRR 233

>TBLA0B07070 Chr2 complement(1677335..1679272) [1938 bp, 645 aa]
           {ON} Anc_2.337 YDL106C
          Length = 645

 Score = 30.0 bits (66), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 3/46 (6%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKK 92
           L+  F LN   P    K+  +LSE T L  K +R W  NRR K +K
Sbjct: 141 LKQEFKLN---PNPNSKRRKMLSESTGLPEKNVRIWFQNRRAKVRK 183

>KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {ON}
           Anc_6.170 YPL177C
          Length = 409

 Score = 29.6 bits (65), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%)

Query: 29  AARGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRR 88
           + +G  K S  P      L NW   +  +PY T  + + L ++T L+  Q+ NW  N RR
Sbjct: 265 SKKGTGKRSNLPKETVQILNNWLVNHLGNPYPTAIEKNELLKQTGLTKIQLSNWFINVRR 324

Query: 89  K 89
           +
Sbjct: 325 R 325

>CAGL0E00341g Chr5 (29668..29775,29840..30076,30143..30190) [393 bp,
           130 aa] {ON} similar to uniprot|P09091 Saccharomyces
           cerevisiae YCR097w Mating-type protein a1
          Length = 130

 Score = 29.3 bits (64), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 23/33 (69%)

Query: 59  YLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           YLTR +   L+ +  +++ Q++ W +NRR++SK
Sbjct: 92  YLTRCEKHQLAVQCGITTNQVQIWFANRRKRSK 124

>Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON}
           (153997..154794) [798 nt, 266 aa]
          Length = 265

 Score = 29.3 bits (64), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%)

Query: 32  GNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRK 89
           G  K S  P N    L  W   +  +PY T ++   L ++T L+  Q+ NW  N RR+
Sbjct: 156 GAGKRSNLPKNSVQILNQWLLNHLQNPYPTPQEKKELLKQTGLTKIQLSNWFINVRRR 213

>TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.170
           YPL177C
          Length = 264

 Score = 29.3 bits (64), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 3/71 (4%)

Query: 22  SFKFLNSAARGNQKVSK---YPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQ 78
           SF  +N+       + K    P      L  W   +  +PY T K+   L E T LS  Q
Sbjct: 140 SFSTINTQTTSKTSIGKRSNLPKQSVDVLNKWLLNHLGNPYPTPKEKEELLELTGLSKIQ 199

Query: 79  IRNWMSNRRRK 89
           + NW  N RR+
Sbjct: 200 LSNWFINVRRR 210

>KAFR0G00180 Chr7 complement(60883..61254,61328..61351) [396 bp, 131
           aa] {ON}  mating type gene MATa1
          Length = 131

 Score = 28.9 bits (63), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 11/37 (29%), Positives = 25/37 (67%)

Query: 55  SSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           ++  +LT+++  L+++R  ++  Q+R W  N+R +SK
Sbjct: 95  ATKQWLTKEERELVAKRCQITPLQVRIWFINKRSRSK 131

>Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 29.3 bits (64), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRK 89
           L  W   + ++PY T ++   L  +T L+  QI NW  N RR+
Sbjct: 207 LNKWLLEHINNPYPTVQEKRELLAKTGLTKLQISNWFINARRR 249

>ZYRO0D13596g Chr4 complement(1138485..1139834) [1350 bp, 449 aa]
           {ON} similar to uniprot|P34161 Saccharomyces cerevisiae
           YML027W YOX1 Homeodomain-containing transcriptional
           repressor binds to Mcm1p and to early cell cycle boxes
           (ECBs) in the promoters of cell cycle-regulated genes
           expressed in M/G1 phase expression is cell
           cycle-regulated potential Cdc28p substrate
          Length = 449

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKK 92
           L+  F L S+     R++   L+ER N+S K ++ W  NRR+  KK
Sbjct: 184 LQAEFELCSAPDKKKRQE---LAERCNMSEKAVQIWFQNRRQAIKK 226

>ZYRO0A07194g Chr1 complement(587457..588950) [1494 bp, 497 aa] {ON}
           similar to uniprot|P07269 Saccharomyces cerevisiae
           YDL106C PHO2 Homeobox transcription factor regulatory
           targets include genes involved in phosphate metabolism
           binds cooperatively with Pho4p to the PHO5 promoter
           phosphorylation of Pho2p facilitates interaction with
           Pho4p
          Length = 497

 Score = 29.3 bits (64), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 56  SHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKKN 93
           ++P  T ++   LSE T L  K +R W  NRR K +K+
Sbjct: 105 TNPNPTSQRRKKLSEMTGLPEKNVRIWFQNRRAKLRKD 142

>Ecym_3378 Chr3 complement(718342..719817) [1476 bp, 491 aa] {ON}
           similar to Ashbya gossypii AFL202C
          Length = 491

 Score = 28.9 bits (63), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKK 92
           L+  F +N +     RK+IS   E+T L  K +R W  NRR K +K
Sbjct: 84  LKKEFDINPNPNAQNRKRIS---EQTGLPEKNVRIWFQNRRAKYRK 126

>TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON}
           Anc_6.170 YPL177C
          Length = 256

 Score = 28.5 bits (62), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 28/63 (44%)

Query: 27  NSAARGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNR 86
           NS    N + S  P      L  W   +  +PY T ++   L  +T L+  Q+ NW  N 
Sbjct: 124 NSGGISNGRRSNLPKETVQILNTWLLDHLRNPYPTPQEKRELLIKTGLTKIQLSNWFINV 183

Query: 87  RRK 89
           RR+
Sbjct: 184 RRR 186

>NDAI0A00670 Chr1
          complement(124998..125033,125093..125308,
          125369..125404) [288 bp, 95 aa] {ON}
          Length = 95

 Score = 27.7 bits (60), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 3/45 (6%)

Query: 47 LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
          LEN F      P+L  K+   +++   +S+ Q+R W  N+R ++K
Sbjct: 52 LENIFQ---KKPWLNTKEREFVAKSCGMSALQVRVWFINKRMRTK 93

>NDAI0H00100 Chr8 complement(758..793,853..1068,1129..1164) [288
          bp, 95 aa] {ON} silent copy of MATa1 gene at HMRa
          Length = 95

 Score = 27.7 bits (60), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 3/45 (6%)

Query: 47 LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
          LEN F      P+L  K+   +++   +S+ Q+R W  N+R ++K
Sbjct: 52 LENIFQ---KKPWLNTKEREFVAKSCGMSALQVRVWFINKRMRTK 93

>KNAG0C01625 Chr3 complement(322219..322248,322306..322698) [423 bp,
           140 aa] {ON}  putative silent copy of mating type a1
           gene equivalent to S. cerevisiae HMRa1
          Length = 140

 Score = 28.1 bits (61), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 22/33 (66%)

Query: 59  YLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           +LT+++  L++ +  +S  Q+R W  N+R +SK
Sbjct: 108 WLTKEERQLIARKCGISPLQVRIWFINKRARSK 140

>SAKL0E06402g Chr5 (521232..522707) [1476 bp, 491 aa] {ON} similar
           to uniprot|Q755L6 Ashbya gossypii AFL202C AFL202Cp and
           weakly similar to YDL106C uniprot|P07269 Saccharomyces
           cerevisiae YDL106C PHO2 Homeobox transcription factor
           regulatory targets include genes involved in phosphate
           metabolism binds cooperatively with Pho4p to the PHO5
           promoter phosphorylation of Pho2p facilitates
           interaction with Pho4p
          Length = 491

 Score = 28.5 bits (62), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKK 92
           L+  F +N +     RK+IS   + TNL  K +R W  NRR K +K
Sbjct: 86  LKREFDVNPNPNAQNRKRIS---DMTNLPEKNVRIWFQNRRAKFRK 128

>NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {ON}
           Anc_6.170 YGL096W
          Length = 409

 Score = 28.5 bits (62), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%)

Query: 31  RGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRK 89
           +G+ + S  P      L  W   + ++PY T ++   L ++T L+  Q+ NW  N RR+
Sbjct: 304 KGSGRRSSLPITTVQILNEWLLDHLTNPYPTTQEKKELLKQTGLTKIQLSNWFINVRRR 362

>Smik_4.728 Chr4 complement(1282412..1283452) [1041 bp, 346 aa] {ON}
           YDR451C (REAL)
          Length = 346

 Score = 28.5 bits (62), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%)

Query: 68  LSERTNLSSKQIRNWMSNRRRKSKK 92
           LSE+ N+S K ++ W  N+R+ +KK
Sbjct: 197 LSEQCNMSEKSVQIWFQNKRQAAKK 221

>TPHA0F00500 Chr6 complement(119121..120554) [1434 bp, 477 aa] {ON}
           Anc_4.74 YGL038C
          Length = 477

 Score = 28.5 bits (62), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 15/28 (53%)

Query: 55  SSHPYLTRKQISLLSERTNLSSKQIRNW 82
           SSHP L    IS L  R+N+    I NW
Sbjct: 328 SSHPILINDSISHLKTRSNVDGTDIMNW 355

>Kpol_2002.48 s2002
          complement(103569..103598,103652..103813,
          103869..103949) [273 bp, 90 aa] {ON}
          complement(103569..103598,103652..103813,
          103869..103949) [273 nt, 91 aa]
          Length = 90

 Score = 27.3 bits (59), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 6/76 (7%)

Query: 17 GKKILSFKFLNSAARGNQKVSKY-PHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLS 75
           K ILS    N ++  ++K  K+ P    + LE  F    S   L  K+   ++++  L+
Sbjct: 20 CKDILSLNIYNESSSDHRK--KFLPKEARLFLERVFEKKQS---LNSKERDAIAKKCGLT 74

Query: 76 SKQIRNWMSNRRRKSK 91
            Q+R W  N+R +SK
Sbjct: 75 PLQVRVWFINKRMRSK 90

>Kpol_408.2 s408 complement(1157..1186,1240..1401,1457..1537) [273
          bp, 90 aa] {ON}
          complement(1157..1186,1240..1401,1457..1537) [273 nt,
          91 aa]
          Length = 90

 Score = 27.3 bits (59), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 6/76 (7%)

Query: 17 GKKILSFKFLNSAARGNQKVSKY-PHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLS 75
           K ILS    N ++  ++K  K+ P    + LE  F    S   L  K+   ++++  L+
Sbjct: 20 CKDILSLNIYNESSSDHRK--KFLPKEARLFLERVFEKKQS---LNSKERDAIAKKCGLT 74

Query: 76 SKQIRNWMSNRRRKSK 91
            Q+R W  N+R +SK
Sbjct: 75 PLQVRVWFINKRMRSK 90

>Kpol_1058.2 s1058 (4720..4800,4856..5017,5071..5100) [273 bp, 90
          aa] {ON} (4720..4800,4856..5017,5071..5100) [273 nt, 91
          aa]
          Length = 90

 Score = 27.3 bits (59), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 6/76 (7%)

Query: 17 GKKILSFKFLNSAARGNQKVSKY-PHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLS 75
           K ILS    N ++  ++K  K+ P    + LE  F    S   L  K+   ++++  L+
Sbjct: 20 CKDILSLNIYNESSSDHRK--KFLPKEARLFLERVFEKKQS---LNSKERDAIAKKCGLT 74

Query: 76 SKQIRNWMSNRRRKSK 91
            Q+R W  N+R +SK
Sbjct: 75 PLQVRVWFINKRMRSK 90

>YDR451C Chr4 complement(1361120..1362181) [1062 bp, 353 aa] {ON}
           YHP1One of two homeobox transcriptional repressors (see
           also Yox1p), that bind to Mcm1p and to early cell cycle
           box (ECB) elements of cell cycle regulated genes,
           thereby restricting ECB-mediated transcription to the
           M/G1 interval
          Length = 353

 Score = 28.5 bits (62), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%)

Query: 68  LSERTNLSSKQIRNWMSNRRRKSKK 92
           LSE+ N+S K ++ W  N+R+ +KK
Sbjct: 206 LSEQCNMSEKSVQIWFQNKRQAAKK 230

>Skud_4.727 Chr4 complement(1281176..1282222) [1047 bp, 348 aa] {ON}
           YDR451C (REAL)
          Length = 348

 Score = 28.5 bits (62), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%)

Query: 68  LSERTNLSSKQIRNWMSNRRRKSKK 92
           LSE+ N+S K ++ W  N+R+ +KK
Sbjct: 203 LSEQCNMSEKSVQIWFQNKRQAAKK 227

>Suva_2.626 Chr2 complement(1112880..1113953) [1074 bp, 357 aa] {ON}
           YDR451C (REAL)
          Length = 357

 Score = 28.5 bits (62), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 22/35 (62%)

Query: 58  PYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKK 92
           P   + + + LSE+ N+S K ++ W  N+R+ +KK
Sbjct: 198 PTPNKTKRTELSEQCNMSEKSVQIWFQNKRQAAKK 232

>TDEL0A04320 Chr1 complement(765442..766434) [993 bp, 330 aa] {ON}
           Anc_5.567 YML027W
          Length = 330

 Score = 28.1 bits (61), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%)

Query: 68  LSERTNLSSKQIRNWMSNRRRKSKK 92
           L+ER N+S K ++ W  N+R+ SK+
Sbjct: 194 LAERCNMSEKAVQIWFQNKRQASKR 218

>KNAG0C00795 Chr3
           complement(141421..141450,141508..141732,141810..141878)
           [324 bp, 107 aa] {ON}  mating type gene MATa1 at MAT
           locus
          Length = 107

 Score = 27.7 bits (60), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 45  MHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91
           + LE  F   +   +LT+++  L++ +  +S  Q+R W  N+R +SK
Sbjct: 64  LFLEKVF---TKKQWLTKEERQLIARKCGISPLQVRIWFINKRARSK 107

>KNAG0B03460 Chr2 (669607..670956) [1350 bp, 449 aa] {ON} Anc_5.567
           YML027W
          Length = 449

 Score = 28.1 bits (61), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 22/35 (62%)

Query: 58  PYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKK 92
           P   R+Q + L+ER ++S K ++ W  N+R+  K+
Sbjct: 222 PTPNRQQRAELAERCDMSEKAVQIWFQNKRQSIKR 256

>YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}
           CUP9Homeodomain-containing transcriptional repressor of
           PTR2, which encodes a major peptide transporter;
           imported peptides activate ubiquitin-dependent
           proteolysis, resulting in degradation of Cup9p and
           de-repression of PTR2 transcription
          Length = 306

 Score = 28.1 bits (61), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 7/70 (10%)

Query: 25  FLNSAARGNQ---KVSKYPHNISMHLENWF--HLNSSHPYLTRKQISLLSERTNLSSKQI 79
           F+ S +R  Q   + S  P      L  W   HLN  +PY T+++   L  +T L+  Q+
Sbjct: 152 FVESKSRRKQNSGRRSNLPKETVQILNTWLLNHLN--NPYPTQQEKRELLIKTGLTKIQL 209

Query: 80  RNWMSNRRRK 89
            NW  N RR+
Sbjct: 210 SNWFINVRRR 219

>CAGL0L07436g Chr12 (820507..822054) [1548 bp, 515 aa] {ON}
          similar to uniprot|P07269 Saccharomyces cerevisiae
          YDL106c GRF10 homeodomain protein
          Length = 515

 Score = 28.1 bits (61), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 3/46 (6%)

Query: 47 LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKK 92
          L++ F LN +     R +IS   E T +  K +R W  NRR K +K
Sbjct: 20 LKSSFQLNPNPSLQERNRIS---ELTGMPEKNVRIWFQNRRAKVRK 62

>Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {ON}
           YPL177C (REAL)
          Length = 295

 Score = 27.7 bits (60), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 37  SKYPHNISMHLENWF--HLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRK 89
           S  P      L  W   HLN  +PY T+++   L  +T L+  Q+ NW  N RR+
Sbjct: 156 SNLPKETVQILNTWLLNHLN--NPYPTQQEKRELLIKTGLTKIQLSNWFINVRRR 208

>CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {ON}
           similar to uniprot|P41817 Saccharomyces cerevisiae
           YPL177c CUP9
          Length = 221

 Score = 27.7 bits (60), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 26/53 (49%)

Query: 37  SKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRK 89
           S  P +    L  W   +  +PY T+++   L  +T L+  Q+ NW  N RR+
Sbjct: 80  SNLPKDTIQILNQWLLDHIHNPYPTQQEKRDLLIKTGLTKIQLSNWFINVRRR 132

>Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {ON}
           YPL177C (REAL)
          Length = 292

 Score = 27.3 bits (59), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 37  SKYPHNISMHLENWF--HLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRK 89
           S  P      L  W   HLN  +PY T+++   L  +T L+  Q+ NW  N RR+
Sbjct: 153 SNLPKETVQVLNTWLLNHLN--NPYPTQQEKRELLIKTGLTKIQLSNWFINVRRR 205

>TDEL0G02680 Chr7 complement(512112..513647) [1536 bp, 511 aa] {ON}
           Anc_2.337 YDL106C
          Length = 511

 Score = 27.7 bits (60), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 56  SHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKK 92
           ++P  T ++   +SE T L  K +R W  NRR K +K
Sbjct: 112 ANPNPTSQRRKKISELTGLPEKNVRIWFQNRRAKLRK 148

>AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL177C
           (CUP9) and YGL096W (TOS8)
          Length = 257

 Score = 27.3 bits (59), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 23/43 (53%)

Query: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRK 89
           L  W   +  +PY + ++   L ++T L+  Q+ NW  N RR+
Sbjct: 146 LNEWLRNHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRRR 188

>TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON}
           Anc_6.170 YPL177C
          Length = 293

 Score = 27.3 bits (59), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%)

Query: 35  KVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRK 89
           K S  P      L +W   +  +PY T K+ S L   T L+  Q+ NW  N RR+
Sbjct: 178 KRSNLPKETVQILNDWLLNHLRNPYPTPKEKSELLVLTGLTKIQLSNWFINVRRR 232

>KLTH0F09636g Chr6 complement(834845..836299) [1455 bp, 484 aa] {ON}
           similar to uniprot|P07269 Saccharomyces cerevisiae
           YDL106C PHO2 Homeobox transcription factor regulatory
           targets include genes involved in phosphate metabolism
           binds cooperatively with Pho4p to the PHO5 promoter
           phosphorylation of Pho2p facilitates interaction with
           Pho4p
          Length = 484

 Score = 27.3 bits (59), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 15/25 (60%)

Query: 68  LSERTNLSSKQIRNWMSNRRRKSKK 92
           +SE T L  K +R W  NRR K +K
Sbjct: 99  ISELTGLPEKNVRIWFQNRRAKHRK 123

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.129    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,352,802
Number of extensions: 323550
Number of successful extensions: 1447
Number of sequences better than 10.0: 129
Number of HSP's gapped: 1447
Number of HSP's successfully gapped: 129
Length of query: 110
Length of database: 53,481,399
Length adjustment: 80
Effective length of query: 30
Effective length of database: 44,308,119
Effective search space: 1329243570
Effective search space used: 1329243570
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)