Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_33.matalpha1singletonOFF24424411371e-159
Kwal_33.12992singletonOFF24424411371e-159
Kwal_YGOB_matalpha11.120ON24424411371e-159
Kwal_YGOB_HMalpha11.1ON24424411371e-159
KLTH0F00374g1.1ON2492494176e-50
KLLA0C00352g1.1ON2612652322e-22
Ecym_10031.1ON263982033e-18
Ecym_11141.120ON263982033e-18
YCR040W (MATALPHA1)1.120ON175771484e-11
YCL066W (HMLALPHA1)1.1ON175771484e-11
Suva_3.1481.1ON175761484e-11
Skud_3.1191.120ON174741405e-10
Smik_92.1singletonON156701342e-09
Skud_71.1singletonON155651316e-09
ZYRO0F18590g1.1ON200791329e-09
ZYRO0F15840g1.120ON200791329e-09
KNAG0C001501.1ON145491132e-06
Suva_69.2singletonON145541132e-06
Kpol_2002.21.1ON209751152e-06
TDEL0C070101.1ON205741142e-06
TBLA0A070401.120ON201701091e-05
TBLA0A075901.1ON201701091e-05
NCAS0B091501.1ON1501161034e-05
CAGL0B01243g1.120ON143521017e-05
CAGL0B00242g1.1ON184521011e-04
KAFR0D007101.120ON17249957e-04
TPHA0E036201.120ON19572958e-04
TPHA0E040801.1ON19572958e-04
KLLA0C04884g1.439ON22054663.8
TBLA0B056002.476ON1412164684.1
KAFR0H028308.615ON47157674.7
Ecym_35273.62ON48763665.9
NOTE: 1 genes in the same pillar as Kwal_YGOB_HMalpha1 were not hit in these BLAST results
LIST: NDAI0A00100

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_YGOB_HMalpha1
         (244 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa...   442   e-159
Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF...   442   e-159
Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 ...   442   e-159
Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]...   442   e-159
KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}...   165   6e-50
KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}...    94   2e-22
Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to Sac...    83   3e-18
Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON} ...    83   3e-18
YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}  MATALPHA1Tr...    62   4e-11
YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}  HMLALPHA1Sile...    62   4e-11
Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W (...    62   4e-11
Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W (...    59   5e-10
Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W...    56   2e-09
Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W...    55   6e-09
ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} simil...    55   9e-09
ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} simil...    55   9e-09
KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON} ...    48   2e-06
Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)        48   2e-06
Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON} c...    49   2e-06
TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1....    49   2e-06
TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {...    47   1e-05
TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {...    47   1e-05
NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1      44   4e-05
CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {O...    44   7e-05
CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}...    44   1e-04
KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON...    41   7e-04
TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.12...    41   8e-04
TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenc...    41   8e-04
KLLA0C04884g Chr3 (444289..444951) [663 bp, 220 aa] {ON} similar...    30   3.8  
TBLA0B05600 Chr2 (1333565..1337803) [4239 bp, 1412 aa] {ON}            31   4.1  
KAFR0H02830 Chr8 complement(539280..540695) [1416 bp, 471 aa] {O...    30   4.7  
Ecym_3527 Chr3 (1001629..1003092) [1464 bp, 487 aa] {ON} similar...    30   5.9  

>Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {OFF} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score =  442 bits (1137), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 216/244 (88%), Positives = 216/244 (88%)

Query: 1   MKFTKPSFKVSVNKRHGAXXXXXXXXXXXXRNYVSEGVNLYMSYSKQELIPKPPKAVMKI 60
           MKFTKPSFKVSVNKRHGA            RNYVSEGVNLYMSYSKQELIPKPPKAVMKI
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKPKISKKSLKRNYVSEGVNLYMSYSKQELIPKPPKAVMKI 60

Query: 61  XXXXXXXXXXXXXXXXIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQE 120
                           IHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQE
Sbjct: 61  LGSDHGKGLSKGLSKGIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQE 120

Query: 121 LSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEGTAAVEISYGLP 180
           LSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEGTAAVEISYGLP
Sbjct: 121 LSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEGTAAVEISYGLP 180

Query: 181 FIEDIYHEQAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLFCSIQKNDE 240
           FIEDIYHEQAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLFCSIQKNDE
Sbjct: 181 FIEDIYHEQAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLFCSIQKNDE 240

Query: 241 GLYL 244
           GLYL
Sbjct: 241 GLYL 244

>Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF}
           YCR040W (MATALPHA1) - transcription factor involved in
           the regulation of alpha-specific genes [contig 123] FULL
          Length = 244

 Score =  442 bits (1137), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 216/244 (88%), Positives = 216/244 (88%)

Query: 1   MKFTKPSFKVSVNKRHGAXXXXXXXXXXXXRNYVSEGVNLYMSYSKQELIPKPPKAVMKI 60
           MKFTKPSFKVSVNKRHGA            RNYVSEGVNLYMSYSKQELIPKPPKAVMKI
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKPKISKKSLKRNYVSEGVNLYMSYSKQELIPKPPKAVMKI 60

Query: 61  XXXXXXXXXXXXXXXXIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQE 120
                           IHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQE
Sbjct: 61  LGSDHGKGLSKGLSKGIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQE 120

Query: 121 LSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEGTAAVEISYGLP 180
           LSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEGTAAVEISYGLP
Sbjct: 121 LSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEGTAAVEISYGLP 180

Query: 181 FIEDIYHEQAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLFCSIQKNDE 240
           FIEDIYHEQAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLFCSIQKNDE
Sbjct: 181 FIEDIYHEQAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLFCSIQKNDE 240

Query: 241 GLYL 244
           GLYL
Sbjct: 241 GLYL 244

>Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {ON} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score =  442 bits (1137), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 216/244 (88%), Positives = 216/244 (88%)

Query: 1   MKFTKPSFKVSVNKRHGAXXXXXXXXXXXXRNYVSEGVNLYMSYSKQELIPKPPKAVMKI 60
           MKFTKPSFKVSVNKRHGA            RNYVSEGVNLYMSYSKQELIPKPPKAVMKI
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKPKISKKSLKRNYVSEGVNLYMSYSKQELIPKPPKAVMKI 60

Query: 61  XXXXXXXXXXXXXXXXIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQE 120
                           IHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQE
Sbjct: 61  LGSDHGKGLSKGLSKGIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQE 120

Query: 121 LSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEGTAAVEISYGLP 180
           LSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEGTAAVEISYGLP
Sbjct: 121 LSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEGTAAVEISYGLP 180

Query: 181 FIEDIYHEQAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLFCSIQKNDE 240
           FIEDIYHEQAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLFCSIQKNDE
Sbjct: 181 FIEDIYHEQAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLFCSIQKNDE 240

Query: 241 GLYL 244
           GLYL
Sbjct: 241 GLYL 244

>Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]
           {ON} ANNOTATED BY YGOB - This is Kwal_33.12992
          Length = 244

 Score =  442 bits (1137), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 216/244 (88%), Positives = 216/244 (88%)

Query: 1   MKFTKPSFKVSVNKRHGAXXXXXXXXXXXXRNYVSEGVNLYMSYSKQELIPKPPKAVMKI 60
           MKFTKPSFKVSVNKRHGA            RNYVSEGVNLYMSYSKQELIPKPPKAVMKI
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKPKISKKSLKRNYVSEGVNLYMSYSKQELIPKPPKAVMKI 60

Query: 61  XXXXXXXXXXXXXXXXIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQE 120
                           IHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQE
Sbjct: 61  LGSDHGKGLSKGLSKGIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYARIVKGRIRQQE 120

Query: 121 LSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEGTAAVEISYGLP 180
           LSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEGTAAVEISYGLP
Sbjct: 121 LSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPEIEGTAAVEISYGLP 180

Query: 181 FIEDIYHEQAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLFCSIQKNDE 240
           FIEDIYHEQAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLFCSIQKNDE
Sbjct: 181 FIEDIYHEQAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLFCSIQKNDE 240

Query: 241 GLYL 244
           GLYL
Sbjct: 241 GLYL 244

>KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}
           weakly similar to uniprot|P01365 Saccharomyces
           cerevisiae YCR040W MATALPHA1 Transcriptional
           co-activator involved in regulation of
           mating-type-specific gene expression targets the
           transcription factor Mcm1p to the promoters of
           alpha-specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 249

 Score =  165 bits (417), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 97/249 (38%), Positives = 132/249 (53%), Gaps = 9/249 (3%)

Query: 1   MKFTKPSFKVSVNKRHGAXXXXXXXXXXXXRNYVSEGVNLYMSYSKQELIPKPPKAVMKI 60
           M  TKPSFKV + K+               ++Y   G NLYMSYSK + IPKPP  ++ +
Sbjct: 1   MNSTKPSFKVLIKKKGKTLNRRLKNSS---KSYRENGANLYMSYSKPQAIPKPPNTLINL 57

Query: 61  XXXXXXXXXXXX--XXXXIHKDQKSQTF-LGSGKCTSKKKINPFIGFRSYYARIVKGRIR 117
                             I K+   +   + S     KKKINPFIGFRSYYA+  KGR+R
Sbjct: 58  VRSKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGFRSYYAKFAKGRVR 117

Query: 118 QQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYK---PEIEGTAAVE 174
           QQELS ILS+YW  + ++H  WEFFT+HYNR+ T MCFT WLE+NY+    E E  +   
Sbjct: 118 QQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLWLEENYQQSYEESELDSECM 177

Query: 175 ISYGLPFIEDIYHEQAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLFCS 234
                P+IED+Y       T+ T +EL      H  +Q  LN +   E++++  D +  S
Sbjct: 178 AKRSQPYIEDLYSGTGEFLTKLTSRELLDISGNHSGFQGSLNSLPFFEEHNRTTDWMLSS 237

Query: 235 IQKNDEGLY 243
           I + D+  Y
Sbjct: 238 ILQCDQVPY 246

>KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}
           uniprot|Q08398 Kluyveromyces lactis HMLAPLHA1 Mating-
           type protein ALPHA1
          Length = 261

 Score = 94.0 bits (232), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/265 (28%), Positives = 112/265 (42%), Gaps = 38/265 (14%)

Query: 1   MKFTKPSFKVSVNKRHGAXXXXXXXX---------XXXXRNYVSEGVNLYMSYSKQELIP 51
           MK   P+FKV+V+KR  +                     R    EGVNLYMS      IP
Sbjct: 1   MKSNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIP 60

Query: 52  KPPKAVMK-IXXXXXXXXXXXXXXXXIHKDQKSQTFLGSGKCTSKKKINPFIGFRSYYAR 110
            PP+ ++  I                 + +Q S   + +   T KK+IN FI FRSYY+R
Sbjct: 61  APPQVLVAYIKEKVKTLNKSEVLMSLGNSNQLSSRDVKTK--TKKKQINDFIAFRSYYSR 118

Query: 111 IVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYKPE---- 166
           ++ G + Q ELSTI+S++W    Q  K WE   + YN D +   F  WLE NY  +    
Sbjct: 119 LLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNYGIDKQWL 178

Query: 167 ---IEGTAAVEISYGLPFIEDIYH-----------------EQAVKSTEWTPQELFGTKE 206
              ++    +  +   P++E+IY+                  Q+  S +W    +F   E
Sbjct: 179 YEIVQYEECLTPTTKKPYVENIYNSGFKQRIDSPNQKDITFSQSDNSADWLVDPIFFDTE 238

Query: 207 LHQEYQDILNKIIPIEDYSQLIDSL 231
                 D  N I  I D   L++S+
Sbjct: 239 FLATSFDRTNLI--ISDCYSLMNSV 261

>Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to
           Saccharomyces cerevisiae YCL066W HMLALPHA1
          Length = 263

 Score = 82.8 bits (203), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 55/98 (56%), Gaps = 6/98 (6%)

Query: 95  KKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMC 154
           +KKIN F+ FRSYY+R  +G + Q ELS IL+Q W    ++ +TWE F EHYN +     
Sbjct: 110 RKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQS 169

Query: 155 FTEWLEKNYKPEIEGTAAVEISYGL------PFIEDIY 186
           F EWLEK Y         V+I          P++ED+Y
Sbjct: 170 FPEWLEKTYTSSYTPKGKVKIDDDQDEKSKHPYVEDLY 207

>Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON}
           similar to YCL066W HMLALPHA1
          Length = 263

 Score = 82.8 bits (203), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 55/98 (56%), Gaps = 6/98 (6%)

Query: 95  KKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMC 154
           +KKIN F+ FRSYY+R  +G + Q ELS IL+Q W    ++ +TWE F EHYN +     
Sbjct: 110 RKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQS 169

Query: 155 FTEWLEKNYKPEIEGTAAVEISYGL------PFIEDIY 186
           F EWLEK Y         V+I          P++ED+Y
Sbjct: 170 FPEWLEKTYTSSYTPKGKVKIDDDQDEKSKHPYVEDLY 207

>YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}
           MATALPHA1Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression;
           targets the transcription factor Mcm1p to the promoters
           of alpha-specific genes; one of two genes encoded by the
           MATalpha mating type cassette
          Length = 175

 Score = 61.6 bits (148), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 46/77 (59%), Gaps = 2/77 (2%)

Query: 93  TSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTV 152
           +SKK +N F+ FR+YY++   G ++Q  LS++L++ W +    H  W++F + YN  N  
Sbjct: 88  SSKKYLNSFMAFRAYYSQFGSG-VKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPG 146

Query: 153 MCFTEWLEKNYKPEIEG 169
             F EWL  NY  E+ G
Sbjct: 147 FGFVEWLTNNY-AEVRG 162

>YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}
           HMLALPHA1Silenced copy of ALPHA1 at HML, encoding a
           transcriptional coactivator involved in the regulation
           of mating-type alpha-specific gene expression
          Length = 175

 Score = 61.6 bits (148), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 46/77 (59%), Gaps = 2/77 (2%)

Query: 93  TSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTV 152
           +SKK +N F+ FR+YY++   G ++Q  LS++L++ W +    H  W++F + YN  N  
Sbjct: 88  SSKKYLNSFMAFRAYYSQFGSG-VKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPG 146

Query: 153 MCFTEWLEKNYKPEIEG 169
             F EWL  NY  E+ G
Sbjct: 147 FGFVEWLTNNY-AEVRG 162

>Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W
           (REAL)
          Length = 175

 Score = 61.6 bits (148), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 2/76 (2%)

Query: 94  SKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVM 153
           SKK +N F+ FR+YY++   G ++Q  LS++LS+ W +    H  W++F + YN  N   
Sbjct: 89  SKKYLNSFMAFRAYYSQFGAG-VKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGF 147

Query: 154 CFTEWLEKNYKPEIEG 169
            F EWL  NY  E+ G
Sbjct: 148 GFVEWLTNNY-AEVRG 162

>Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W
           (REAL)
          Length = 174

 Score = 58.5 bits (140), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 42/74 (56%), Gaps = 2/74 (2%)

Query: 98  INPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTE 157
           IN F+ FR+YY++   G ++Q  LS++LS+ W +    H  W++F + YN  N    F E
Sbjct: 92  INSFMAFRAYYSQFGSG-VKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVE 150

Query: 158 WLEKNYKPEIEGTA 171
           WL  NY  E+ G  
Sbjct: 151 WLTNNY-AEVRGDG 163

>Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W
           (REAL)
          Length = 156

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 93  TSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTV 152
           ++KK +N F+ FR+YY++   G ++Q  LS++LS+ W +    H  W++F + YN  N  
Sbjct: 88  STKKYLNSFMAFRAYYSQFGSG-VKQNILSSLLSEEWHADKTQHGIWDYFAQQYNFINPG 146

Query: 153 MCFTEWLEKN 162
             F EWL  N
Sbjct: 147 FGFVEWLTNN 156

>Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W
           (REAL)
          Length = 155

 Score = 55.1 bits (131), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 98  INPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTE 157
           IN F+ FR+YY++   G ++Q  LS++LS+ W +    H  W++F + YN  N    F E
Sbjct: 92  INSFMAFRAYYSQFGSG-VKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVE 150

Query: 158 WLEKN 162
           WL  N
Sbjct: 151 WLTNN 155

>ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score = 55.5 bits (132), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 88  GSGKCTSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYN 147
           GS K  S+K +N F+ FR+Y ++   G ++Q  LS++L+  W SH +  K W+ F + +N
Sbjct: 120 GSRKGCSEKPLNSFMAFRAYNSQFGNG-LKQNILSSLLAAAWHSHPEQQKIWDTFAQQFN 178

Query: 148 RDNTVMCFTEWLEKNYKPE 166
                  F EW+++ Y+ E
Sbjct: 179 FVKPKCGFVEWVDQRYERE 197

>ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score = 55.5 bits (132), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 88  GSGKCTSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYN 147
           GS K  S+K +N F+ FR+Y ++   G ++Q  LS++L+  W SH +  K W+ F + +N
Sbjct: 120 GSRKGCSEKPLNSFMAFRAYNSQFGNG-LKQNILSSLLAAAWHSHPEQQKIWDTFAQQFN 178

Query: 148 RDNTVMCFTEWLEKNYKPE 166
                  F EW+++ Y+ E
Sbjct: 179 FVKPKCGFVEWVDQRYERE 197

>KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON}
           Anc_1.1 YCL066W silent copy of mating type alpha1 gene
           at HML locus
          Length = 145

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 98  INPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHY 146
           +N FI FR+YY++   G I Q +LS+ILS++W S+      W+  TE Y
Sbjct: 92  LNSFIAFRAYYSQFANG-INQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139

>Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)
          Length = 145

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 94  SKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYN 147
           SKK +N F+ FR+YY++   G ++Q  LS++LS+ W +    H  W++F + YN
Sbjct: 89  SKKYLNSFMAFRAYYSQFGAG-VKQNILSSLLSEEWHADKMQHGIWDYFAQQYN 141

>Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON}
           complement(3611..4240) [630 nt, 210 aa]
          Length = 209

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 93  TSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTV 152
           +SKK +N F+ FR+Y ++   G ++Q+ LS++LS+ W S  +  K W   ++ +N     
Sbjct: 132 SSKKSLNGFMAFRAYNSQFGYG-LKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPK 190

Query: 153 MCFTEWLEKNYKPEI 167
             F EW+ + Y+ E+
Sbjct: 191 CGFVEWVGQTYEREM 205

>TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1.121
           YCR040W silenced copy of alpha1 gene at T. delbrueckii
           HML locus
          Length = 205

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 1/74 (1%)

Query: 93  TSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTV 152
            S K +N F+ FR+Y ++   G ++Q  LS++L+  W SH +    W+ F + +N     
Sbjct: 132 ASNKPLNSFMAFRAYNSQFGYG-LKQNILSSLLASAWHSHPEQQGIWDTFAQQFNFVKPK 190

Query: 153 MCFTEWLEKNYKPE 166
             F EW+++ Y+ E
Sbjct: 191 CGFVEWVDQRYERE 204

>TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {ON}
            MATalpha1 gene at MAT locus
          Length = 201

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 98  INPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTE 157
           +N FI FR+Y ++   G ++Q  LS++LS  W  +      W FF++ YN       F E
Sbjct: 129 LNGFIAFRAYNSQFGYG-LKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFVE 187

Query: 158 WLEKNYKPEI 167
           WL + Y+ E+
Sbjct: 188 WLGQTYEREM 197

>TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {ON}
           Anc_1.1 YCL066W silenced copy of alpha1 gene at HML
           locus
          Length = 201

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 98  INPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTE 157
           +N FI FR+Y ++   G ++Q  LS++LS  W  +      W FF++ YN       F E
Sbjct: 129 LNGFIAFRAYNSQFGYG-LKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFVE 187

Query: 158 WLEKNYKPEI 167
           WL + Y+ E+
Sbjct: 188 WLGQTYEREM 197

>NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1
          Length = 150

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 51/116 (43%), Gaps = 14/116 (12%)

Query: 39  NLYMSYSKQELIPKPPKAVMKIXXXXXXXXXXXXXXXXIHKDQKSQTFLGSGKCTSKKKI 98
           N+++   K   IP+PP  V++                 I+  ++             K I
Sbjct: 43  NIFLKDPKNITIPQPPNWVLQ----------ELETIRIIYPSKQKPKPRKQVTSNPSKPI 92

Query: 99  NPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMC 154
           N FI FRSYY+R   G I+Q  LS +L+++W S       W++F   Y   +TV C
Sbjct: 93  NGFILFRSYYSRWGYG-IKQTMLSQLLAKFWKSSDTDQALWDYFALQY---STVGC 144

>CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 expressed copy at MAT locus
           or uniprot|P01365 Saccharomyces cerevisiae YCL066w
           HMLALPHA1 silenced copy at HML
          Length = 143

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 96  KKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYN 147
           + +N F+ FR+YYA++  G ++Q  LS ILS+ W +       W+ F + +N
Sbjct: 73  RPMNAFMAFRTYYAQLGTG-LKQNTLSVILSEAWNAPETDQNIWDIFAQQFN 123

>CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 mating type regulatory
           protein or uniprot|P01365 Saccharomyces cerevisiae
           YCL066w HMLALPHA1
          Length = 184

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 96  KKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYN 147
           + +N F+ FR+YYA++  G ++Q  LS ILS+ W +       W+ F + +N
Sbjct: 114 RPMNAFMAFRTYYAQLGTG-LKQNTLSVILSEAWNAPETDQNIWDIFAQQFN 164

>KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON}
           mating type gene MATalpha1
          Length = 172

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 96  KKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTE 144
           + +NPF+ FRSYY++  +G ++Q ELS +L++ W S  +    W   T+
Sbjct: 119 RNLNPFMAFRSYYSQYAQG-LKQIELSEVLAKAWHSDTKEQNYWISLTQ 166

>TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.121
           YCR040W MATalpha1 gene at MAT locus
          Length = 195

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 95  KKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMC 154
           KK +N FI FR+Y A+   G + Q  LS +LS  W S  + H  W+ F + +N       
Sbjct: 121 KKSLNSFIAFRAYNAQFGNG-LNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPKCG 179

Query: 155 FTEWLEKNYKPE 166
           F EW+ + Y+ E
Sbjct: 180 FVEWVGQTYERE 191

>TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenced
           copy of alpha1 at HMLalpha locus
          Length = 195

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 95  KKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMC 154
           KK +N FI FR+Y A+   G + Q  LS +LS  W S  + H  W+ F + +N       
Sbjct: 121 KKSLNSFIAFRAYNAQFGNG-LNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPKCG 179

Query: 155 FTEWLEKNYKPE 166
           F EW+ + Y+ E
Sbjct: 180 FVEWVGQTYERE 191

>KLLA0C04884g Chr3 (444289..444951) [663 bp, 220 aa] {ON} similar to
           uniprot|P25362 Saccharomyces cerevisiae YCR020C PET18
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 220

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 183 EDIYHEQAVKSTEWTPQELFGTKELH--QEYQDILNKIIPIEDYSQLIDSLFCS 234
           E+ Y +Q ++ TE  P + F T+ L   Q+Y D L K+    DY Q +  ++C+
Sbjct: 92  ENDYFDQCLQITERDPLKRFKTQVLPKVQKYLDFLEKMPASVDYGQWVTHMWCA 145

>TBLA0B05600 Chr2 (1333565..1337803) [4239 bp, 1412 aa] {ON} 
          Length = 1412

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 67/164 (40%), Gaps = 22/164 (13%)

Query: 77  IHKDQKSQTFLGSGKC----TSKKKINPFIGFRSYYARIVKGR-IRQQELSTILSQYWLS 131
           I+ D ++ + + S        +KK +N  +  R  +    + +   ++EL  +  Q   S
Sbjct: 822 IYSDTEADSRMNSNSSRKTNVNKKNVNSTVSSRKEFQNYQEPKSTSKRELLAVKKQK--S 879

Query: 132 HHQVHKTWEFFTEHYNRDN---TVMCFTEWLEKNYKPEIEGTAAVEISYGLPFIEDIYHE 188
           HHQ H +    +  YN +N   T++  T       +P  +   + ++            +
Sbjct: 880 HHQRHHSTNLSSSEYNNENNETTIISATLTPRSFRRPAGKTVVSKKV------------K 927

Query: 189 QAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLF 232
              +S   T      TK+L+ EY D+   IIP  D S+  D L+
Sbjct: 928 DPNRSYSLTSTTSHHTKKLNNEYNDVSPIIIPDIDLSEEYDELY 971

>KAFR0H02830 Chr8 complement(539280..540695) [1416 bp, 471 aa] {ON}
           Anc_8.615 YPL120W
          Length = 471

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 33/57 (57%)

Query: 181 FIEDIYHEQAVKSTEWTPQELFGTKELHQEYQDILNKIIPIEDYSQLIDSLFCSIQK 237
           F+  +  E++ K T+       G+++LH E + +L ++I +E   +++D+   S+QK
Sbjct: 151 FLNKLEREESNKRTDHRDNGKDGSEKLHVEKEKLLQQLIELEKEDEMLDNEILSLQK 207

>Ecym_3527 Chr3 (1001629..1003092) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii AEL203W
          Length = 487

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 8/63 (12%)

Query: 182 IEDIYHEQ------AVKSTEWTPQELFGTKELHQEYQDIL--NKIIPIEDYSQLIDSLFC 233
           I D+++++       V ST+  P E   T+EL   Y+ +   N I+  + + +L+D  F 
Sbjct: 82  IVDVFNKRDYLLVPTVASTDHVPLEEIATEELFARYRPLFLGNSILDTDRHGKLLDKFFS 141

Query: 234 SIQ 236
           S++
Sbjct: 142 SLK 144

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,023,449
Number of extensions: 983282
Number of successful extensions: 2504
Number of sequences better than 10.0: 36
Number of HSP's gapped: 2524
Number of HSP's successfully gapped: 36
Length of query: 244
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 137
Effective length of database: 41,212,137
Effective search space: 5646062769
Effective search space used: 5646062769
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)