Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_YGOB_EST37.128ON19219210271e-144
Kthe_YGOB_EST37.128ON1931905241e-67
Kwal_55.20848singletonOFF96955072e-66
Sklu_YGOB_EST37.128ON1961893479e-41
ADL016C7.128ON2021803234e-37
NCAS0E021507.128ON1851892972e-33
TDEL0H029007.128ON1881922963e-33
CAGL0C03828g7.128ON1801742884e-32
KLTH0F12606gsingletonOFF96872762e-31
Skud_9.1637.128ON1801832721e-29
NDAI0E036907.128ON1961952731e-29
Zrou_YGOB_EST37.128ON1681752711e-29
YIL009C-A (EST3)7.128ON1811852685e-29
Smik_9.1857.128ON1821892529e-27
KNAG0L009607.128ON1851832484e-26
KAFR0L004807.128ON1801832432e-25
Suva_9.1957.128ON1891912433e-25
Kpol_1062.557.128ON1821162372e-24
KLLA0D14289g7.128ON1841862207e-22
TPHA0C043107.128ON2012061947e-18
Sklu_YGOB_Anc_7.128singletonOFF98971666e-15
TBLA0A009607.128ON2151091676e-14
ZYRO0C05258gsingletonOFF87931282e-09
TDEL0F033403.451ON41487655.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_YGOB_EST3
         (192 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [57...   400   e-144
Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026...   206   1e-67
Kwal_55.20848 s55 complement(581970..582260) [291 bp, 96 aa] {OF...   199   2e-66
Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196...   138   9e-41
ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, ...   129   4e-37
NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 ...   119   2e-33
TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 ...   118   3e-33
CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 a...   115   4e-32
KLTH0F12606g Chr6 complement(1055736..1056026) [291 bp, 96 aa] {...   110   2e-31
Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 b...   109   1e-29
NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 ...   109   1e-29
Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [5...   108   1e-29
YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp...   107   5e-29
Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 b...   101   9e-27
KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558...   100   4e-26
KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,...    98   2e-25
Suva_9.195 Chr9 complement(324112..324381,324353..324373,324377....    98   3e-25
Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 ...    96   2e-24
KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} simil...    89   7e-22
TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa...    79   7e-18
Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF} ...    69   6e-15
TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 ...    69   6e-14
ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa] {OF...    54   2e-09
TDEL0F03340 Chr6 (617255..618499) [1245 bp, 414 aa] {ON} Anc_3.4...    30   5.3  

>Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [579
           bp, 192 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 192

 Score =  400 bits (1027), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 192/192 (100%), Positives = 192/192 (100%)

Query: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPMQLSS 60
           MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPMQLSS
Sbjct: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPMQLSS 60

Query: 61  QLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITARTVN 120
           QLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITARTVN
Sbjct: 61  QLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITARTVN 120

Query: 121 TIFLIGAVTIKYIPIYEVRETWCWASDLDTRIPVLPVLVVNECTVFDLDQVESRRKFNYL 180
           TIFLIGAVTIKYIPIYEVRETWCWASDLDTRIPVLPVLVVNECTVFDLDQVESRRKFNYL
Sbjct: 121 TIFLIGAVTIKYIPIYEVRETWCWASDLDTRIPVLPVLVVNECTVFDLDQVESRRKFNYL 180

Query: 181 YHLSHFKDIFGC 192
           YHLSHFKDIFGC
Sbjct: 181 YHLSHFKDIFGC 192

>Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026)
           [582 bp, 193 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006).
           Replaces KLTH0F12606g.
          Length = 193

 Score =  206 bits (524), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 108/190 (56%), Positives = 140/190 (73%)

Query: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPMQLSS 60
           M K  +  K+KQ ES FLR WI  DV  V+K H  LP+WPAV  FVP + +  G +   S
Sbjct: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60

Query: 61  QLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITARTVN 120
           ++L NRRHFLKIT FH++  FAV+ASGRD++C+ILVEFTP+CVS FER + +RITA+TVN
Sbjct: 61  EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAKTVN 120

Query: 121 TIFLIGAVTIKYIPIYEVRETWCWASDLDTRIPVLPVLVVNECTVFDLDQVESRRKFNYL 180
           TI LIG+ T+KY+P++E    W  +  LD R+PV+PVLVV +C VFDLDQVE+R  F+YL
Sbjct: 121 TILLIGSGTLKYLPVHEAYTQWSLSIPLDPRVPVVPVLVVEQCAVFDLDQVEARPSFDYL 180

Query: 181 YHLSHFKDIF 190
           Y L+ FK +F
Sbjct: 181 YQLTPFKKLF 190

>Kwal_55.20848 s55 complement(581970..582260) [291 bp, 96 aa]
          {OFF} [contig 138] FULL
          Length = 96

 Score =  199 bits (507), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 95/95 (100%), Positives = 95/95 (100%)

Query: 1  MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPMQLSS 60
          MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPMQLSS
Sbjct: 1  MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPMQLSS 60

Query: 61 QLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQIL 95
          QLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQIL
Sbjct: 61 QLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQIL 95

>Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196
           aa] {ON} ANNOTATED BY YGOB - Ribosomal frameshifting
           (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 196

 Score =  138 bits (347), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 114/189 (60%), Gaps = 3/189 (1%)

Query: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSD--GPMQL 58
           MPK +   + K+ +S +L +WI   +   V+   ++ +   V  FVPS+   D    + L
Sbjct: 1   MPKVALSSRNKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVHL 60

Query: 59  SSQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITART 118
           S +++ N RHF+K+T F++++N+ VYAS RD  C ILVEFT  CVS FER H  RIT+ T
Sbjct: 61  SRKIILNHRHFIKLTKFYQVNNYQVYASARDSLCSILVEFTACCVSNFERLHHSRITSET 120

Query: 119 VNTIFLIGAVTIKYIPIYEVRETWCW-ASDLDTRIPVLPVLVVNECTVFDLDQVESRRKF 177
            NT+F+IG V + ++    V + +    +  + ++ ++P+L VN+  V+D+DQVES RKF
Sbjct: 121 TNTLFVIGDVKLVFMDKASVSQKFGIDITQFNPQLNLVPILRVNQAFVYDMDQVESNRKF 180

Query: 178 NYLYHLSHF 186
            + Y    F
Sbjct: 181 PFFYQSEAF 189

>ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, 202
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YIL009C-A (EST3)
          Length = 202

 Score =  129 bits (323), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 103/180 (57%), Gaps = 7/180 (3%)

Query: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPMQLSS 60
           MPK     +  + +S FLR W+   V   ++   +   W  VE F+P++  +   + L  
Sbjct: 1   MPKVVLASRAHKADSIFLREWLVDAVVPALERSGACAPWAGVECFIPALPPATATLSLEP 60

Query: 61  QLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITARTVN 120
            ++QN + FL+I  F ++H+FAV A  RD  C ILVEFTP CVS FERR+  RIT+ TVN
Sbjct: 61  TVIQNPKRFLRIVRFTRVHDFAVCAVARDAGCCILVEFTPHCVSNFERRYHQRITSSTVN 120

Query: 121 TIFLIGAVTIKYIPIYEVRETWCWASDLDTRI---PVLPVLVVNECTVFDLDQVESRRKF 177
           ++F+IG  ++    ++  R     A ++   +     LPVL V +C +FD DQVES R+F
Sbjct: 121 SLFVIGNTSL----LFYARSDAAAAFEVPALMNGSSTLPVLRVGDCAIFDQDQVESHRRF 176

>NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 bp,
           185 aa] {ON} Anc_7.128 YIL009C-A
          Length = 185

 Score =  119 bits (297), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/189 (39%), Positives = 111/189 (58%), Gaps = 15/189 (7%)

Query: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSD--GPMQL 58
           MP+     K  Q +S FL+ WI+  + E ++    LP     +R VPS+  +D   P Q 
Sbjct: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLP--GNQQREVPSLNEADLRAP-QC 57

Query: 59  SSQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITART 118
           S ++L N  HF K+T F KI+N+A+ AS RD   Q+LVEFTPKCVS FERRH  R+T+ T
Sbjct: 58  SPKVLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSET 117

Query: 119 VNTIFLIGAVTIKYIPIYEVRETWCWA-SDLDTRI-----PVLPVLVVNECTVFDLDQVE 172
           +N + +IG   I    IY+ R+       ++D  I     P++P+L +N+ ++FD DQV+
Sbjct: 118 LNCLLVIGDAAI----IYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQVQ 173

Query: 173 SRRKFNYLY 181
             R F ++Y
Sbjct: 174 HLRSFPFVY 182

>TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 bp,
           188 aa] {ON} Anc_7.128 YIL009C-A
          Length = 188

 Score =  118 bits (296), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/192 (36%), Positives = 110/192 (57%), Gaps = 13/192 (6%)

Query: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVV--KGHVSLPVWPAVERFVPSIVRSD-GPMQ 57
           MPK       KQ+++ FL  WI++ +  ++  +  + LPV+     F+P +   D    Q
Sbjct: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLPVF----NFIPKLQLKDLRKPQ 56

Query: 58  LSSQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITAR 117
           LS ++L+N  HF+K+  FH ++ F V+A+ RD + QILVEFTP+CVS+FER H  RIT  
Sbjct: 57  LSPRILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLE 116

Query: 118 TVNTIFLIGAVTI-----KYIPIYEVRETWCWASDLD-TRIPVLPVLVVNECTVFDLDQV 171
           T +++F+I    +      YI      +   W S  +  R   +PVL+VN+ + F++DQ+
Sbjct: 117 TEHSLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQI 176

Query: 172 ESRRKFNYLYHL 183
           ES   F YLY L
Sbjct: 177 ESFEHFPYLYTL 188

>CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 aa]
           {ON} similar to uniprot|Q03096 Saccharomyces cerevisiae
           YIL009ca
          Length = 180

 Score =  115 bits (288), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 105/174 (60%), Gaps = 14/174 (8%)

Query: 14  ESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPMQLSSQLLQNRRHFLKIT 73
           ES +L  W++  + E  K   ++ V P V+    SI     P+ LS ++  NRRHF+KIT
Sbjct: 14  ESVYLHGWVRDMLLES-KTSQNIAVIPRVDPDEASI-----PL-LSRRIYANRRHFVKIT 66

Query: 74  GFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITARTVNTIFLIGAVTIKYI 133
            F ++HN++VYAS +D   QIL +FTPKCVS+FE R+  RIT+ TVNT+F+IG   +  +
Sbjct: 67  KFFQVHNYSVYASVKDSQHQILSQFTPKCVSEFESRNRSRITSDTVNTLFMIGDAKLGIM 126

Query: 134 PIYEVRETW-----CWASDLDTRIPVLPVLVVNECTVFDLDQVESRRKFNYLYH 182
            + E+R  +        + LD  +P +P L++N+  + D DQVE+ +   ++Y 
Sbjct: 127 VVDELRHYFGEKIVSLFNGLD--MPYIPYLIINQAFILDYDQVEAFKMTPFVYQ 178

>KLTH0F12606g Chr6 complement(1055736..1056026) [291 bp, 96 aa]
          {OFF} no similarity
          Length = 96

 Score =  110 bits (276), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 63/87 (72%)

Query: 9  KKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPMQLSSQLLQNRRH 68
          K+KQ ES FLR WI  DV  V+K H  LP+WPAV  FVP + +  G +   S++L NRRH
Sbjct: 9  KEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKSEILLNRRH 68

Query: 69 FLKITGFHKIHNFAVYASGRDDSCQIL 95
          FLKIT FH++  FAV+ASGRD++C+IL
Sbjct: 69 FLKITNFHRVEKFAVFASGRDNNCRIL 95

>Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 bp,
           180 aa] {ON} YIL009C-A (REAL)
          Length = 180

 Score =  109 bits (272), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/183 (37%), Positives = 103/183 (56%), Gaps = 8/183 (4%)

Query: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPM-QLS 59
           MP+       K  +S FL+ WI+  V +    H      P+ ER +PS+ R D  +  +S
Sbjct: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQH-----RPS-ERVIPSLTRQDLLVPHMS 54

Query: 60  SQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQIL-VEFTPKCVSQFERRHGLRITART 118
           +Q+L N  HF KIT F+ + N+ V AS RD + QIL VEF+ +CVS FER H  RIT+ T
Sbjct: 55  AQILTNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSET 114

Query: 119 VNTIFLIGAVTIKYIPIYEVRETWCWASDLDTRIPVLPVLVVNECTVFDLDQVESRRKFN 178
           +N + +IG   + Y+   +V   +       +   +LPVL +N+ T+FD+DQV S   F 
Sbjct: 115 INCLMIIGDADLIYVTSNQVMARFKIRVSSISPNEILPVLKINQTTIFDIDQVGSLSTFP 174

Query: 179 YLY 181
           ++Y
Sbjct: 175 FVY 177

>NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 bp,
           196 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 196

 Score =  109 bits (273), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/195 (32%), Positives = 105/195 (53%), Gaps = 10/195 (5%)

Query: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPMQLSS 60
           MP+     K+   +S FL+ WI   + + ++    LP    +     S    D P ++S 
Sbjct: 1   MPRVILSSKQTVSDSVFLQPWIANIIRKEIQAKTYLPGNQRLSIARLSRRDMDAP-EISE 59

Query: 61  QLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITARTVN 120
            +L N  HF K+T F  ++N+ ++AS RD + QILVEFTP+CV +FER +  RIT+ TVN
Sbjct: 60  TILNNYSHFAKVTKFFSVNNYKIFASIRDSTYQILVEFTPQCVLEFERVYRSRITSETVN 119

Query: 121 TIFLIGAVTIKY---------IPIYEVRETWCWASDLDTRIPVLPVLVVNECTVFDLDQV 171
            +F+IG  T+ Y          P ++++      +       + PVL +N+ ++FD DQV
Sbjct: 120 CLFVIGDCTVIYKTRSQIRSSFPKFDLQSLAGEKNSNKNGFGLFPVLQINQASLFDSDQV 179

Query: 172 ESRRKFNYLYHLSHF 186
           +   +F ++Y+  HF
Sbjct: 180 QLLFEFPFIYNKLHF 194

>Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [507
           bp, 168 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 168

 Score =  108 bits (271), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 94/175 (53%), Gaps = 14/175 (8%)

Query: 4   PSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSD-GPMQLSSQL 62
           P AI   K  +S FL+ WIQ  + E              +R +P +   D    +LSS++
Sbjct: 2   PQAIVSVKPFDSVFLQPWIQTALAEHDPR--------LGDRLIPPVPTQDLSQPELSSKV 53

Query: 63  LQNRRHFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITARTVNTI 122
           L N RHF+K+T F  + ++ VYAS RD   Q+LVEFTP+CVS FERR+  RITA T N +
Sbjct: 54  LSNIRHFVKVTRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNCV 113

Query: 123 FLIGAVTIKYIPIYEVRETWCWASDLDTRIPVLPVLVVNECTVFDLDQVESRRKF 177
           F+I    + Y     +   +   +  +T     PVL VN+  +FD DQVES   +
Sbjct: 114 FIIADCQLIYHSPSYIENHYKIVTRGET-----PVLRVNQTAIFDWDQVESLETY 163

>YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp,
           181 aa] {ON}  EST3Component of the telomerase
           holoenzyme, involved in telomere replication
          Length = 181

 Score =  107 bits (268), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 68/185 (36%), Positives = 99/185 (53%), Gaps = 11/185 (5%)

Query: 1   MPKPSAIYKKKQRESCFLRSWIQ---QDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPM- 56
           MPK       K  +S FL+ WI+   +D  E  + H S  V       +PS+ + D  + 
Sbjct: 1   MPKVILESHSKPTDSVFLQPWIKALIEDNSEHDQYHPSGHV-------IPSLTKQDLALP 53

Query: 57  QLSSQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITA 116
            +S  +L N  HF KIT F+ + ++ VYAS RD S QILVEF+ +CVS FER H  RIT+
Sbjct: 54  HMSPTILTNPCHFAKITKFYNVCDYKVYASIRDSSHQILVEFSQECVSNFERTHNCRITS 113

Query: 117 RTVNTIFLIGAVTIKYIPIYEVRETWCWASDLDTRIPVLPVLVVNECTVFDLDQVESRRK 176
            T N + +IG   + Y+        +       +   ++PVL VN+ T+FD+DQV S   
Sbjct: 114 ETTNCLMIIGDADLVYVTNSRAMSHFKICLSNISSKEIVPVLNVNQATIFDIDQVGSLST 173

Query: 177 FNYLY 181
           F ++Y
Sbjct: 174 FPFVY 178

>Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 bp,
           182 aa] {ON} YIL009C-A (REAL)
          Length = 182

 Score =  101 bits (252), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 105/189 (55%), Gaps = 18/189 (9%)

Query: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPM-QLS 59
           MP+       K  +S FL+ WI+  V +  + H   P     +  +P +   D  +  +S
Sbjct: 1   MPRVVLESHSKPTDSIFLQPWIKALVEDNSEHHQYHPS----DHVIPVLTEQDLKLPHMS 56

Query: 60  SQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQIL-VEFTPKCVSQFERRHGLRITART 118
           +++L N  HF KIT F+ + ++ V AS RD + QIL VEF+P+CVS FER H  RITA T
Sbjct: 57  AKILTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAET 116

Query: 119 VNTIFLIG------AVTIKYIPIYEVRETWCWASDLDTRIPVLPVLVVNECTVFDLDQVE 172
           VN + +IG      A + +    +++R +   ++DL      +PVL +N+ T+FD+DQV 
Sbjct: 117 VNCLMIIGDASLINATSSRVKSHFKIRLSSISSNDL------VPVLQINQVTIFDIDQVG 170

Query: 173 SRRKFNYLY 181
           S   F ++Y
Sbjct: 171 SLSAFPFVY 179

>KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558
           bp, 185 aa] {ON} Anc_7.128 YIL009C-A ribosomal
           frameshifting
          Length = 185

 Score =  100 bits (248), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 103/183 (56%), Gaps = 24/183 (13%)

Query: 11  KQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSD--GPMQLSSQLLQNRRH 68
           K +E  F   WI+ ++ ++    +SL     V + +P +  +D   P + S ++L+N+ H
Sbjct: 12  KFQEWIFTHPWIK-NLVKLPTEEISL--MRPVRQIIPKLTTNDLKNPTR-SKRVLKNKTH 67

Query: 69  FLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITARTVNTIFLIGAV 128
           F K+  F+ +HN+ V+A  RD  CQ+LVEF P+CVS FER H  RIT+ TVN +F+IG  
Sbjct: 68  FAKVMKFYSVHNYKVFACIRDSECQLLVEFHPECVSYFERFHHCRITSGTVNCLFVIGNC 127

Query: 129 TIKYIPIYEVRETWCWASDLDTRIPVL----------PVLVVNECTVFDLDQVESRRKFN 178
            ++Y  +  V + +        RI +L          PVLV+N+ TV D  Q+E++  F 
Sbjct: 128 DLEYRSVARVNDEF--------RINILPRKQKLMDQIPVLVINQATVADWGQMEAQTTFP 179

Query: 179 YLY 181
           +++
Sbjct: 180 FVH 182

>KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,
           180 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 180

 Score = 98.2 bits (243), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 99/183 (54%), Gaps = 8/183 (4%)

Query: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPMQLSS 60
           MP      +  + +S F+  WI+  + E  +G +  P++ A+     + VR   P+    
Sbjct: 1   MPTVKLTSQHTRPDSIFIHDWIKPLLDENCQGLLR-PIYRAIPPINNTNVR--NPLSSRP 57

Query: 61  QLLQNRR--HFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITART 118
            LL  +   HF KI  F+K+ NF ++AS RD   QILVEFTP CVS FER +  R+T+ T
Sbjct: 58  SLLTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSDT 117

Query: 119 VNTIFLIGAVTIKYIPIYEVRETWCWASDLDTRIPVLPVLVVNECTVFDLDQVESRRKFN 178
            N   LIG  +I+Y   +E+ + +   +  + R+  LPVL +N+ ++ D DQ     +F 
Sbjct: 118 TNCTLLIGDCSIEYKSSHEISQNY-RLNFPNKRL--LPVLTINQASILDRDQATLLEQFP 174

Query: 179 YLY 181
           ++Y
Sbjct: 175 FVY 177

>Suva_9.195 Chr9
           complement(324112..324381,324353..324373,324377..324652)
           [567 bp, 189 aa] {ON} YIL009C-A (REAL)
          Length = 189

 Score = 98.2 bits (243), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 101/191 (52%), Gaps = 15/191 (7%)

Query: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPM-QLS 59
           MP+       +Q +S FL+ WI+  + +  + H  +P     +  +P++ + D  +  + 
Sbjct: 1   MPRVFLESNSRQVDSIFLQPWIKLLIDDNSEHH-HIPS----DHVIPALAQQDLALPHMC 55

Query: 60  SQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQIL---------VEFTPKCVSQFERRH 110
            Q+L N  HF +IT F+ + ++ VYAS RD + QIL         VEF+ KCVS FER +
Sbjct: 56  PQILTNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERIN 115

Query: 111 GLRITARTVNTIFLIGAVTIKYIPIYEVRETWCWASDLDTRIPVLPVLVVNECTVFDLDQ 170
             RIT+ T N + +IG   + Y+   +    +       +    +P+L++N+ T+FD+DQ
Sbjct: 116 NFRITSETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTSETVPILIINQATIFDIDQ 175

Query: 171 VESRRKFNYLY 181
           V S   F ++Y
Sbjct: 176 VGSLNNFPFVY 186

>Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 aa]
           {ON} (125085..125366,125368..125634) [549 nt, 183 aa]
          Length = 182

 Score = 95.9 bits (237), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 74/116 (63%), Gaps = 1/116 (0%)

Query: 68  HFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITARTVNTIFLIGA 127
           HF K+T F  + +++VYAS RD   Q+L EFT  CVS FER +  RIT  T+N +FLIG 
Sbjct: 66  HFAKVTNFFNVVDYSVYASIRDRKFQVLSEFTSNCVSSFERLYNSRITENTINCLFLIGD 125

Query: 128 VTIKYIPIYEVRETWCW-ASDLDTRIPVLPVLVVNECTVFDLDQVESRRKFNYLYH 182
             +K++  +E++E +    S +  +  + PVL +N+  +FD  Q++S  KF+++Y+
Sbjct: 126 CKLKFMTYWEIKELYKLDLSSICNKNSLYPVLSINQARMFDWSQIKSFEKFDWIYN 181

>KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} similar
           to uniprot|Q03096 Saccharomyces cerevisiae YIL009C-A
           EST3 Component of the telomerase holoenzyme involved in
           telomere replication
          Length = 184

 Score = 89.4 bits (220), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 92/186 (49%), Gaps = 4/186 (2%)

Query: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDG-PMQLS 59
           MP      +    +S FL+ WI+  V      +     WP     V  ++  D       
Sbjct: 1   MPNVVLSSRLTNNDSVFLQEWIKPSVRPYYLKNEKTKFWPEQRELVTDLLEHDIIESAFQ 60

Query: 60  SQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITARTV 119
           + L    + F++I  FH+++++ VYA+ RD +  IL  FT  CV  +E  +  RIT  T+
Sbjct: 61  TALNPAPQRFVRIVKFHRVNDYTVYATIRDSTALILCYFTVDCVLDYETINNDRITLNTL 120

Query: 120 NTIFLIGAVTIKYIPIYEVRETWCWASDLDTRIPVLPVLVVNECTVFDLDQVESRRKFNY 179
           NT+F+IG VT+++   +  RE   W +     + ++PVL + +  +FD DQ+ S  +F +
Sbjct: 121 NTLFVIGNVTLQF---WNHRECKLWFNQDFPGLRMVPVLKIEKARMFDRDQISSNVQFEW 177

Query: 180 LYHLSH 185
           +Y   H
Sbjct: 178 VYDTLH 183

>TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa]
           {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 201

 Score = 79.3 bits (194), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 97/206 (47%), Gaps = 35/206 (16%)

Query: 1   MPK---PSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPMQ 57
           MPK   PS +      +S FL+ WI++ + +  K  +       +      +  ++  +Q
Sbjct: 1   MPKIILPSKV--NLSPDSIFLKPWIKEFIEDGKKNSIG-----KIGNLDELLNNTNVKLQ 53

Query: 58  LSSQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITAR 117
           L   +L+     +K+T  + I N+ V+ S RD+  Q+LVEFT  CVS FER + +RIT +
Sbjct: 54  L---ILKYPNQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQ 110

Query: 118 TVNTIFLIGAVTIKYIPIYEVRETWCWAS-DLDTRIPV---------------------L 155
           T N +FLIG   IKY+   E+ + +       D  I +                      
Sbjct: 111 TKNCLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLY 170

Query: 156 PVLVVNECTVFDLDQVESRRKFNYLY 181
           P+L VN+  +FD DQV +   + ++Y
Sbjct: 171 PILQVNQVMIFDWDQVVTFENYPFVY 196

>Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF}
          ANNOTATED BY YGOB -
          Length = 98

 Score = 68.6 bits (166), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 57/97 (58%), Gaps = 2/97 (2%)

Query: 1  MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSD--GPMQL 58
          MPK +   + K+ +S +L +WI   +   V+   ++ +   V  FVPS+   D    + L
Sbjct: 1  MPKVALSSRNKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVHL 60

Query: 59 SSQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQIL 95
          S +++ N RHF+K+T F++++N+ VYAS RD  C IL
Sbjct: 61 SRKIILNHRHFIKLTKFYQVNNYQVYASARDSLCSIL 97

>TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 bp,
           215 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 215

 Score = 68.9 bits (167), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 63/109 (57%), Gaps = 10/109 (9%)

Query: 68  HFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITARTVNTIFLIGA 127
           H +KIT F K++N+ + AS +D  CQILVE TP CV+++ER+   R+T+ T++ +F+IG 
Sbjct: 91  HIIKITKFFKVNNYKICASVQDAECQILVELTPICVTEYERKTRDRMTSNTLDCLFVIGD 150

Query: 128 VTIKYIPIYEV---------RETWCWASDLDTRIPVLPVLVVNECTVFD 167
             + +    EV         R      + LD R  ++PVLV+N+    D
Sbjct: 151 CRLYFQNKNEVLHNFNCNTFRNIIPGLNALD-RDSLIPVLVINQIICVD 198

>ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa]
          {OFF} some similarities with uniprot|Q03096
          Saccharomyces cerevisiae YIL009C-A
          Length = 87

 Score = 53.9 bits (128), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 48/93 (51%), Gaps = 9/93 (9%)

Query: 4  PSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSD-GPMQLSSQL 62
          P AI   K  +S FL+ WIQ  + E              +R +P +   D    +LSS++
Sbjct: 2  PQAIVSVKPFDSVFLQPWIQTALAEHDPR--------LGDRLIPPVPTQDLSQPELSSKV 53

Query: 63 LQNRRHFLKITGFHKIHNFAVYASGRDDSCQIL 95
          L N RHF+K+T F  + ++ VYAS RD   Q+L
Sbjct: 54 LSNIRHFVKVTRFFDVDHYTVYASIRDSKAQLL 86

>TDEL0F03340 Chr6 (617255..618499) [1245 bp, 414 aa] {ON} Anc_3.451
           YPR118W
          Length = 414

 Score = 29.6 bits (65), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 43/87 (49%), Gaps = 4/87 (4%)

Query: 105 QFERRHGLRITARTVNTIFLIGAVTIKYIPIYEVRETWCWASDLDTR-IPVLPVL-VVNE 162
           +F+R     ++ + ++ + L    T KYIPIY + + +     +  R  P + ++  ++ 
Sbjct: 7   KFDRSEPRHVSVKVLDQLLL--PYTTKYIPIYTIDDGYSVIKTMQVRGAPAIAIVGTLSV 64

Query: 163 CTVFDLDQVESRRKFNYLYHLSHFKDI 189
            T   L Q ES  K  + Y L++++ +
Sbjct: 65  LTEVQLLQSESYTKSQWFYDLTNWESV 91

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.140    0.450 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,059,357
Number of extensions: 773315
Number of successful extensions: 1851
Number of sequences better than 10.0: 29
Number of HSP's gapped: 1863
Number of HSP's successfully gapped: 29
Length of query: 192
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 89
Effective length of database: 41,670,801
Effective search space: 3708701289
Effective search space used: 3708701289
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 62 (28.5 bits)