Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_YGOB_Anc_5.7055.705ON88884571e-60
KLTH0E00990g5.705ON89883851e-49
NCAS0A031805.705ON88872931e-35
SAKL0E14982g5.705ON89882932e-35
Kpol_YGOB_1043.725.705ON88882913e-35
Skud_11.3355.705ON94942792e-33
Smik_11.3595.705ON88882783e-33
TDEL0B021505.705ON91822741e-32
TBLA0G010305.705ON89862713e-32
KAFR0H001905.705ON82822713e-32
YKR095W-A (PCC1)5.705ON88882704e-32
ZYRO0B16368g5.705ON85802634e-31
KNAG0C066205.705ON101862524e-29
Suva_11.3325.705ON111772516e-29
TPHA0E002005.705ON85732471e-28
KLLA0A00539g5.705ON87802443e-28
NDAI0E050605.705ON86842366e-27
Ecym_40165.705ON125742389e-27
AFR289W5.705ON81771844e-19
CAGL0G02535g5.705ON140531539e-14
KAFR0E028808.484ON84031641.1
CAGL0G04191g5.181ON31554622.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_YGOB_Anc_5.705
         (88 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...   180   1e-60
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...   152   1e-49
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...   117   1e-35
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...   117   2e-35
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...   116   3e-35
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...   112   2e-33
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...   111   3e-33
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...   110   1e-32
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...   108   3e-32
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...   108   3e-32
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...   108   4e-32
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...   105   4e-31
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...   101   4e-29
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...   101   6e-29
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...   100   1e-28
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...    99   3e-28
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...    96   6e-27
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    96   9e-27
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    75   4e-19
CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...    64   9e-14
KAFR0E02880 Chr5 (580120..582642) [2523 bp, 840 aa] {ON} Anc_8.4...    29   1.1  
CAGL0G04191g Chr7 complement(399519..400466) [948 bp, 315 aa] {O...    28   2.1  

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644)
          [267 bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  180 bits (457), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 88/88 (100%), Positives = 88/88 (100%)

Query: 1  MKSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEG 60
          MKSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEG
Sbjct: 1  MKSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEG 60

Query: 61 VDDRVLRVGVSSVIESIKTIVETIDEFS 88
          VDDRVLRVGVSSVIESIKTIVETIDEFS
Sbjct: 61 VDDRVLRVGVSSVIESIKTIVETIDEFS 88

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,
          89 aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score =  152 bits (385), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 73/88 (82%), Positives = 80/88 (90%)

Query: 1  MKSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEG 60
          MK +R  +LAYTLYLEVPF+  KQA TAV+VLKPDPILKPQDFHVEY+S A+NLCV FEG
Sbjct: 1  MKGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEG 60

Query: 61 VDDRVLRVGVSSVIESIKTIVETIDEFS 88
          VDDRVLRVGVSSVIESIKTI+ETIDEFS
Sbjct: 61 VDDRVLRVGVSSVIESIKTIIETIDEFS 88

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267
          bp, 88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score =  117 bits (293), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 57/87 (65%), Positives = 66/87 (75%)

Query: 1  MKSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEG 60
          MK+ R ++L Y L LE+PF   +QA  A +VL PDPILKPQDF VEY S  N L V F G
Sbjct: 1  MKNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRG 60

Query: 61 VDDRVLRVGVSSVIESIKTIVETIDEF 87
          +DDRVLRVGVSSVI+SIKTI+ETIDE 
Sbjct: 61 IDDRVLRVGVSSVIDSIKTIIETIDEL 87

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Proposed transcription factor
          involved in the expression of genes regulated by
          alpha-factor and galactose
          Length = 89

 Score =  117 bits (293), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 71/88 (80%)

Query: 1  MKSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEG 60
          MK++R ++L + LYLE+P +   QA  A++ LKPDP+LKP+DF VEY+++   LCV F+ 
Sbjct: 1  MKNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKS 60

Query: 61 VDDRVLRVGVSSVIESIKTIVETIDEFS 88
          +DDRVLRVGVSSVIES+KTI+ET+DEF 
Sbjct: 61 IDDRVLRVGVSSVIESVKTIIETMDEFG 88

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,
          88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  116 bits (291), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 70/88 (79%)

Query: 1  MKSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEG 60
          MK+ R + + +TL  E+PF+  +QA  AVQVLKPDPILKPQDF V Y+S+ N L + F+ 
Sbjct: 1  MKTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKS 60

Query: 61 VDDRVLRVGVSSVIESIKTIVETIDEFS 88
          +DDRVLRVGVSSVI+S+KTI+ET+DE S
Sbjct: 61 IDDRVLRVGVSSVIDSVKTIIETMDELS 88

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
          [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score =  112 bits (279), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 56/94 (59%), Positives = 69/94 (73%), Gaps = 6/94 (6%)

Query: 1  MKSSRPLNLAYTLY------LEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNL 54
          M S R ++L YTL       L++PF+ + QA+ A +VL PDPILKPQDF V+Y+S  N +
Sbjct: 1  MTSKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM 60

Query: 55 CVLFEGVDDRVLRVGVSSVIESIKTIVETIDEFS 88
           V F  +DDRVLRVGVSSVI+SIKTIVETIDE S
Sbjct: 61 LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDELS 94

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
          {ON} YKR095W-A (REAL)
          Length = 88

 Score =  111 bits (278), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 67/88 (76%)

Query: 1  MKSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEG 60
          M S R + L +TL L+VPF+ ++QA  A +VL PDPILKPQDF ++Y+S  N + V F  
Sbjct: 1  MSSKREMPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRS 60

Query: 61 VDDRVLRVGVSSVIESIKTIVETIDEFS 88
          +DDRVLRVGVSSVI+SIKT+VE +DE S
Sbjct: 61 IDDRVLRVGVSSVIDSIKTVVEAMDELS 88

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276
          bp, 91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score =  110 bits (274), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 54/82 (65%), Positives = 65/82 (79%)

Query: 7  LNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVL 66
          ++L ++L LE+PFQ   QA  A QVL PDPILKPQDF V+YT++ N L V F+ +DDRVL
Sbjct: 1  MSLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVL 60

Query: 67 RVGVSSVIESIKTIVETIDEFS 88
          RVGVSSVI+SIKTIVETIDE  
Sbjct: 61 RVGVSSVIDSIKTIVETIDELG 82

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
          {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score =  108 bits (271), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%)

Query: 2  KSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGV 61
          K    + + +TL L +PF   KQA  A QVL+PDPIL+PQDF V+YTS  N L + F+ +
Sbjct: 3  KRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSI 62

Query: 62 DDRVLRVGVSSVIESIKTIVETIDEF 87
          DDRVLRVGVSSVI+S+KTI+ET DE 
Sbjct: 63 DDRVLRVGVSSVIDSVKTIIETFDEL 88

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp,
          82 aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score =  108 bits (271), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 64/82 (78%)

Query: 7  LNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVL 66
          +NL +TL LE+PF++ KQA  AV VLKPDPIL+PQDF V Y +  N     FE +DDRVL
Sbjct: 1  MNLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVL 60

Query: 67 RVGVSSVIESIKTIVETIDEFS 88
          RVGVS+VI+S+KTI+ET+DE S
Sbjct: 61 RVGVSNVIDSLKTIIETMDELS 82

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
          {ON}  PCC1Component of the EKC/KEOPS protein complex
          with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
          complex is required for t6A tRNA modification and may
          have roles in telomere maintenance and transcription
          Length = 88

 Score =  108 bits (270), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 51/88 (57%), Positives = 66/88 (75%)

Query: 1  MKSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEG 60
          M S R  +L +TL L++PF+ ++QA  A +VL PDPILKPQDF V+Y+S  N + V F  
Sbjct: 1  MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60

Query: 61 VDDRVLRVGVSSVIESIKTIVETIDEFS 88
          +DDRVLRVGVSS+I+SIKTIVE +D  S
Sbjct: 61 IDDRVLRVGVSSIIDSIKTIVEAMDVLS 88

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A
          Length = 85

 Score =  105 bits (263), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 64/80 (80%)

Query: 8  NLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVLR 67
          +L + L+L +PF ND+ +  AV+VL+PDPIL+P+DF VEY S  N L + F+ VDDRVLR
Sbjct: 3  HLDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLR 62

Query: 68 VGVSSVIESIKTIVETIDEF 87
          VGVSSVI+S+KTIVETIDE 
Sbjct: 63 VGVSSVIDSVKTIVETIDEL 82

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
          aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score =  101 bits (252), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%)

Query: 2  KSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGV 61
          K++RP  L +TL L VPF+  +QA  A QVL+PDPILKPQDF V Y +    L   F G 
Sbjct: 4  KTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGR 63

Query: 62 DDRVLRVGVSSVIESIKTIVETIDEF 87
          D RVLRVGVSSVI+S+KTI+E++DE 
Sbjct: 64 DARVLRVGVSSVIDSLKTIIESLDEL 89

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score =  101 bits (251), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 59/77 (76%)

Query: 12  TLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVLRVGVS 71
           T  L++PF+ +KQA  A +VL PDPILKPQDF  +Y+S  N +   F  +DDRVLRVGVS
Sbjct: 35  TRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLRVGVS 94

Query: 72  SVIESIKTIVETIDEFS 88
           SVI+SIKTI+ET+DE S
Sbjct: 95  SVIDSIKTIIETMDELS 111

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp,
          85 aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score = 99.8 bits (247), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 60/73 (82%)

Query: 15 LEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVLRVGVSSVI 74
          L +PF+  KQA+ A QVLKPDP L+P++F V+Y+S  ++L V F+ VDDRVLRVGVS+VI
Sbjct: 10 LNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNVI 69

Query: 75 ESIKTIVETIDEF 87
          +SIKTI+ETIDE 
Sbjct: 70 DSIKTIIETIDEL 82

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,
          87 aa] {ON} highly similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score = 98.6 bits (244), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 47/80 (58%), Positives = 62/80 (77%)

Query: 8  NLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVLR 67
          +  ++L+LE+PF++ KQA  A +VL PDPI+KP+DF V Y++    L   FE VD+R+LR
Sbjct: 7  SFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILR 66

Query: 68 VGVSSVIESIKTIVETIDEF 87
          VGV+SVIESIKTIVETIDE 
Sbjct: 67 VGVNSVIESIKTIVETIDEL 86

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON}
          Anc_5.705 YKR095W-A
          Length = 86

 Score = 95.5 bits (236), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 4/84 (4%)

Query: 8  NLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEY----TSSANNLCVLFEGVDD 63
           L YTL + +PF  ++ A  A QVL PDPILKP+DF VEY    T   N L V F+ +D+
Sbjct: 3  TLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDE 62

Query: 64 RVLRVGVSSVIESIKTIVETIDEF 87
          RVLRVGVSSV++SIKTI+ET+DE 
Sbjct: 63 RVLRVGVSSVLDSIKTILETMDEL 86

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 96.3 bits (238), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 47/74 (63%), Positives = 56/74 (75%)

Query: 15  LEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVLRVGVSSVI 74
           LEVPF+N KQA  A +VL  DP+L+P+DF V+YT     L V F  +D R LRVGVSSVI
Sbjct: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110

Query: 75  ESIKTIVETIDEFS 88
           ESIKT+VET+DEFS
Sbjct: 111 ESIKTVVETMDEFS 124

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
          Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
          (PCC1); 1-intron
          Length = 81

 Score = 75.5 bits (184), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 51/77 (66%)

Query: 11 YTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVLRVGV 70
          +TL+L VPF++ + A  A + L PDP+L+P++  V + S   +L +    +D RVLRV  
Sbjct: 3  HTLHLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAIDARVLRVAT 62

Query: 71 SSVIESIKTIVETIDEF 87
          +S+ E++KT+VET DE 
Sbjct: 63 NSIFEALKTVVETADEL 79

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
          [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
          unknown function
          Length = 140

 Score = 63.5 bits (153), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 38/53 (71%)

Query: 15 LEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVLR 67
          L VPF+  + A  A +VL+PDPIL+P+DF VEY + A  L + F+ +DDRVLR
Sbjct: 31 LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83

>KAFR0E02880 Chr5 (580120..582642) [2523 bp, 840 aa] {ON} Anc_8.484
           YDR251W
          Length = 840

 Score = 29.3 bits (64), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 42  DFHVEYTSSANNLCVLFEGVDDRVLRVGVSS 72
           +FH   +SS +NL V F+G+D R  ++  SS
Sbjct: 625 NFHEHNSSSVSNLNVPFDGMDSRYNKIPHSS 655

>CAGL0G04191g Chr7 complement(399519..400466) [948 bp, 315 aa] {ON}
           some similarities with uniprot|P53298 Saccharomyces
           cerevisiae YGR179c
          Length = 315

 Score = 28.5 bits (62), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 33  KPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVLRV--GVSSVIESIKTIVETI 84
           KP  IL      +  T+SAN++ ++FE  DD ++R+  G    IE IK   E +
Sbjct: 97  KPSRILVDSVMQLLETNSANSVDIVFEKYDDELMRLLRGKRQEIELIKEDKEKM 150

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,924,415
Number of extensions: 313230
Number of successful extensions: 777
Number of sequences better than 10.0: 22
Number of HSP's gapped: 776
Number of HSP's successfully gapped: 22
Length of query: 88
Length of database: 53,481,399
Length adjustment: 60
Effective length of query: 28
Effective length of database: 46,601,439
Effective search space: 1304840292
Effective search space used: 1304840292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)