Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_YGOB_Anc_3.1873.187ON1121122094e-22
KLTH0E15840g3.187ON1131131521e-13
SAKL0C08008g3.187ON145271375e-11
Klac_YGOB_Anc_3.1873.187ON119251225e-09
TBLA0B016803.187ON40261097e-08
Skud_4.2413.187ON106251103e-07
YDL012C3.187ON107251069e-07
ZYRO0A04972g3.187ON122261071e-06
TDEL0D043403.187ON120241061e-06
KAFR0C008803.187ON121231052e-06
NCAS0I019003.187ON93261032e-06
Ecym_52633.187ON124271042e-06
CAGL0I04510g3.187ON116261033e-06
Smik_2.1353.187ON127261033e-06
Suva_4.2373.187ON103251024e-06
CAGL0K01903g3.187ON10126963e-05
AER212W3.187ON11326964e-05
Skud_2.1283.187ON12722955e-05
KNAG0K012853.187ON12626939e-05
Suva_2.1443.187ON11924912e-04
Kpol_1036.513.187ON7926660.38
NOTE: 3 genes in the same pillar as Kwal_YGOB_Anc_3.187 were not hit in these BLAST results
LIST: Smik_4.222 TBLA0F00730 YBR016W

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_YGOB_Anc_3.187
         (112 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_YGOB_Anc_3.187 s27 complement(77867..78157,78226..78273) [3...    85   4e-22
KLTH0E15840g Chr5 (1406256..1406303,1406400..1406693) [342 bp, 1...    63   1e-13
SAKL0C08008g Chr3 complement(743966..744268,744380..744514) [438...    57   5e-11
Klac_YGOB_Anc_3.187 Chr3 complement(406964..407278,407429..40747...    52   5e-09
TBLA0B01680 Chr2 complement(375921..376043) [123 bp, 40 aa] {ON}...    47   7e-08
Skud_4.241 Chr4 complement(425844..426119,426211..426255) [321 b...    47   3e-07
YDL012C Chr4 complement(431108..431386,431473..431517) [324 bp, ...    45   9e-07
ZYRO0A04972g Chr1 (400197..400235,400324..400653) [369 bp, 122 a...    46   1e-06
TDEL0D04340 Chr4 (792565..792609,792675..792992) [363 bp, 120 aa...    45   1e-06
KAFR0C00880 Chr3 (178337..178375,178475..178801) [366 bp, 121 aa...    45   2e-06
NCAS0I01900 Chr9 (349882..350163) [282 bp, 93 aa] {ON} Anc_3.187...    44   2e-06
Ecym_5263 Chr5 complement(545614..545943,546179..546223) [375 bp...    45   2e-06
CAGL0I04510g Chr9 complement(403225..403527,403675..403722) [351...    44   3e-06
Smik_2.135 Chr2 (250473..250856) [384 bp, 127 aa] {ON} YBR016W (...    44   3e-06
Suva_4.237 Chr4 complement(424387..424653,424741..424785) [312 b...    44   4e-06
CAGL0K01903g Chr11 complement(169669..169974) [306 bp, 101 aa] {...    42   3e-05
AER212W Chr5 (1027712..1027753,1027805..1028104) [342 bp, 113 aa...    42   4e-05
Skud_2.128 Chr2 (243786..244169) [384 bp, 127 aa] {ON} YBR016W (...    41   5e-05
KNAG0K01285 Chr11 complement(253589..253930,254081..254119) [381...    40   9e-05
Suva_2.144 Chr2 (249704..250063) [360 bp, 119 aa] {ON} YBR016W (...    40   2e-04
Kpol_1036.51 s1036 (140002..140004,140137..140373) [240 bp, 79 a...    30   0.38 

>Kwal_YGOB_Anc_3.187 s27 complement(77867..78157,78226..78273) [339
           bp, 112 aa] {ON} ANNOTATED BY YGOB -
          Length = 112

 Score = 85.1 bits (209), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 50/112 (44%)

Query: 1   MSAAEYYKXXXXXXXXXXXXXXXXXXHQQDSRGILPNFQNKXXXXXXXXXXXXXXXXXXX 60
           MSAAEYYK                  HQQDSRGILPNFQNK                   
Sbjct: 1   MSAAEYYKGTSQPQQQYTSPSGPPPGHQQDSRGILPNFQNKPQQAYYGAQQQQYYANQPP 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXRPTNNNSDCLTACLAGMCLCCTLDMLF 112
                                    RPTNNNSDCLTACLAGMCLCCTLDMLF
Sbjct: 61  QYNQQQHFQQPGYYNQQQPIYVQQQRPTNNNSDCLTACLAGMCLCCTLDMLF 112

>KLTH0E15840g Chr5 (1406256..1406303,1406400..1406693) [342 bp, 113
           aa] {ON} similar to uniprot|Q12489 Saccharomyces
           cerevisiae YDL012C Plasma membrane protein of unknown
           function
          Length = 113

 Score = 63.2 bits (152), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 45/113 (39%), Gaps = 1/113 (0%)

Query: 1   MSAAEYYKXXXXXXXXXXXXXXXXXXHQQDSRGILPNFQN-KXXXXXXXXXXXXXXXXXX 59
           MSAAEYYK                    QDSRG   +FQN +                  
Sbjct: 1   MSAAEYYKGTSESKQQYTSPAGPPPGAYQDSRGFGSHFQNNQPQQAYYGAQQQQYYANQP 60

Query: 60  XXXXXXXXXXXXXXXXXXXXXXXXXXRPTNNNSDCLTACLAGMCLCCTLDMLF 112
                                     RPTNNNSDCLTACLAGMCLCCTLDMLF
Sbjct: 61  PQYNQQQHYQQPGYYNQQQPIYVQQQRPTNNNSDCLTACLAGMCLCCTLDMLF 113

>SAKL0C08008g Chr3 complement(743966..744268,744380..744514) [438
           bp, 145 aa] {ON} similar to uniprot|Q12489 Saccharomyces
           cerevisiae YDL012C Plasma membrane protein of unknown
           function
          Length = 145

 Score = 57.4 bits (137), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 25/27 (92%), Positives = 26/27 (96%)

Query: 86  RPTNNNSDCLTACLAGMCLCCTLDMLF 112
           RPT+NN DCLTACLAGMCLCCTLDMLF
Sbjct: 119 RPTSNNQDCLTACLAGMCLCCTLDMLF 145

>Klac_YGOB_Anc_3.187 Chr3 complement(406964..407278,407429..407473)
           [360 bp, 119 aa] {ON} ANNOTATED BY YGOB -
          Length = 119

 Score = 51.6 bits (122), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%)

Query: 88  TNNNSDCLTACLAGMCLCCTLDMLF 112
           + NNSDCLTACLAGMCLCCTLDMLF
Sbjct: 95  SRNNSDCLTACLAGMCLCCTLDMLF 119

>TBLA0B01680 Chr2 complement(375921..376043) [123 bp, 40 aa] {ON}
           Anc_3.187 YDL012C
          Length = 40

 Score = 46.6 bits (109), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 20/26 (76%), Positives = 24/26 (92%)

Query: 87  PTNNNSDCLTACLAGMCLCCTLDMLF 112
           PT+NN DC+TACLA +C+CCTLDMLF
Sbjct: 15  PTSNNDDCMTACLAALCVCCTLDMLF 40

>Skud_4.241 Chr4 complement(425844..426119,426211..426255) [321 bp,
           106 aa] {ON} YDL012C (REAL)
          Length = 106

 Score = 47.0 bits (110), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 21/25 (84%)

Query: 88  TNNNSDCLTACLAGMCLCCTLDMLF 112
           +  N DCLT CLAG+CLCCTLDMLF
Sbjct: 82  STGNGDCLTGCLAGLCLCCTLDMLF 106

>YDL012C Chr4 complement(431108..431386,431473..431517) [324 bp, 107
           aa] {ON} Tail-anchored plasma membrane protein
           containing a conserved CYSTM module, possibly involved
           in response to stress; may contribute to non-homologous
           end-joining (NHEJ) based on ydl012c htz1 double null
           phenotype
          Length = 107

 Score = 45.4 bits (106), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 21/25 (84%)

Query: 88  TNNNSDCLTACLAGMCLCCTLDMLF 112
           ++ N DCL  CLAG+CLCCTLDMLF
Sbjct: 83  SSGNEDCLAGCLAGLCLCCTLDMLF 107

>ZYRO0A04972g Chr1 (400197..400235,400324..400653) [369 bp, 122 aa]
           {ON} weakly similar to uniprot|P38216 Saccharomyces
           cerevisiae YBR016W
          Length = 122

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 21/26 (80%)

Query: 87  PTNNNSDCLTACLAGMCLCCTLDMLF 112
           P   N DCLTACLA +C+CCTLDMLF
Sbjct: 97  PQRGNEDCLTACLAVLCVCCTLDMLF 122

>TDEL0D04340 Chr4 (792565..792609,792675..792992) [363 bp, 120 aa]
           {ON} Anc_3.187 YDL012C
          Length = 120

 Score = 45.4 bits (106), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (87%)

Query: 89  NNNSDCLTACLAGMCLCCTLDMLF 112
           + N DCLTACLA MC+CCTLDMLF
Sbjct: 97  SGNQDCLTACLAAMCICCTLDMLF 120

>KAFR0C00880 Chr3 (178337..178375,178475..178801) [366 bp, 121 aa]
           {ON} Anc_3.187 YDL012C
          Length = 121

 Score = 45.1 bits (105), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/23 (82%), Positives = 20/23 (86%)

Query: 90  NNSDCLTACLAGMCLCCTLDMLF 112
            N DCLTACLA MC+CCTLDMLF
Sbjct: 99  GNEDCLTACLAAMCICCTLDMLF 121

>NCAS0I01900 Chr9 (349882..350163) [282 bp, 93 aa] {ON} Anc_3.187
           YBR016W
          Length = 93

 Score = 44.3 bits (103), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 20/26 (76%)

Query: 87  PTNNNSDCLTACLAGMCLCCTLDMLF 112
           P   N DCLT CLAG+C+CCTLDML 
Sbjct: 68  PQRGNEDCLTGCLAGLCICCTLDMLM 93

>Ecym_5263 Chr5 complement(545614..545943,546179..546223) [375 bp,
           124 aa] {ON} similar to Ashbya gossypii AER212W
          Length = 124

 Score = 44.7 bits (104), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 18/27 (66%), Positives = 20/27 (74%)

Query: 86  RPTNNNSDCLTACLAGMCLCCTLDMLF 112
           +P +    CL ACLAG CLCCTLDMLF
Sbjct: 98  QPESKKDSCLMACLAGACLCCTLDMLF 124

>CAGL0I04510g Chr9 complement(403225..403527,403675..403722) [351
           bp, 116 aa] {ON} similar to uniprot|P38216 Saccharomyces
           cerevisiae YBR016w and similar to uniprot|Q12489
           Saccharomyces cerevisiae YDL012c
          Length = 116

 Score = 44.3 bits (103), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 21/26 (80%)

Query: 87  PTNNNSDCLTACLAGMCLCCTLDMLF 112
           P   N DC+TACLA +C+CCTLD+LF
Sbjct: 91  PQRGNDDCMTACLAALCICCTLDLLF 116

>Smik_2.135 Chr2 (250473..250856) [384 bp, 127 aa] {ON} YBR016W
           (REAL)
          Length = 127

 Score = 44.3 bits (103), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 20/26 (76%)

Query: 87  PTNNNSDCLTACLAGMCLCCTLDMLF 112
           P   N  C+TACLA +C+CCT+DMLF
Sbjct: 102 PQKGNEGCITACLAALCICCTMDMLF 127

>Suva_4.237 Chr4 complement(424387..424653,424741..424785) [312 bp,
           103 aa] {ON} YDL012C (REAL)
          Length = 103

 Score = 43.9 bits (102), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 21/25 (84%)

Query: 88  TNNNSDCLTACLAGMCLCCTLDMLF 112
           ++ N DCLT CLAG+CLCCTLDML 
Sbjct: 79  SSGNQDCLTGCLAGLCLCCTLDMLI 103

>CAGL0K01903g Chr11 complement(169669..169974) [306 bp, 101 aa] {ON}
           no similarity
          Length = 101

 Score = 41.6 bits (96), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 19/26 (73%)

Query: 87  PTNNNSDCLTACLAGMCLCCTLDMLF 112
           P N N DCL ACLA MC+C TLD+L 
Sbjct: 76  PQNGNEDCLMACLAAMCICLTLDLLI 101

>AER212W Chr5 (1027712..1027753,1027805..1028104) [342 bp, 113 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL012C and YBR016W; 1-intron
          Length = 113

 Score = 41.6 bits (96), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 21/26 (80%), Gaps = 1/26 (3%)

Query: 87  PTNNNSDCLTACLAGMCLCCTLDMLF 112
           P+ N+S CL ACL GMCLC TLDMLF
Sbjct: 89  PSKNDS-CLVACLGGMCLCYTLDMLF 113

>Skud_2.128 Chr2 (243786..244169) [384 bp, 127 aa] {ON} YBR016W
           (REAL)
          Length = 127

 Score = 41.2 bits (95), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 19/22 (86%)

Query: 91  NSDCLTACLAGMCLCCTLDMLF 112
           N  C+TACLA +C+CCT+DMLF
Sbjct: 106 NEGCITACLAALCICCTMDMLF 127

>KNAG0K01285 Chr11 complement(253589..253930,254081..254119) [381
           bp, 126 aa] {ON}
          Length = 126

 Score = 40.4 bits (93), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 87  PTNNNSDCLTACLAGMCLCCTLDMLF 112
           P   N DC+TACLA +C+CC ++M+F
Sbjct: 101 PQRGNDDCMTACLAALCVCCAMNMIF 126

>Suva_2.144 Chr2 (249704..250063) [360 bp, 119 aa] {ON} YBR016W
           (REAL)
          Length = 119

 Score = 39.7 bits (91), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 19/24 (79%)

Query: 89  NNNSDCLTACLAGMCLCCTLDMLF 112
             N  C+TACLA +C+CCT+DMLF
Sbjct: 96  KGNEGCMTACLAALCICCTMDMLF 119

>Kpol_1036.51 s1036 (140002..140004,140137..140373) [240 bp, 79 aa]
           {ON} (140002..140004,140137..140373) [240 nt, 80 aa]
          Length = 79

 Score = 30.0 bits (66), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 87  PTNNNSDCLTACLAGMCLCCTLDMLF 112
           P   N DC+TACLA +C+  TL++  
Sbjct: 54  PQRGNEDCMTACLAALCVLFTLNLFI 79

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.134    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,689,977
Number of extensions: 70248
Number of successful extensions: 127
Number of sequences better than 10.0: 25
Number of HSP's gapped: 126
Number of HSP's successfully gapped: 27
Length of query: 112
Length of database: 53,481,399
Length adjustment: 82
Effective length of query: 30
Effective length of database: 44,078,787
Effective search space: 1322363610
Effective search space used: 1322363610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)