Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_55.20373singletonOFF1151156001e-81
Kwal_YGOB_ADL119W7.195ON1151156001e-81
KLTH0E04576g7.195ON1151043474e-43
TDEL0H025207.195ON1191112522e-28
Ecym_43817.195ON1201092494e-28
TPHA0C045207.195ON1351132332e-25
SAKL0F07480g7.195ON1131112302e-25
Kpol_1063.107.195ON1221102295e-25
ZYRO0D15818g7.195ON1181102243e-24
CAGL0D05148g7.195ON108982155e-23
KLLA0D16192g7.195ON1211002122e-22
NCAS0E018207.195ON1141051992e-20
ADL119W7.195ON1851051789e-17
NDAI0G019907.195ON101791632e-15
KAFR0G029907.195ON110831643e-15
Scer_YGOB_ADL119W (ADL119W)7.195ON96941623e-15
TBLA0J015107.195ON1071041503e-13
Skud_6.1257.195ON225941512e-12
KNAG0L012307.195ON128801462e-12
Suva_6.1147.195ON2681011012e-05
KLLA0A05621g1.216ON406535670.87
Kpol_1054.282.52ON68351608.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_YGOB_ADL119W
         (115 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.20373 s55 complement(377983..378330) [348 bp, 115 aa] {O...   235   1e-81
Kwal_YGOB_ADL119W s55 complement(377983..378330) [348 bp, 115 aa...   235   1e-81
KLTH0E04576g Chr5 complement(414398..414745) [348 bp, 115 aa] {O...   138   4e-43
TDEL0H02520 Chr8 complement(424797..425156) [360 bp, 119 aa] {ON...   101   2e-28
Ecym_4381 Chr4 complement(802807..803169) [363 bp, 120 aa] {ON} ...   100   4e-28
TPHA0C04520 Chr3 (975080..975487) [408 bp, 135 aa] {ON} Anc_7.19...    94   2e-25
SAKL0F07480g Chr6 (571315..571656) [342 bp, 113 aa] {ON} conserv...    93   2e-25
Kpol_1063.10 s1063 complement(28076..28444) [369 bp, 122 aa] {ON...    93   5e-25
ZYRO0D15818g Chr4 (1321075..1321431) [357 bp, 118 aa] {ON} conse...    91   3e-24
CAGL0D05148g Chr4 complement(492687..493013) [327 bp, 108 aa] {O...    87   5e-23
KLLA0D16192g Chr4 (1364216..1364581) [366 bp, 121 aa] {ON} conse...    86   2e-22
NCAS0E01820 Chr5 complement(355133..355477) [345 bp, 114 aa] {ON...    81   2e-20
ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No...    73   9e-17
NDAI0G01990 Chr7 complement(449171..449476) [306 bp, 101 aa] {ON...    67   2e-15
KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.19...    68   3e-15
Scer_YGOB_ADL119W Chr6 (226260..226550) [291 bp, 96 aa] {ON} ANN...    67   3e-15
TBLA0J01510 Chr10 complement(344073..344396) [324 bp, 107 aa] {O...    62   3e-13
Skud_6.125 Chr6 (221029..221706) [678 bp, 225 aa] {ON}  (REAL)         63   2e-12
KNAG0L01230 Chr12 (218769..219155) [387 bp, 128 aa] {ON} Anc_7.1...    61   2e-12
Suva_6.114 Chr6 (192307..193113) [807 bp, 268 aa] {ON}  (REAL)         44   2e-05
KLLA0A05621g Chr1 complement(516514..528711) [12198 bp, 4065 aa]...    30   0.87 
Kpol_1054.28 s1054 (68326..70377) [2052 bp, 683 aa] {ON} (68326....    28   8.1  

>Kwal_55.20373 s55 complement(377983..378330) [348 bp, 115 aa] {OFF}
           [contig 149] FULL
          Length = 115

 Score =  235 bits (600), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%)

Query: 1   MTVKSSVGTPQKVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKV 60
           MTVKSSVGTPQKVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKV
Sbjct: 1   MTVKSSVGTPQKVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKV 60

Query: 61  VLRDVLLLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLVPKRM 115
           VLRDVLLLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLVPKRM
Sbjct: 61  VLRDVLLLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLVPKRM 115

>Kwal_YGOB_ADL119W s55 complement(377983..378330) [348 bp, 115 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 115

 Score =  235 bits (600), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%)

Query: 1   MTVKSSVGTPQKVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKV 60
           MTVKSSVGTPQKVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKV
Sbjct: 1   MTVKSSVGTPQKVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKV 60

Query: 61  VLRDVLLLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLVPKRM 115
           VLRDVLLLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLVPKRM
Sbjct: 61  VLRDVLLLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLVPKRM 115

>KLTH0E04576g Chr5 complement(414398..414745) [348 bp, 115 aa] {ON}
           conserved hypothetical protein
          Length = 115

 Score =  138 bits (347), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 63/104 (60%), Positives = 85/104 (81%)

Query: 11  QKVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRDVLLLPF 70
           QKV++PDLRFEQTF+ AL+REA KN++  ++  + TD+++ +SAS+ICKVVLRDVLL+PF
Sbjct: 11  QKVAVPDLRFEQTFQRALRREASKNQKATSQGHSTTDADATISASVICKVVLRDVLLMPF 70

Query: 71  LQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLVPKR 114
           LQG LWT  LIA++PWL  V+++G  +G RIY +VLGK LV KR
Sbjct: 71  LQGILWTSALIALKPWLHMVRIRGQLVGHRIYEMVLGKGLVRKR 114

>TDEL0H02520 Chr8 complement(424797..425156) [360 bp, 119 aa] {ON}
           Anc_7.195 Scer_YGOB_ADL119W
          Length = 119

 Score =  101 bits (252), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 73/111 (65%), Gaps = 11/111 (9%)

Query: 15  IPDLRFEQTFKNALKREALKNK--QYKAKNGTD-------TDSESP-LSASIICKVVLRD 64
           +PD RFEQTF+ AL REA K++  Q++     D         ++ P +S  ++CKVVLRD
Sbjct: 7   VPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVCKVVLRD 66

Query: 65  VLLLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLV-PKR 114
           V+ +P +QG LWTGVLIAM+PWL +    G +LG  IY LVLG DLV PKR
Sbjct: 67  VIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLVKPKR 117

>Ecym_4381 Chr4 complement(802807..803169) [363 bp, 120 aa] {ON}
           similar to Ashbya gossypii ADL119W
          Length = 120

 Score =  100 bits (249), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 71/109 (65%), Gaps = 8/109 (7%)

Query: 13  VSIPDLRFEQTFKNALKREALKNKQYKAKN--------GTDTDSESPLSASIICKVVLRD 64
           ++IPD+RFEQTF  ALK+EALK  QYK +          ++   E  ++  ++ KV++RD
Sbjct: 6   LAIPDIRFEQTFMVALKKEALKQHQYKIRKLKGSQDIVVSEDFGEPTITTFVVAKVIVRD 65

Query: 65  VLLLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLVPK 113
           V+LLP + G LWTG LI M+PWL      G +LG  IYN+++G+++ PK
Sbjct: 66  VVLLPLVHGMLWTGFLIMMKPWLKACTQNGRRLGAGIYNVIVGRNVYPK 114

>TPHA0C04520 Chr3 (975080..975487) [408 bp, 135 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 135

 Score = 94.4 bits (233), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 75/113 (66%), Gaps = 10/113 (8%)

Query: 9   TPQK-VSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSE---------SPLSASIIC 58
            PQ+ + +PD+R EQ+F NAL++EA K +  K K     DS+         + ++  I+ 
Sbjct: 18  VPQETLKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVW 77

Query: 59  KVVLRDVLLLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLV 111
           KV+LRD++L+PF+QGAL+TG+L+A++PWL  V   G + G  IY LVLGKDLV
Sbjct: 78  KVILRDMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDLV 130

>SAKL0F07480g Chr6 (571315..571656) [342 bp, 113 aa] {ON} conserved
           hypothetical protein
          Length = 113

 Score = 93.2 bits (230), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 78/111 (70%), Gaps = 4/111 (3%)

Query: 7   VGTP-QKVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDT-DSESPLSASIICKVVLRD 64
           V TP Q + +PD RFEQTFKNALK+EA + K   A+ G  T D  +P++  ++ KVV+RD
Sbjct: 5   VTTPIQTIVVPDTRFEQTFKNALKKEAKRMKA--ARLGITTLDDNAPVTPMVVAKVVVRD 62

Query: 65  VLLLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLVPKRM 115
           VLL+P +QG LWT  LIA++PWL +   QG + G  +Y LVLGKDLV KR+
Sbjct: 63  VLLMPLVQGVLWTSFLIAIKPWLRNAVWQGRRFGMSVYRLVLGKDLVRKRV 113

>Kpol_1063.10 s1063 complement(28076..28444) [369 bp, 122 aa] {ON}
           complement(28076..28444) [369 nt, 123 aa]
          Length = 122

 Score = 92.8 bits (229), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 46/110 (41%), Positives = 72/110 (65%), Gaps = 9/110 (8%)

Query: 10  PQKVSIPDLRFEQTFKNALKREALKNKQYK-AKNGTDTD-------SESP-LSASIICKV 60
           P    +PD+RFE+TF  A+ +EA K ++Y   K G  TD       +E+P ++  I+ KV
Sbjct: 7   PTNFPVPDVRFEETFNRAINKEAEKQREYSLKKKGLTTDEISKIKENEAPEVTTYIVWKV 66

Query: 61  VLRDVLLLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDL 110
           ++RD+L++PF+QG +++G+LI ++PWL  V   G + G  IYN VLGK+L
Sbjct: 67  IVRDMLIMPFIQGIMFSGLLIILKPWLRSVVGNGRRFGTFIYNTVLGKNL 116

>ZYRO0D15818g Chr4 (1321075..1321431) [357 bp, 118 aa] {ON}
           conserved hypothetical protein
          Length = 118

 Score = 90.9 bits (224), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 63/110 (57%), Gaps = 10/110 (9%)

Query: 15  IPDLRFEQTFKNALKREALKNKQYKAK----------NGTDTDSESPLSASIICKVVLRD 64
           IPD RFE TFK AL REA K +  + K          N    +    +++ ++CKVV RD
Sbjct: 7   IPDTRFESTFKRALNREAEKQRTLQWKKMGVEDPLVINQLQKNQPVKINSYVVCKVVARD 66

Query: 65  VLLLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLVPKR 114
           V+ +P +QG LWT +LI M+PWL  V   G + G  IY  VLG DL+ K+
Sbjct: 67  VIFMPLVQGLLWTSLLITMKPWLRSVIQNGRKFGTFIYRTVLGTDLIKKK 116

>CAGL0D05148g Chr4 complement(492687..493013) [327 bp, 108 aa] {ON}
           some similarities with KLLA0D16192g Kluyveromyces lactis
           and DEHA0C08349g Debaryomyces hansenii
          Length = 108

 Score = 87.4 bits (215), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 61/98 (62%), Gaps = 2/98 (2%)

Query: 13  VSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRDVLLLPFLQ 72
           + IPD RFEQTF+ A+ RE  K      K+ TD D +S  SA +ICKVV+RDVLL+PF+Q
Sbjct: 5   IKIPDTRFEQTFRRAIDREVAKQNALSGKS-TD-DKKSGPSAYVICKVVVRDVLLMPFIQ 62

Query: 73  GALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDL 110
             LWTG L+ ++PWL  V   G + G  +   + G  L
Sbjct: 63  SVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRL 100

>KLLA0D16192g Chr4 (1364216..1364581) [366 bp, 121 aa] {ON}
           conserved hypothetical protein
          Length = 121

 Score = 86.3 bits (212), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 60/100 (60%)

Query: 12  KVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRDVLLLPFL 71
           K S+PDLRFEQTFK +L++EALK  +        +  + P++  I+ KVV RD+L+ PFL
Sbjct: 15  KASLPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIVAKVVARDILISPFL 74

Query: 72  QGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLV 111
           QG   +   I  +PWL + +  G  +GR I   + GK+ +
Sbjct: 75  QGVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFGKNAI 114

>NCAS0E01820 Chr5 complement(355133..355477) [345 bp, 114 aa] {ON}
           Anc_7.195
          Length = 114

 Score = 81.3 bits (199), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 62/105 (59%), Gaps = 9/105 (8%)

Query: 13  VSIPDLRFEQTFKNALKREALKNKQYKAKN------GTDTDSESPLSASIICKVVLRDVL 66
           ++IPDLR EQTFK A+ +E    K+Y  KN       T T+      A I  KV+LRD+L
Sbjct: 6   LNIPDLRVEQTFKRAVAKE---TKEYIIKNKATFPRSTITELTRVEKAVICSKVILRDIL 62

Query: 67  LLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLV 111
           ++PFLQ   WTG LI ++PWL      G ++G    +L+ G++LV
Sbjct: 63  VMPFLQSVAWTGFLIVLKPWLRTTVTFGRKMGSSAMDLITGRNLV 107

>ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No
           homolog in Saccharomyces cerevisiae
          Length = 185

 Score = 73.2 bits (178), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 72/105 (68%), Gaps = 3/105 (2%)

Query: 11  QKVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDT--DSESPLSASIICKVVLRDVLLL 68
           + ++IPD+RFEQTF+ AL +E+ + +Q +A+   +   D E+ +SA ++ KVV+RDVLL+
Sbjct: 78  KAITIPDVRFEQTFRAALAKESARQRQLRAQKEGEAAADGEAGISALVVAKVVVRDVLLM 137

Query: 69  PFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLVPK 113
           P +QGALWTG+LI M+P L    + G +  +  Y  ++G D+ P+
Sbjct: 138 PLVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVG-DVRPR 181

>NDAI0G01990 Chr7 complement(449171..449476) [306 bp, 101 aa] {ON}
          Anc_7.195
          Length = 101

 Score = 67.4 bits (163), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 3/79 (3%)

Query: 11 QKVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRDVLLLPF 70
          + + IPD RF+Q F+NAL+RE  +NK Y      +T +    S  +I KV+LRDV+LLPF
Sbjct: 2  KTIVIPDTRFQQVFQNALERE--RNKLYPDTTKQNTGTLVTESL-VIFKVILRDVILLPF 58

Query: 71 LQGALWTGVLIAMRPWLWH 89
          +Q  LWT  LI  +P ++ 
Sbjct: 59 IQSVLWTEFLIVCKPRIYR 77

>KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.195
          Scer_YGOB_ADL119W
          Length = 110

 Score = 67.8 bits (164), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 51/83 (61%), Gaps = 5/83 (6%)

Query: 5  SSVGTPQKVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRD 64
          + +     ++IPD RF   F+ A+++E    KQ K    TD+D++      IICKV+ RD
Sbjct: 4  AGIHINNNLAIPDTRFGYVFRKAVQKEL--RKQVKE---TDSDNKHINKNLIICKVIARD 58

Query: 65 VLLLPFLQGALWTGVLIAMRPWL 87
          V+L+PF+Q  LWTG LI+ +P L
Sbjct: 59 VILMPFIQSILWTGFLISFKPCL 81

>Scer_YGOB_ADL119W Chr6 (226260..226550) [291 bp, 96 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 96

 Score = 67.0 bits (162), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 55/94 (58%), Gaps = 13/94 (13%)

Query: 9   TPQK-VSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRDVLL 67
           TP K ++IPDLRFE+ FK AL RE   +     K G            +I KVV+RDVLL
Sbjct: 8   TPNKHLNIPDLRFEKVFKKALHRELAPSSSLSRKAG------------VITKVVVRDVLL 55

Query: 68  LPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRI 101
           +P LQ  + +  L+ ++ WL +++++G  LG RI
Sbjct: 56  MPLLQSFVLSLALMGVKEWLSYIRLKGRTLGDRI 89

>TBLA0J01510 Chr10 complement(344073..344396) [324 bp, 107 aa] {ON}
           Anc_7.195 Scer_YGOB_ADL119W
          Length = 107

 Score = 62.4 bits (150), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 51/104 (49%), Gaps = 4/104 (3%)

Query: 6   SVGTPQKV-SIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRD 64
           SV  P+ V  IPD RFE TF+  L +E  KN      + +    E       + KV+ RD
Sbjct: 2   SVAKPKLVIPIPDTRFESTFRRKLDKELNKNN---VNSNSIIKDERVRKLLCLGKVICRD 58

Query: 65  VLLLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGK 108
           V+ +PF+QG    G  I ++PWL  +   G  +GR    L  G+
Sbjct: 59  VIFMPFVQGMFMCGAFILIKPWLLKLLRNGKNIGRNFVELFGGQ 102

>Skud_6.125 Chr6 (221029..221706) [678 bp, 225 aa] {ON}  (REAL)
          Length = 225

 Score = 62.8 bits (151), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (59%), Gaps = 13/94 (13%)

Query: 9   TPQK-VSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRDVLL 67
           TP + ++IPDLRFE+ FK AL RE   +            S  P   ++I KVV+RDVLL
Sbjct: 137 TPNRHLNIPDLRFEKVFKKALHRELAPS------------SSVPSKWAVITKVVVRDVLL 184

Query: 68  LPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRI 101
           +P LQ  + + VL+ ++ WL  ++++G  LG R+
Sbjct: 185 MPLLQSFVLSLVLMGVKDWLRFIRLEGRTLGGRL 218

>KNAG0L01230 Chr12 (218769..219155) [387 bp, 128 aa] {ON}
          Anc_7.195 Scer_YGOB_ADL119W
          Length = 128

 Score = 60.8 bits (146), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (58%), Gaps = 16/80 (20%)

Query: 9  TPQK----VSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRD 64
          TP+K    + IP++RF   F NALK EA ++   +             +  ++CKVV +D
Sbjct: 26 TPRKGSLPIKIPEMRFNYVFNNALKAEAARHNVAEP------------TTWMVCKVVCKD 73

Query: 65 VLLLPFLQGALWTGVLIAMR 84
          VLL+PFLQ  LWT +LI+M+
Sbjct: 74 VLLMPFLQSFLWTALLISMK 93

>Suva_6.114 Chr6 (192307..193113) [807 bp, 268 aa] {ON}  (REAL)
          Length = 268

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 58/101 (57%), Gaps = 12/101 (11%)

Query: 1   MTVKSSVGTPQKVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKV 60
           M V S+    ++++IPDLRF + F+ AL R+   +     K             +++ KV
Sbjct: 173 MNVPSAPTPNKQLNIPDLRFGKVFERALYRDLTPSASRSRK------------LAVVAKV 220

Query: 61  VLRDVLLLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRI 101
           V+RDVLL+P +Q  + + VLI ++ WL +++++G  LG R+
Sbjct: 221 VVRDVLLMPLVQSIVLSVVLIGVKDWLRYIRLKGFTLGARL 261

>KLLA0A05621g Chr1 complement(516514..528711) [12198 bp, 4065 aa] {ON}
            similar to uniprot|P36022 Saccharomyces cerevisiae
            YKR054C DYN1 Cytoplasmic heavy chain dynein microtubule
            motor protein required for anaphase spindle elongation
            involved in spindle assembly chromosome movement and
            spindle orientation during cell division targeted to
            microtubule tips by Pac1p
          Length = 4065

 Score = 30.4 bits (67), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 22/35 (62%)

Query: 13   VSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTD 47
            ++  D+ ++Q+F N  KR +L+NK +  +NG   D
Sbjct: 3329 LATSDIAYDQSFNNLAKRVSLENKSFWIENGLSED 3363

>Kpol_1054.28 s1054 (68326..70377) [2052 bp, 683 aa] {ON}
           (68326..70377) [2052 nt, 684 aa]
          Length = 683

 Score = 27.7 bits (60), Expect = 8.1,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 4   KSSVGTPQKVS-IPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLS 53
           KS  GTPQKV  +   R  Q   N  K  +  +  Y + +G  T S++ LS
Sbjct: 493 KSQAGTPQKVQPVRSNRSGQNMMNNQKNSSGTSISYNSMSGNGTISQADLS 543

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,702,381
Number of extensions: 428281
Number of successful extensions: 1356
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1342
Number of HSP's successfully gapped: 25
Length of query: 115
Length of database: 53,481,399
Length adjustment: 85
Effective length of query: 30
Effective length of database: 43,734,789
Effective search space: 1312043670
Effective search space used: 1312043670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)