Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_YGOB_56.238088.260ON29412941151270.0
Kwal_56.23810singletonOFF27632753141960.0
KLTH0G13728g8.260ON2966298887830.0
SAKL0H17072g8.260ON2997301162620.0
Suva_10.1718.260ON2958300650060.0
Skud_12.1558.260ON2959300749990.0
Smik_12.1468.260ON2958300849890.0
YLR087C (CSF1)8.260ON2958300249890.0
KAFR0B027208.260ON2982303348780.0
NDAI0B019808.260ON2959303547610.0
NCAS0B050108.260ON2952302047470.0
CAGL0L12210g8.260ON2981304846780.0
KNAG0G020308.260ON2998306946450.0
TDEL0F038708.260ON2942302145270.0
ZYRO0C01694g8.260ON3006309644320.0
Kpol_392.78.260ON2995305543170.0
TPHA0J007308.260ON3046294438570.0
TBLA0E044208.260ON3148261137050.0
Ecym_43108.260ON2943154124780.0
AGR088W8.260ON2887152222570.0
KLLA0F19096g8.260ON2923157321340.0
Kwal_56.23808singletonOFF62623292e-35
Smik_6.4276.242ON688105831.3
Suva_16.816.249ON14657771.7
Smik_6.4306.249ON14657762.2
TBLA0J017107.134ON668105793.9
YPL225W6.249ON14657743.9
Skud_16.536.249ON14657736.9
SAKL0F02596g3.497ON113245768.0
Kpol_1004.445.556ON63777768.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_YGOB_56.23808
         (2941 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...  5831   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...  5472   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...  3387   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...  2416   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...  1932   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...  1930   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...  1926   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...  1926   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...  1883   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...  1838   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...  1833   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...  1806   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...  1793   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...  1748   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...  1711   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...  1667   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...  1490   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  1431   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...   959   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...   874   0.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...   826   0.0  
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...   131   2e-35
Smik_6.427 Chr6 complement(692098..694164) [2067 bp, 688 aa] {ON...    37   1.3  
Suva_16.81 Chr16 (135391..135831) [441 bp, 146 aa] {ON} YPL225W ...    34   1.7  
Smik_6.430 Chr6 complement(697895..698335) [441 bp, 146 aa] {ON}...    34   2.2  
TBLA0J01710 Chr10 (377791..379797) [2007 bp, 668 aa] {ON} Anc_7....    35   3.9  
YPL225W Chr16 (126006..126446) [441 bp, 146 aa] {ON} Protein of ...    33   3.9  
Skud_16.53 Chr16 (99521..99961) [441 bp, 146 aa] {ON} YPL225W (R...    33   6.9  
SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] ...    34   8.0  
Kpol_1004.44 s1004 (91177..93090) [1914 bp, 637 aa] {ON} (91177....    34   8.2  

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score = 5831 bits (15127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2848/2941 (96%), Positives = 2848/2941 (96%)

Query: 1    MSSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGV 60
            MSSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGV
Sbjct: 1    MSSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGV 60

Query: 61   KVGRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQSEKAAKLPCRFRIECQG 120
            KVGRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQSEKAAKLPCRFRIECQG
Sbjct: 61   KVGRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQSEKAAKLPCRFRIECQG 120

Query: 121  LEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPSPRATEETSTENDSAAQKSHLXXXXX 180
            LEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPSPRATEETSTENDSAAQKSHL     
Sbjct: 121  LEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPSPRATEETSTENDSAAQKSHLETSMS 180

Query: 181  XXXXXXXXLNDRTYQLPNSMPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHL 240
                    LNDRTYQLPNSMPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHL
Sbjct: 181  SPSASTESLNDRTYQLPNSMPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHL 240

Query: 241  DACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFL 300
            DACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFL
Sbjct: 241  DACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFL 300

Query: 301  RVRKRYLSRGSKTESTRKDLRNPLERWRGLGLYWKENDPAWDDVFHFELPKHEYARYSKV 360
            RVRKRYLSRGSKTESTRKDLRNPLERWRGLGLYWKENDPAWDDVFHFELPKHEYARYSKV
Sbjct: 301  RVRKRYLSRGSKTESTRKDLRNPLERWRGLGLYWKENDPAWDDVFHFELPKHEYARYSKV 360

Query: 361  MKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWA 420
            MKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWA
Sbjct: 361  MKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWA 420

Query: 421  HHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLD 480
            HHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLD
Sbjct: 421  HHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLD 480

Query: 481  FLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNH 540
            FLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNH
Sbjct: 481  FLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNH 540

Query: 541  DILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDP 600
            DILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDP
Sbjct: 541  DILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDP 600

Query: 601  TPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQD 660
            TPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQD
Sbjct: 601  TPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQD 660

Query: 661  SIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVE 720
            SIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVE
Sbjct: 661  SIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVE 720

Query: 721  NIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKAN 780
            NIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKAN
Sbjct: 721  NIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKAN 780

Query: 781  SEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLIL 840
            SEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLIL
Sbjct: 781  SEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLIL 840

Query: 841  PKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEGRCP 900
            PKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEGRCP
Sbjct: 841  PKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEGRCP 900

Query: 901  SRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVXXXXXXXXXXXXFGDAWSKLAF 960
            SRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGV            FGDAWSKLAF
Sbjct: 901  SRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAF 960

Query: 961  SFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENER 1020
            SFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENER
Sbjct: 961  SFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENER 1020

Query: 1021 YSSRADVDIHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDA 1080
            YSSRADVDIHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDA
Sbjct: 1021 YSSRADVDIHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDA 1080

Query: 1081 PFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQ 1140
            PFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQ
Sbjct: 1081 PFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQ 1140

Query: 1141 MGNEHFCSKKEEDGYAFNFASGLMSSTENDSNVESESLVVKLIKPQASISACCIKPFRSF 1200
            MGNEHFCSKKEEDGYAFNFASGLMSSTENDSNVESESLVVKLIKPQASISACCIKPFRSF
Sbjct: 1141 MGNEHFCSKKEEDGYAFNFASGLMSSTENDSNVESESLVVKLIKPQASISACCIKPFRSF 1200

Query: 1201 SDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTS 1260
            SDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTS
Sbjct: 1201 SDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTS 1260

Query: 1261 DTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHE 1320
            DTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHE
Sbjct: 1261 DTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHE 1320

Query: 1321 DQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVV 1380
            DQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVV
Sbjct: 1321 DQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVV 1380

Query: 1381 SVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRL 1440
            SVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRL
Sbjct: 1381 SVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRL 1440

Query: 1441 RHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFY 1500
            RHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFY
Sbjct: 1441 RHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFY 1500

Query: 1501 SQYEGQAGPLNLRVEVDSCSATVSDSTHKEGDMIAVXXXXXXXXXXXXSEMVGSILAIDD 1560
            SQYEGQAGPLNLRVEVDSCSATVSDSTHKEGDMIAV            SEMVGSILAIDD
Sbjct: 1501 SQYEGQAGPLNLRVEVDSCSATVSDSTHKEGDMIAVKGLKLLKKFILKSEMVGSILAIDD 1560

Query: 1561 GTATDGNSLSCSLKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLMEL 1620
            GTATDGNSLSCSLKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLMEL
Sbjct: 1561 GTATDGNSLSCSLKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLMEL 1620

Query: 1621 ALLIDRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNA 1680
            ALLIDRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNA
Sbjct: 1621 ALLIDRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNA 1680

Query: 1681 IIVDAFARRGSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLA 1740
            IIVDAFARRGSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLA
Sbjct: 1681 IIVDAFARRGSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLA 1740

Query: 1741 PKLKFNTRSKDLSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANS 1800
            PKLKFNTRSKDLSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANS
Sbjct: 1741 PKLKFNTRSKDLSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANS 1800

Query: 1801 SLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCD 1860
            SLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCD
Sbjct: 1801 SLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCD 1860

Query: 1861 PREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKY 1920
            PREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKY
Sbjct: 1861 PREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKY 1920

Query: 1921 VGLLVPLGTTXXXXXXXXXXXXXXCDEAAEFSFPLVHGELSVAGISFLINDKELPEDLSK 1980
            VGLLVPLGTT              CDEAAEFSFPLVHGELSVAGISFLINDKELPEDLSK
Sbjct: 1921 VGLLVPLGTTSYISEINELSSSLSCDEAAEFSFPLVHGELSVAGISFLINDKELPEDLSK 1980

Query: 1981 VLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSGLQALKDNA 2040
            VLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSGLQALKDNA
Sbjct: 1981 VLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSGLQALKDNA 2040

Query: 2041 GVKSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYG 2100
            GVKSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYG
Sbjct: 2041 GVKSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYG 2100

Query: 2101 KLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGE 2160
            KLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGE
Sbjct: 2101 KLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGE 2160

Query: 2161 RLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKLPILSSIS 2220
            RLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKLPILSSIS
Sbjct: 2161 RLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKLPILSSIS 2220

Query: 2221 HVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSV 2280
            HVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSV
Sbjct: 2221 HVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSV 2280

Query: 2281 DSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQDVDISFM 2340
            DSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQDVDISFM
Sbjct: 2281 DSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQDVDISFM 2340

Query: 2341 MNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFS 2400
            MNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFS
Sbjct: 2341 MNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFS 2400

Query: 2401 REVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKI 2460
            REVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKI
Sbjct: 2401 REVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKI 2460

Query: 2461 LSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSL 2520
            LSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSL
Sbjct: 2461 LSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSL 2520

Query: 2521 TTEKIWAVTDHYSDWXXXXXXXXXXXXXXXXGRLGGTFLLQNFRWMSQIKWPLNEGSFES 2580
            TTEKIWAVTDHYSDW                GRLGGTFLLQNFRWMSQIKWPLNEGSFES
Sbjct: 2521 TTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFES 2580

Query: 2581 PLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQV 2640
            PLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQV
Sbjct: 2581 PLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQV 2640

Query: 2641 FLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGXXXXXXXXXXXXXXRTEL 2700
            FLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKG              RTEL
Sbjct: 2641 FLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILSSLSFLRTEL 2700

Query: 2701 SVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYK 2760
            SVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYK
Sbjct: 2701 SVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYK 2760

Query: 2761 SQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGK 2820
            SQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGK
Sbjct: 2761 SQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGK 2820

Query: 2821 IGVRWNLGSINFLREMWATHARAMALRRSHNGQSKSFFEDEHXXXXXXXXXXXXEYTYIP 2880
            IGVRWNLGSINFLREMWATHARAMALRRSHNGQSKSFFEDEH            EYTYIP
Sbjct: 2821 IGVRWNLGSINFLREMWATHARAMALRRSHNGQSKSFFEDEHLGDKLKDVDLGDEYTYIP 2880

Query: 2881 LEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARILGR 2940
            LEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARILGR
Sbjct: 2881 LEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARILGR 2940

Query: 2941 A 2941
            A
Sbjct: 2941 A 2941

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score = 5472 bits (14196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2673/2753 (97%), Positives = 2673/2753 (97%)

Query: 189  LNDRTYQLPNSMPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTK 248
            LNDRTYQLPNSMPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTK
Sbjct: 11   LNDRTYQLPNSMPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTK 70

Query: 249  IDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRYLS 308
            IDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRYLS
Sbjct: 71   IDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRYLS 130

Query: 309  RGSKTESTRKDLRNPLERWRGLGLYWKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLI 368
            RGSKTESTRKDLRNPLERWRGLGLYWKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLI
Sbjct: 131  RGSKTESTRKDLRNPLERWRGLGLYWKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLI 190

Query: 369  EYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQ 428
            EYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQ
Sbjct: 191  EYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQ 250

Query: 429  KVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKET 488
            KVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKET
Sbjct: 251  KVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKET 310

Query: 489  EDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAET 548
            EDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAET
Sbjct: 311  EDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAET 370

Query: 549  HDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRP 608
            HDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRP
Sbjct: 371  HDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRP 430

Query: 609  FIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTT 668
            FIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTT
Sbjct: 431  FIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTT 490

Query: 669  IDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIE 728
            IDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIE
Sbjct: 491  IDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIE 550

Query: 729  CKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANSEQSANST 788
            CKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANSEQSANST
Sbjct: 551  CKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANSEQSANST 610

Query: 789  ETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCN 848
            ETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCN
Sbjct: 611  ETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCN 670

Query: 849  ACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEGRCPSRANFGSI 908
            ACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEGRCPSRANFGSI
Sbjct: 671  ACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEGRCPSRANFGSI 730

Query: 909  SDLHIHAHRMFGLPPDEETYFCKWDFSMGVXXXXXXXXXXXXFGDAWSKLAFSFKDYENI 968
            SDLHIHAHRMFGLPPDEETYFCKWDFSMGV            FGDAWSKLAFSFKDYENI
Sbjct: 731  SDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYENI 790

Query: 969  MNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVD 1028
            MNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVD
Sbjct: 791  MNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVD 850

Query: 1029 IHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFL 1088
            IHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFL
Sbjct: 851  IHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFL 910

Query: 1089 LPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNEHFCS 1148
            LPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNEHFCS
Sbjct: 911  LPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNEHFCS 970

Query: 1149 KKEEDGYAFNFASGLMSSTENDSNVESESLVVKLIKPQASISACCIKPFRSFSDQAYSNF 1208
            KKEEDGYAFNFASGLMSSTENDSNVESESLVVKLIKPQASISACCIKPFRSFSDQAYSNF
Sbjct: 971  KKEEDGYAFNFASGLMSSTENDSNVESESLVVKLIKPQASISACCIKPFRSFSDQAYSNF 1030

Query: 1209 VEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIK 1268
            VEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIK
Sbjct: 1031 VEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIK 1090

Query: 1269 EISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCSTSI 1328
            EISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCSTSI
Sbjct: 1091 EISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCSTSI 1150

Query: 1329 KDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKERLQ 1388
            KDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKERLQ
Sbjct: 1151 KDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKERLQ 1210

Query: 1389 KAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLP 1448
            KAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLP
Sbjct: 1211 KAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLP 1270

Query: 1449 PSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEGQAG 1508
            PSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEGQAG
Sbjct: 1271 PSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEGQAG 1330

Query: 1509 PLNLRVEVDSCSATVSDSTHKEGDMIAVXXXXXXXXXXXXSEMVGSILAIDDGTATDGNS 1568
            PLNLRVEVDSCSATVSDSTHKEGDMIAV            SEMVGSILAIDDGTATDGNS
Sbjct: 1331 PLNLRVEVDSCSATVSDSTHKEGDMIAVKGLKLLKKFILKSEMVGSILAIDDGTATDGNS 1390

Query: 1569 LSCSLKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLMELALLIDRCE 1628
            LSCSLKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLMELALLIDRCE
Sbjct: 1391 LSCSLKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLMELALLIDRCE 1450

Query: 1629 IKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAIIVDAFAR 1688
            IKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAIIVDAFAR
Sbjct: 1451 IKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAIIVDAFAR 1510

Query: 1689 RGSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLAPKLKFNTR 1748
            RGSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLAPKLKFNTR
Sbjct: 1511 RGSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLAPKLKFNTR 1570

Query: 1749 SKDLSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVEN 1808
            SKDLSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVEN
Sbjct: 1571 SKDLSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVEN 1630

Query: 1809 FDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETL 1868
            FDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETL
Sbjct: 1631 FDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETL 1690

Query: 1869 TQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLG 1928
            TQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLG
Sbjct: 1691 TQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLG 1750

Query: 1929 TTXXXXXXXXXXXXXXCDEAAEFSFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFRI 1988
            TT              CDEAAEFSFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFRI
Sbjct: 1751 TTSYISEINELSSSLSCDEAAEFSFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFRI 1810

Query: 1989 KLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSGLQALKDNAGVKSSDDA 2048
            KLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSGLQALKDNAGVKSSDDA
Sbjct: 1811 KLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSGLQALKDNAGVKSSDDA 1870

Query: 2049 KDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAY 2108
            KDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAY
Sbjct: 1871 KDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAY 1930

Query: 2109 FFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLS 2168
            FFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLS
Sbjct: 1931 FFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLS 1990

Query: 2169 KSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKLPILSSISHVNCKVRY 2228
            KSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKLPILSSISHVNCKVRY
Sbjct: 1991 KSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKLPILSSISHVNCKVRY 2050

Query: 2229 AGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLF 2288
            AGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLF
Sbjct: 2051 AGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLF 2110

Query: 2289 PTCVPIISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQI 2348
            PTCVPIISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQI
Sbjct: 2111 PTCVPIISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQI 2170

Query: 2349 SLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLN 2408
            SLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLN
Sbjct: 2171 SLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLN 2230

Query: 2409 IECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDN 2468
            IECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDN
Sbjct: 2231 IECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDN 2290

Query: 2469 KFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAV 2528
            KFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAV
Sbjct: 2291 KFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAV 2350

Query: 2529 TDHYSDWXXXXXXXXXXXXXXXXGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIF 2588
            TDHYSDW                GRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIF
Sbjct: 2351 TDHYSDWTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIF 2410

Query: 2589 LDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPA 2648
            LDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPA
Sbjct: 2411 LDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPA 2470

Query: 2649 NIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGXXXXXXXXXXXXXXRTELSVMLKFVH 2708
            NIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKG              RTELSVMLKFVH
Sbjct: 2471 NIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVH 2530

Query: 2709 IQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVA 2768
            IQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVA
Sbjct: 2531 IQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVA 2590

Query: 2769 SQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLG 2828
            SQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLG
Sbjct: 2591 SQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLG 2650

Query: 2829 SINFLREMWATHARAMALRRSHNGQSKSFFEDEHXXXXXXXXXXXXEYTYIPLEEPHIEI 2888
            SINFLREMWATHARAMALRRSHNGQSKSFFEDEH            EYTYIPLEEPHIEI
Sbjct: 2651 SINFLREMWATHARAMALRRSHNGQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEI 2710

Query: 2889 PQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARILGRA 2941
            PQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARILGRA
Sbjct: 2711 PQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARILGRA 2763

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score = 3387 bits (8783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1677/2988 (56%), Positives = 2124/2988 (71%), Gaps = 69/2988 (2%)

Query: 1    MSSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGV 60
            M+S+F+RV +ST +DFSWVFL DWVLILSVSLL AFYFGRV GYT+T +LE+LAWKRY V
Sbjct: 1    MASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKV 60

Query: 61   KV-----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQSEK--- 106
            K+           GR+FFKNLTV+TQ+QT+S L GSITWRYWLL+SRKT+    SE    
Sbjct: 61   KISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDK 120

Query: 107  -AAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPSPRATEETSTE 165
               KLPCRFR+ECQGLEHFIYN+TQAFDNIL+SLPRED E  K FF D S + T+E S +
Sbjct: 121  SVEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNSDKNTDECSVD 180

Query: 166  NDSAAQKSHLXXXXXXXXXXXXXLNDRTYQLPNSMPSFLRLLPLEYSVQKGALIIGNKKT 225
             DSA Q+SHL             LNDR++Q P+S P FL+LLPLEYSVQKGA++IGNK +
Sbjct: 181  EDSAGQRSHLETSTSSPSSKSKSLNDRSFQSPDSTPPFLKLLPLEYSVQKGAVVIGNKTS 240

Query: 226  SSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKA 285
            SSVMV S+EKL G LD C PD+KIDLYKIK++++  KF +SL+PNL  +++ PLK+  K 
Sbjct: 241  SSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKSFVKR 300

Query: 286  NRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKDLRNPLERWRGLGLYWKENDPAWDDVF 345
            ++L KL H+ Y+ F +      S  +   S +   RNPL+RWRGLGLYWKE D AWDD F
Sbjct: 301  SKLSKLWHRSYQLFFKTDSP--SSKNPANSAKDGTRNPLKRWRGLGLYWKEEDAAWDDRF 358

Query: 346  HFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSL 405
             F+L KHEYARY+KVMKC++ML+EY+ D PG+VPHGA PT + +DGPDVGN G PPD+S+
Sbjct: 359  QFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNSGPPPDYSI 418

Query: 406  DIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSD 465
            DIQ+ GA+++YGPW+HHEIMP+QK+FSPVVSRDS P E+L+ GS R++TRLR+SI+I+ +
Sbjct: 419  DIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLRLSILIVGE 478

Query: 466  SIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKL 525
            S+WRIPTRE SKDL+FLKR++ETED+TRPFGWLE+SL+EGSEVR NIAMCPT+TGFDN L
Sbjct: 479  SVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPTATGFDNTL 538

Query: 526  DLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHI 585
            DLHF+KPEIRTSVNHDILLSA+TH + A +GYPLGWN KA+W FD  S+Q ++FILKDHI
Sbjct: 539  DLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQIFILKDHI 598

Query: 586  TLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLS 645
            TLLGDI+SDFG+G+PTPY+LFRPF Y FNW  TGYS+YLNVNDANIVNNPV+FNENCYLS
Sbjct: 599  TLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLNVNDANIVNNPVNFNENCYLS 658

Query: 646  FHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDF 705
            FHGDDLR++F VPQ++IAGNST I+Y L+TPLFRLNMNTPSWNTLHEFMKDKEVGR+ +F
Sbjct: 659  FHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDKEVGRSANF 718

Query: 706  SLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEE 765
            SL+GSYLFHSKLDV+NIDTIIIEC S+ TTLKCYGYV+R+ +GVKMNYFGDFVHFKTTEE
Sbjct: 719  SLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHFKTTEE 778

Query: 766  YMEELRDAYVEPKANSEQSANSTETTTAGEGEDKQNAPK-NHTTDPVMAKKLSLKRMVNE 824
            YMEELR      K   +   + TE   A +  D+ ++ +  H  DP+ AKK SLKRMVNE
Sbjct: 779  YMEELRGTNAVTKTTHD---SETEIQEAPKQMDEDSSQREQHIKDPLTAKKTSLKRMVNE 835

Query: 825  KDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLS 884
            KDVWFTF+VEDGC ILP+NLYDC++C+A EFDSLDIDLR+INYYMD+QAALSP+ +R L 
Sbjct: 836  KDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRRLI 895

Query: 885  DCDPAHLFSGSEGRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVXXXXXX 944
            DC    +F             G +S LHIH HRMFGLPP EETYFCKWDFS+G       
Sbjct: 896  DCGCEEVFEQKGRALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLDLSSD 955

Query: 945  XXXXXXFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIV 1004
                  F +AW KL F F+DYENIMNYK+ PILDMTS+      I    + +  +  I +
Sbjct: 956  LPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVFCTDKIKDETAIQL 1015

Query: 1005 EVENVTARGVDFENERYSSRADVDIHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNF 1064
              ++++A+  D EN  YSSR D+D+ ++T  + +  K    I  F +S+KI+ FCQL++ 
Sbjct: 1016 NAQDISAKFADLENSLYSSRVDLDVANLTASIIDKNKSNKAIASFMTSIKISNFCQLQDL 1075

Query: 1065 LVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENV 1124
            L HS QQK HIA+NDAPFHRC FL+PL +Q S +Y+ L G I PGVSIP +  P+  ENV
Sbjct: 1076 LAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENV 1135

Query: 1125 TMILDEFLKGEKNSLQMGNEHFC---SKKEEDGYAFNFASGL---------MSSTENDSN 1172
              +   +LK E  S    +  F     K +      +F   L         +SS+ +D  
Sbjct: 1136 KAVFQGYLKAENASKDFVDRWFPVNEVKNKNSSSLKDFKGQLQPILDDNTSLSSSFSDPT 1195

Query: 1173 VESESLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRK 1232
             E  +LVV L   + SIS  C +   +  +Q +   +EQ ID+ E++VVLHFI+   ++K
Sbjct: 1196 FEHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDNIELDVVLHFIKMASRQK 1255

Query: 1233 QCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQD 1292
              KN++V  PT ++    +  +N       V +   ++S+D S+++      S+    +D
Sbjct: 1256 NYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQVSLDWSLKKGLKLPGSDNDP-ED 1314

Query: 1293 ITALVKVESLALCVSNT-SRNGPLENIHEDQLCSTSIKDLEFWMTSEDIRKSSFNATSID 1351
             T+L+K+ESL L V N   +      + E+     S+K+LE W     I  SS    SI+
Sbjct: 1315 TTSLLKIESLDLEVFNKLDKKTKFAEMDENIAFGCSVKELEAWSYLNGIADSSLYLKSIN 1374

Query: 1352 TWVHSDKTELCCIFLKNTAANIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDP 1411
              V  DK      F++    +   +   +S    + +KA+++FFYRIS ASDEYQI HDP
Sbjct: 1375 ASVALDKFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDP 1434

Query: 1412 PVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAG 1471
            PVITKPAYITRLP+QHVRE++SWKI+TRLRHILNYLP +L+++I+  LK++ +   + A 
Sbjct: 1435 PVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAE 1494

Query: 1472 EIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEGQ-AGPLNLRVEVDSCSATVSDSTHKE 1530
            E FL IFS W +W+ SDVE+CYMYR+ F +  +   A   + ++E  +      DS +  
Sbjct: 1495 ETFLEIFSNWGNWDYSDVEKCYMYRRVFTNTLDDTVAHESSTKIETGTFMLNFFDSINTG 1554

Query: 1531 GDMIAVXXXXXXXXXXXXSEMVGSILAIDDGTATD-GNSLSCSLKAVKASISE-TAIKLL 1588
             D + +             +      +       D    LSC +   + S+S+ T IKLL
Sbjct: 1555 SDSVILKNLKAQRTLEACKDEAAEKRSNMSNAEDDLEERLSCIINKAQISLSDGTLIKLL 1614

Query: 1589 AFRELFESQNSQDILSNTQVLPSGKILKLMELALLIDRCEIKISLDSKTANLKSFGNSIS 1648
            + RELF  +     +   + LP+       +   L+DRC+I++   +  ANLKSFGN+++
Sbjct: 1615 SVRELFTFEAEHAAVKENEKLPA-----FQQYTALVDRCDIQLLCGANRANLKSFGNTLT 1669

Query: 1649 FALVDTESARDTGS-SMALAWSWFEFDVRHNNAIIVDAFARRGSLGSFISQSESTTLHRV 1707
              +V    + D  + S A AWSWFEF +RH N I++DAF+R  ++G+    S   +  ++
Sbjct: 1670 --IVRENKSEDADAFSTAFAWSWFEFGIRHRNTILLDAFSRSSAVGAH-GFSGKNSRRKL 1726

Query: 1708 HLGSQKLRLKVPSSTKDYCNFINSLSESWSSLAPKLKFNTRSKDLSPEMKNFSKVA--FE 1765
             L ++K RLK+PS +K YC FI+SL ESW++L   L  NT   +  P      KVA  F 
Sbjct: 1727 DLRAKKFRLKLPSESKHYCTFIDSLEESWNNLRLALGPNTGFLE-KPHSAATEKVAPQFA 1785

Query: 1766 AHVD--DFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYL 1823
             ++D  D T++IS LS L+I+K FK LT+ +E+ A+S+L+L  E  D+D+ S  T QQYL
Sbjct: 1786 LNIDISDLTTDISLLSSLAITKNFKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQYL 1845

Query: 1824 KVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLK 1883
            K+SQS +  +     K       ++L+S +TK KL DPR+I   L +D+  AK  L  LK
Sbjct: 1846 KISQSNISFSLHRPKKNNASPPTVKLDSNITKLKLYDPRDITLPLGKDIAQAKACLASLK 1905

Query: 1884 IHLLALGALFGTDST--DEEVFAGA----LWPREWLWQLDMKYVGLLVPLGTTXXXXXXX 1937
                   + FG  +T  D+++ +       +   W++Q+ + YVGLL+PLG+T       
Sbjct: 1906 -------SCFGKLNTKNDKDIMSQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELN 1958

Query: 1938 XXXXXXXCDE----AAEFSFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKV 1993
                    DE    A+E S   + G+LS A I+FLIND+ LPE LS+V++FA  IK+AK 
Sbjct: 1959 EISAFITADEFTNKASENSQGALRGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKE 2018

Query: 1994 AENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSGLQALKDNAGVKSSDDAKDFFN 2053
            +E  ++SLQIES +FRIAL PFSL+RIL L  E + LS LQ  +    +  S + ++ F 
Sbjct: 2019 SEEVIRSLQIESPYFRIALSPFSLVRILFLVNELSRLSELQKRQTVGKLPESVEVRETFR 2078

Query: 2054 ISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIAR 2113
              + F S+Q+LSY+FCLGWIF+ + +   GL WGYQRLFAAHEKPYGKLTLLDAYF IA 
Sbjct: 2079 FRRAFRSVQVLSYNFCLGWIFDVNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAE 2138

Query: 2114 GSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGI 2173
            GSTS+DFY   +  + PNRS LPSMQI YW E+ G  DELF+RINGERLDV FLSKSI +
Sbjct: 2139 GSTSDDFYAHKNSFENPNRSFLPSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDV 2198

Query: 2174 AGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVF 2233
            AGG  +SL++F ELK+QY+DPFK     KR  A S FSK P LS+I  V+CKV+YAGGVF
Sbjct: 2199 AGGLMKSLNMFDELKKQYVDPFKSVANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVF 2258

Query: 2234 KLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVP 2293
            +LYSLDD++ + GPSFQLESPSV+++F+Y +M+ GK  H+LRA M V SSHNT+FPTCVP
Sbjct: 2259 RLYSLDDVQNEAGPSFQLESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVP 2318

Query: 2294 IISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCE 2353
            +++EMA DIRQLLK  N+S  E    S  QE ++YRS L+  DISF+++I KQQIS SCE
Sbjct: 2319 VLNEMARDIRQLLKGFNRSPQEASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCE 2378

Query: 2354 PKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLS 2413
            PKAKVQAD+GFEK A+K+FTND D+ EPLSLS+DI+ ITA SRHIFSREVSTS+ I+ LS
Sbjct: 2379 PKAKVQADLGFEKLAVKVFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLS 2438

Query: 2414 FVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVIG 2473
            ++F+LTHPDTIHTYGI +IP IDVYFNIKQLQDLN+F+NIWK DS + +QPELD++    
Sbjct: 2439 WIFILTHPDTIHTYGIMHIPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRA 2498

Query: 2474 PTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYS 2533
             T+ EKPL +K+KKV S +SFPWNF++I+S+I+G+IDLGISLGVLSLTT++IWA+TDHYS
Sbjct: 2499 LTSEEKPLVAKFKKVSSTTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYS 2558

Query: 2534 DWXXXXXXXXXXXXXXXXGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETA 2593
            DW                GRLGGT LL+NF WMS+I+WP+ EG FESPLV L++ LDE  
Sbjct: 2559 DWTQKLSLQMEKILLSSDGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFD 2618

Query: 2594 VKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDV 2653
            +KL+FDYHL+LIASVE L L LFNKRDPRG+ RNLLSV++SS+STQ+FLTALAPANI DV
Sbjct: 2619 LKLSFDYHLILIASVEVLKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDV 2678

Query: 2654 YNTILRMRKDNRKSYLETLGDSNTRDTKGXXXXXXXXXXXXXXRTELSVMLKFVHIQVYP 2713
            YNTILRMRKDNRKSY ETLGDSNT+DT+               RTEL V LKFVHIQ+YP
Sbjct: 2679 YNTILRMRKDNRKSYFETLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYP 2738

Query: 2714 STLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGV 2773
            S LFDMEV+TFKA+DF T SQ EG +KLKT LK ++H VK+ALS +K+QLHE+ ASQIGV
Sbjct: 2739 SKLFDMEVLTFKAKDFLTQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGV 2798

Query: 2774 KEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFL 2833
            KEYIEHA K DGGTIL  PAILIGMTTWHDVATN VELLYSNSFGGKIG+RWNLGSINFL
Sbjct: 2799 KEYIEHARKADGGTILVIPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFL 2858

Query: 2834 REMWATHARAMALRRSHNGQSKSFFEDEHXXXXXXXXXXXXEYTYIPLEEPHIEIPQTKD 2893
            REMWATH RAMALRRSHNGQ + FFEDEH            EY Y+PLEEPHIEIPQTKD
Sbjct: 2859 REMWATHVRAMALRRSHNGQPRGFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKD 2918

Query: 2894 LGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARILGRA 2941
            LGEATPPVEWFGVNRKQFPGLTHQ +IVPLQKLAH+AE+EWARILGRA
Sbjct: 2919 LGEATPPVEWFGVNRKQFPGLTHQAMIVPLQKLAHIAETEWARILGRA 2966

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score = 2416 bits (6262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1275/3011 (42%), Positives = 1850/3011 (61%), Gaps = 94/3011 (3%)

Query: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62
            S+F+ +PIS   +FSWVFL DWVL++ +SL   FYFGR L Y IT +++++ W+RY VK+
Sbjct: 5    SQFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRYKVKI 64

Query: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLES-------QS 104
                       GRVFFKNLTVIT+DQT S L GS TWRYWLL+SRKT LE        + 
Sbjct: 65   NIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRKTLLEELEKSGEEKD 124

Query: 105  EKAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFF--SDPSPRATEET 162
            +K+  L CRF +E  G E FIYNRT A+D IL S+ ++D+E+ KKFF   + S  ++EE 
Sbjct: 125  QKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAKDDKESFKKFFEGGEDSLHSSEE- 183

Query: 163  STENDSAAQKSHLXXXXXXXXXXXXXLNDRTYQLPNSMPSFLRLLPLEYSVQKGALIIGN 222
              E+++ A  S +              NDR +Q  +S    L+ LP+   V +GA+++GN
Sbjct: 184  KLEDETLASDSSVSNVDST--------NDRNFQEQDSRSMLLQFLPIHLKVNRGAVLLGN 235

Query: 223  KKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNL 282
              T SVM+  +E  +G +D C  + K+DLYKI+   D     + ++PN+ + ++ P+K+ 
Sbjct: 236  TTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIKSY 295

Query: 283  PKANRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKDLRNPLERWRGLGLYWKENDPAWD 342
               +R+ ++  K+ + F      YL+     +      +   E+WRGL LY + N    D
Sbjct: 296  IVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNVTTSD 355

Query: 343  DVFHF-----------ELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDG 391
                            ++  HEYA+Y++++K   + + Y++D PG+VPHGA  T+E  DG
Sbjct: 356  HSVGDEEEEEDENMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQRDG 415

Query: 392  PDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTR 451
            PDVGN GAPP+FSLD +++GA I YGPWAH +I  +Q++  P+VSRD+ P ++L+ GS R
Sbjct: 416  PDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGSRR 475

Query: 452  VFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLN 511
            ++TR  +S+++M D++WRIPTRE SKD DFLK+Y+E+++  RPFGWL++ L + +++ + 
Sbjct: 476  IYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLFMT 535

Query: 512  IAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDL 571
            + MCPT TGF+NKL  H +KPEIR+SVNHDI   A+   I A +GYPLGWN++A+W F  
Sbjct: 536  VGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVFQF 595

Query: 572  KSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANI 631
             S Q   F L+DHI LL DI  DFG+G PTPY+LFRPF+Y F W +  YS+YLNVNDANI
Sbjct: 596  NSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDANI 655

Query: 632  VNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLH 691
            +NNP+DFNENCYLS HGD L+I F V   +I GNSTT++Y++ TP F L ++TPSW+TLH
Sbjct: 656  INNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWSTLH 715

Query: 692  EFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKM 751
            EFMK+KEVGR+ DF + GSY FHS +DV N+DTI+IEC+S+ TTL+C G+V+R+L+ + M
Sbjct: 716  EFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNINM 775

Query: 752  NYFGDFVHFKTTEEYMEEL------RDAYVEPKANSEQSANSTETTTAGEGEDKQNAPKN 805
            NYFGDF+HFKTTEEY  EL      R+A V     S++S+  + T+     ++      +
Sbjct: 776  NYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFVTNDKETTEYDLH 835

Query: 806  HTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYI 865
               +    K+  LKR  NEKDVWFTF VEDGCL+ P+N+YDC +C    FDSLD+DLRY+
Sbjct: 836  EFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVDLRYL 895

Query: 866  NYYMDLQAALSPVIVRNLSDCDPAHLFS---GSEGRCPSRANFGSISDLHIHAHRMFGLP 922
            NYYMDLQA+LSP  ++  SD +P ++F      EG       F  +S+L+IHAHRMFGLP
Sbjct: 896  NYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGF--LSELNIHAHRMFGLP 953

Query: 923  PDEETYFCKWDFSMGVXXXXXXXXXXXXFGDAWSKLAFSFKDYENIMNYKIVPILDMTSI 982
              EETYFCKWDF +G                A+SK+ F +KDYEN++ Y+I+  +DMTS+
Sbjct: 954  IIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMTSL 1013

Query: 983  IFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQVKEGGKD 1042
                  I  K+ D   +  + ++++ ++A  +DFENERYS++    I +I + V E    
Sbjct: 1014 TLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSEKSSK 1073

Query: 1043 GSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKL 1102
              + G F +SL +  F Q ++F  H   Q++HI  +D+P+HRC+FLLP+  Q++  Y KL
Sbjct: 1074 NEVQGLFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKTVLYNKL 1133

Query: 1103 LGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNEHFCSKK---EEDGYAFNF 1159
             G+I PGVSIP + +P+ P  +  I +  L       +  ++   SK+    E+  +F  
Sbjct: 1134 FGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSDANYSKETAITEENSSFIQ 1193

Query: 1160 ASG-------LMSSTEN------DSNVESESLVVKLIKPQASISACCIKPFRSFSDQAYS 1206
             SG       L S ++N      +   E +S ++ L K   +I+    K   S   Q   
Sbjct: 1194 GSGSTSALKELSSYSQNCPSYKLEPKFEYDSFIINLGKTIIAINPSSEKCLLSIYLQFCV 1253

Query: 1207 NFVEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIV 1266
              ++ +ID+NEI++V  F +  +++    N++V +P    T  +          D + + 
Sbjct: 1254 GSIDDIIDANEIDIVEKFSKYFVEKSAVTNLRVLAPKICFTFGSPKGKFEVSDYDHLYVE 1313

Query: 1267 IKEISVDISMREE-PSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCS 1325
            +   S+D+  ++     NSS+    +++T+ +K  S+   + N  +  P   +    + S
Sbjct: 1314 VNHPSLDLCQKKIFGQTNSSKLEYTEEVTSSLKASSINFFI-NQQQLKPKTLLKARPVFS 1372

Query: 1326 TSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKE 1385
               ++LEFW  S +  K+S NA ++D +V+  + E    +L+        +    S  K 
Sbjct: 1373 IVFEELEFWSDSSESSKNSLNARAVDFFVNHSQLEWLSDYLRAVILCATKLFASFSKSKT 1432

Query: 1386 RLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILN 1445
             +Q  Q++  +R + AS EY IIHD PVITKPAYITRL   H+REN+SW+IITRLRHILN
Sbjct: 1433 LIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIRENRSWRIITRLRHILN 1492

Query: 1446 YLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQ--Y 1503
            YLP S       +LK   F+ P +A + FL IFS WRSWE SDV++CY+Y++ F S+   
Sbjct: 1493 YLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKCYIYKRVFLSRSMK 1552

Query: 1504 EGQAGPLNLRVEVDSCSATVSDSTHKEGD-MIAVXXXXXXXXXXXXSEMVGSILAIDDGT 1562
            + +    + +V ++  S ++S STH++ D M+              S +  S    +D  
Sbjct: 1553 KNRITGADFKVNLERISFSLSSSTHEDEDFMVVKNLKSVISNELIESSLPPSAKNTEDSA 1612

Query: 1563 ATDGNSLSCSLKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLMELAL 1622
            +T+   +SC++K+++  + +  +KL+   +   S  S   L  T V    K  KL++  L
Sbjct: 1613 STEKMIISCNIKSIRGDLGDNIVKLVRMYDGL-SNLSDTNLKTTSVKHDVKP-KLIQGVL 1670

Query: 1623 LIDRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAII 1682
            L+DR +  I LD K   L+SF N  S  +    S  +T  S+A   +  E  VRH +A++
Sbjct: 1671 LVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETKVSLAATCASSEAWVRHGSAVL 1730

Query: 1683 VDAFARRGSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLAPK 1742
            +++  + G+L    S      + +V L S  L +   +ST+ Y +FI S+  S   +  +
Sbjct: 1731 LESSLKDGALNFSQSLFHEHLITKVVLRSGGLSVSAMASTEQYIHFIWSIKASVDGIRKE 1790

Query: 1743 L------KFNTRSKDLSPEMKN-FSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFE 1795
            L      K NT      PE  +  + V  +A +  F+  I  L+P  I +    + V  E
Sbjct: 1791 LASAIPKKNNTTISTTKPETSSRLNTVTLDATLSGFSLNIQPLTPFGIHQSTDSIEVHVE 1850

Query: 1796 KEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTK 1855
            K    +  + + + D++LLS  + Q+YLK SQS V L      +   +   + + S ++K
Sbjct: 1851 KHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLVISNTPEQNAMFLNVGVASGISK 1910

Query: 1856 FKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQ 1915
              + DPRE I +L +D   A +N  QLK    +L   F + +  E+          WL  
Sbjct: 1911 LTVSDPREFIYSLVEDETLAIKNFAQLK----SLAEKFPSKN-QEKSKQRKQTNIIWLLH 1965

Query: 1916 LDMKYVGLLVPLGTTXXXXXXXXXXXXXXCDEAA----EFSFPLVHGELSVAGISFLIND 1971
            ++++Y+G++V LG+                + +A    E     + G+ S+  +  LI+ 
Sbjct: 1966 VNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLHGIVGDFSIENVLLLIHA 2025

Query: 1972 KELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLS 2031
              L  +LSK+++ A  +K+++   + ++++QIES+HFR+ALCP SL ++L    E T +S
Sbjct: 2026 NRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCPMSLTKVLWAINEFTRVS 2085

Query: 2032 GLQALKDNAGVKSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRL 2091
                 + +          D   +S  F SIQILSY+FC+GWIF+    ++ GL WGY+RL
Sbjct: 2086 EAYKTRSSLLQHKKTAPTDISELSNKFRSIQILSYNFCIGWIFDAGSETDPGLIWGYERL 2145

Query: 2092 FAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSED 2151
            FAA++KPYGKLTLLDAYF IA G++S+ F+    E D+ NRS LPSMQI YWF   G   
Sbjct: 2146 FAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKEKDQFNRSYLPSMQIGYWFVKEGDTS 2205

Query: 2152 ELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFS 2211
             LFVRI GERLDV+FLS SIGIA G  +S+  FQELK+  +DPF   +  ++ P  S  +
Sbjct: 2206 NLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQELKKTMVDPFATNKTTEK-PVNSEAA 2264

Query: 2212 KL-PILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKR 2270
             L PILS I   NC V+YAGGVFKL+S +DI+  + PSF++ESPSV+V  +Y  +    +
Sbjct: 2265 PLDPILSKIRAFNCIVKYAGGVFKLFSEEDIQNNSKPSFEVESPSVEVAIDYKHLPDVIK 2324

Query: 2271 KHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRS 2330
             H +R L++VD S+NTLFPTCVPI+S M  D+R +LK  N        ++    G+NY+ 
Sbjct: 2325 SHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLKSFNSKPKPDRNSTISSSGMNYKK 2384

Query: 2331 LLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHN 2390
            LL+  DI+F++NI KQ ISLSCEPKAKVQADVGFEK A+K+FTN+ D  EPLSLS+DI +
Sbjct: 2385 LLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFEKLAVKMFTNNLDNSEPLSLSIDIEH 2444

Query: 2391 ITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVF 2450
            + ATSRHIFSREVSTS  I+ +  VF+LTHP+ I TYG   +  + +YFN+KQLQDLN+F
Sbjct: 2445 LRATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQTYGTTLVSDVQIYFNMKQLQDLNLF 2504

Query: 2451 INIWKLDSKILSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEID 2510
            ++IWK DS+IL  P+  N      ++ +K   SK++K    ++FPWN+ +I S I+G+ID
Sbjct: 2505 LDIWKPDSQILEMPKGGNTRTRSLSSHDKLPVSKFQKPAGTNAFPWNYTLIFSNIKGDID 2564

Query: 2511 LGISLGVLSLTTEKIWAVTDHYSDWXXXXXXXXXXXXXXXXGRLGGTFLLQNFRWMSQIK 2570
            LG SLGVLS+   + WA++DH+ DW                GRLGG   ++   W S+I 
Sbjct: 2565 LGPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLENILLSSDGRLGGFLGIERVCWSSEIS 2624

Query: 2571 WPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLS 2630
            WP+  G +E+PL+ L++ L   A+K +FDYH+ LIA+VE L L L+N+RD  G++++LL+
Sbjct: 2625 WPVKGGFYETPLISLSLELGSLALKTSFDYHMFLIANVEHLLLKLYNERDEMGILKDLLA 2684

Query: 2631 VSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGXXXXXXXX 2690
            VS++     +FLTALA AN  D+YNTI+RMR+DN+ SY+ETL DSNT+ TK         
Sbjct: 2685 VSVTCGKIHLFLTALASANAIDIYNTIIRMRQDNKNSYIETLKDSNTQSTKSKRQNQNVL 2744

Query: 2691 XXXXXXRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVH 2750
                  RT+LSV +   ++QV+PSTLFDMEV+  KA D S  +QT+G  K+KT+L  ++H
Sbjct: 2745 ESLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLH 2804

Query: 2751 NVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVE 2810
            N K++LS +K+Q +E + SQI VKEYI+HA+KV GGTIL+ PAIL+ MTTW +V++N +E
Sbjct: 2805 NFKVSLSAFKNQFNEEIVSQIEVKEYIKHATKVRGGTILAAPAILVDMTTWQEVSSNVIE 2864

Query: 2811 LLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHN--GQSKSFFEDEHXXXXXX 2868
            LLY++SFGGK+ V+WNLG INF+REMWATH RA+ALRR H+   ++KSFFEDEH      
Sbjct: 2865 LLYTSSFGGKVDVKWNLGPINFIREMWATHVRALALRRVHDMRDKNKSFFEDEHIEEKIK 2924

Query: 2869 XXXXXXEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAH 2928
                  +Y YIPLEEP IE+PQ KDLG+ATPPVEWFGVNR++FPGLTHQ V+VPLQKLAH
Sbjct: 2925 DVDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAH 2984

Query: 2929 LAESEWARILG 2939
            +AE E+AR+LG
Sbjct: 2985 MAEEEYARVLG 2995

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 1932 bits (5006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1079/3006 (35%), Positives = 1648/3006 (54%), Gaps = 126/3006 (4%)

Query: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62
            S+ R VP++  +DFSWVFL DW+L +   L + FY GR+  Y ++ ILE+L WKR  +K+
Sbjct: 5    SQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRAKIKI 64

Query: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSL----ESQSEKA 107
                       GR++FK+L+VI +D T SIL GS+TW+YWLL+ RK  L    ++ S K 
Sbjct: 65   NVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNSSGKN 124

Query: 108  AKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSD---PSPRATEETST 164
             +LPC+F +EC+GLE+FIYNRT A+DN+++ L +++++  +K+ ++   P P +   ++ 
Sbjct: 125  IELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDGSSAD 184

Query: 165  ENDSAAQKSHLXXXXXXXXXXXXXLNDRTYQLPN--SMPSFLRLLPLEYSVQKGALIIGN 222
            + D    +S               +NDR YQ  N    P  L   P+E  + +G+L++GN
Sbjct: 185  KLDEDLSES-----AYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLLGN 239

Query: 223  KKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNL 282
            K T SVM+ S+E  +G +D   P  ++DLY+ K   ++  F++S++ N+ YD+   LK  
Sbjct: 240  KFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLKFK 299

Query: 283  PKANRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKDLRNPLERWRGLGLYWKENDPA-- 340
                ++ KL   +      V K  + R  K      D     ++W+GL LY      A  
Sbjct: 300  LDTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSDDAF--FQKWKGLSLYKASAGDAKT 357

Query: 341  --WDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGG 398
               DD+  F+   HEYA+++ ++KC  + + Y  D PGVVPHGA PT+  +DGPDVGN G
Sbjct: 358  SDLDDI-EFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNNG 416

Query: 399  APPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRI 458
            APPDF+LD+Q+ G +I YGPWA  ++  +Q+V SPVVSR + P ++L  GS RV+T  R+
Sbjct: 417  APPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRM 476

Query: 459  SIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTS 518
            +I+IM D+ WRIPTRE SKD +FL+ YK+T ++ RPFGW++L   + +    NI++CPT 
Sbjct: 477  NILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPTV 536

Query: 519  TGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARM 578
             GF N   +HF++ EIR+SVNHDILL ++  D++  IGYPLGWN+   W  ++KS Q   
Sbjct: 537  EGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLEA 596

Query: 579  FILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDF 638
            F+L++HITL+ D LSDF  GDPTPY+LFRPF+Y+ NWE+ GYS+YLNVND NIVNNP+DF
Sbjct: 597  FLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLDF 656

Query: 639  NENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKE 698
            NENCYLS HGD L I   VP++SI G  T + Y + TP+FR+ +NTP WNTL+EFMK KE
Sbjct: 657  NENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKE 716

Query: 699  VGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFV 758
            VGR+ DF++ G YL +S+LD++N+D++ I C S  T L CYG+V+R+L+ VKMNYFG+F 
Sbjct: 717  VGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEFF 776

Query: 759  HFKTTEEYMEELRDAYVEPKANSEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSL 818
            +F T+EEY   L    V          +   T    + E +  + KN   D    K+  L
Sbjct: 777  NFVTSEEYTGVLGAREVGEVVTKSSVVDLASTL---DSEYQNGSMKNDAEDNGPMKRSDL 833

Query: 819  KRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPV 878
            KR  NE D+WFTF V +G LILP+ +Y  + C A  F  L +D R  NYYMD+ A L+  
Sbjct: 834  KRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGT 893

Query: 879  IVRNLSDCDPAHLFSG-SEGRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMG 937
             ++         +F              G +SDL IH HRM+GLPP E TYFC+WD ++G
Sbjct: 894  SIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLG 953

Query: 938  VXXXXXXXXXXXXFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVA 997
                         F  ++ K+ F + D ENI+ Y    I DMTS+  HA  I + +ND  
Sbjct: 954  ELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAERINISLNDPV 1013

Query: 998  VDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQVKEGGKDGSLIG--DFSSSLKI 1055
            +    IV VE++    +DFENERYS R D+ +  +TV +     DG+     +F + L+ 
Sbjct: 1014 MKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFLNFETKLRF 1073

Query: 1056 TKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGM 1115
            T F Q K+      +Q+ +I  ND+P+HRC FLLPL  Q SD Y+KL G+I P  SIP +
Sbjct: 1074 TNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTL 1133

Query: 1116 VEPITPENVTMILDEFLKGEKNSLQMGNEHF-----------------CSKKEEDGYAFN 1158
              P  P+ +  I+++ + GE  +L      F                  ++ +++  A  
Sbjct: 1134 PLPTLPDTIDYIIEDIV-GEYATLLEATNPFKDLFAETPSTVEPLRASFTEDDDEEAADP 1192

Query: 1159 FASGLMSSTENDSNVESESLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDSNEI 1218
                 ++ TE + N E ++ V+ +      I        +S  +Q YS  + Q++D  EI
Sbjct: 1193 LEFKPVAFTE-EINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDIEI 1251

Query: 1219 EVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMRE 1278
             +V              N+ +      +     G +      D ++  + E S++     
Sbjct: 1252 GIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMSEKSLE----- 1306

Query: 1279 EPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCSTSIKDLEFWMTSE 1338
                N + KS   ++  L KV+++   V N  +N  L       L S  ++  E W ++E
Sbjct: 1307 ---KNRTSKSL--EVAVLAKVKTVRATV-NQKKNPELSEDRPPAL-SLGLEGFEVWSSTE 1359

Query: 1339 DIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTI-TEVVSVHKERLQKAQRDFFYR 1397
            D + +S N TS D  +   + E    +  +    I  + T V S+   R    + +   +
Sbjct: 1360 DRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTR-SSTKTELISK 1418

Query: 1398 ISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYG 1457
            ++ AS+ YQI HDP VITKPA+I RL   HVREN+SWKIITRLRHIL YLP      I  
Sbjct: 1419 LTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDK 1478

Query: 1458 ALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAF---YSQYEGQAGPLNLRV 1514
             LK   +    +A  IF+++FS WR+WE SDV + Y+Y K F   +++++G +    L+ 
Sbjct: 1479 VLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKC 1538

Query: 1515 EVDSCSATVSDSTHKEGDMIAVXXXXXXXXXXXXSEMVGSILAIDDGTATDGNSLSCSLK 1574
             + S   TV       G+   V             ++   + ++      +   ++  + 
Sbjct: 1539 TMGSFYLTVY------GEGYEVEHNFVVADANLVVDLTPPVTSLS-SNREETIEITGKVG 1591

Query: 1575 AVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKL--MELALLIDRCEIKIS 1632
            +VK   S+  +KL     L  +    D     +  P  ++ K   M   LL+D+ EI++ 
Sbjct: 1592 SVKGKFSDKLLKLQDLIPLVVAVTEDD-----KSDPKAELSKQFKMNTVLLVDKSEIQVV 1646

Query: 1633 LDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAIIVDA-FARRGS 1691
            +D      ++ G  +S    + + +     S+ +     E  ++H + I+ +A       
Sbjct: 1647 MDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSI 1706

Query: 1692 LGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLAPKLKFNTRSKD 1751
            L +  + S   T+  V+     L  +  S+T+   N I  + ES   +  ++KF  +SK+
Sbjct: 1707 LATTEAWSHKPTI-LVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQIKFKPKSKN 1765

Query: 1752 LSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDL 1811
             S  + +        +  + +SEI  LSP  I    K L + F K  ++ + L + + D 
Sbjct: 1766 KSQFVGSRINTVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDF 1825

Query: 1812 DLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQD 1871
             + S  T +QYL+ S   +E+      +   + + + +  ++ K    +PR I+ +  QD
Sbjct: 1826 FMTSHQTKEQYLRFSFGDIEIKGGFSKEAYSLIN-VDISISMIKLTFSEPRRIVNSFLQD 1884

Query: 1872 LVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWL-WQLD--MKYVGLLVPLG 1928
               A Q +  L               T + + A    P + + W LD  + Y G+LVP+ 
Sbjct: 1885 EKLASQGINLLSSLNSLF-------LTTDPMNAKKETPAKMINWTLDTNISYFGILVPVA 1937

Query: 1929 TTXXX-XXXXXXXXXXXCDEAAEFSFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFR 1987
            +T                +         + G+LS+  I FLI ++ LP  LSK+L+F+ +
Sbjct: 1938 STYFVFELHMLLLSLTNTNNGLLPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIK 1997

Query: 1988 IKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSGLQALKDNAGV----- 2042
            +   +   ++ +S Q+ES+HFR+ L P SL+R++  AY+   +    + +    +     
Sbjct: 1998 VSTLQRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNIRM 2057

Query: 2043 --KSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYG 2100
                SD  K+   I   F SI ILSY FC+GW+F      + GL +GY RLF+A+EK +G
Sbjct: 2058 FTGKSDKPKE---IPINFRSIHILSYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFG 2114

Query: 2101 KLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGE 2160
            K T++DA+F ++ G+TS+ F+ + +E ++ NRS LP+MQI YWF+  G   + F R +GE
Sbjct: 2115 KFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGE 2174

Query: 2161 RLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVP------AGSAFSKLP 2214
             LDV+FL   + +     +S+  FQELK+  LD           P        ++ S  P
Sbjct: 2175 ALDVNFLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSSPDAAPNTENASNSLAP 2234

Query: 2215 ILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLL 2274
             L +I  VNC  +Y GGVF++Y+ DDI+ K+ PSF+L+SP V +   Y    +  + H +
Sbjct: 2235 FLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTINCTYKHDESKAKPHRI 2294

Query: 2275 RALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQD 2334
            R L++VD +HNTL+  C P++ E +  ++ ++K  +    +   T    + ++Y+ LL  
Sbjct: 2295 RTLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFTKPSTQNVDYKRLLDQ 2354

Query: 2335 VDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITAT 2394
             D++  +   KQQ+SLSCEPKAKVQADVGFE F   + TN+FD  +PL  SL +    A+
Sbjct: 2355 FDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKAS 2414

Query: 2395 SRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIW 2454
             +HIFSREVSTS  +  +    + THPD I  YG + +  + V+FN+KQLQ+L +F++IW
Sbjct: 2415 IKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIW 2474

Query: 2455 KLDSKILSQPELDNKFVIGPTNLEKPLT--SKYKKVISNSSFPWNFVVILSRIRGEIDLG 2512
            +  S + ++P         P N E  ++  S    V   +  PW F +I + + G++DLG
Sbjct: 2475 RFSSILHTRP------TQRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIFTNLSGDVDLG 2528

Query: 2513 ISLGVLSLTTEKIWAVTDHYSDWXXXXXXXXXXXXXXXXGRLGGTFLLQNFRWMSQIKWP 2572
             SLGV+SL +++ W  TDHY +                 GRL G F + N  W+S++KWP
Sbjct: 2529 PSLGVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWP 2588

Query: 2573 LNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVS 2632
            L       PLV  ++ +D+ AVK  FDYH+ LI ++  +   L N++D +G++ +LL VS
Sbjct: 2589 LENSKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVS 2648

Query: 2633 LSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGXXXXXXXXXX 2692
             SSD   +  TAL  ANI D+YNTI+RMR+DN+ SY+ETL DSN  ++K           
Sbjct: 2649 FSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQPILYKDILRS 2708

Query: 2693 XXXXRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNV 2752
                RT+LSV +  + +Q+ P +LFD+EV+  +    S  S+T   KKLKT L+L+V +V
Sbjct: 2709 LKLLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDV 2768

Query: 2753 KLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELL 2812
              ALST K +L E + + I + +Y+ +ASK+ GGTI+  P + + MTT  +  TN +E L
Sbjct: 2769 SAALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYL 2828

Query: 2813 YSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNGQSKSFFEDEHXXXXXXXXXX 2872
            ++ SF  KI VRWNLG INF++EMW TH +A+A+RRS          +E           
Sbjct: 2829 FACSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQTEEELEESIKREEN 2888

Query: 2873 XXEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAES 2932
              ++ YI LEEP IE+PQ +DLGEATPP+EWFGVNRK+ P  THQ  ++P+QKL +LAE 
Sbjct: 2889 ASKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEK 2948

Query: 2933 EWARIL 2938
            ++ +IL
Sbjct: 2949 QYVKIL 2954

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score = 1930 bits (4999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1085/3007 (36%), Positives = 1652/3007 (54%), Gaps = 127/3007 (4%)

Query: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62
            S+ R VP++  +DFSWVFL DW+L + + L   FY GR+  Y +T ILE+L WKR  +K+
Sbjct: 5    SQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRANIKI 64

Query: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQSE----KA 107
                       GR+ FK+L+VI +D T S+L GS+TW+YWLL+ RK  L   ++    K 
Sbjct: 65   NVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDSLSKN 124

Query: 108  AKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPSPRATEETSTEND 167
             KLPC+F +EC+GLE FIYNRT A+DN+++ L +++++  +K+ ++ S     E+ ++  
Sbjct: 125  VKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHS---FPESFSDGS 181

Query: 168  SAAQ-KSHLXXXXXXXXXXXXXLNDRTYQLPN--SMPSFLRLLPLEYSVQKGALIIGNKK 224
            SA +    L             +NDR YQ  +   +P FL+ LP+E    +G+L++GNK 
Sbjct: 182  SADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLLGNKF 241

Query: 225  TSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPK 284
            T SVM+ S+E  +G +D   P  ++DLY+ K Q +   F++S++ N+ YD+   LK    
Sbjct: 242  TPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKLD 301

Query: 285  ANRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKDLRNPLERWRGLGLYWK---ENDPAW 341
              ++ KL   +      V K  +S+ +K ++   D  +  ++W+GL LY     +  P+ 
Sbjct: 302  TGKVSKLWKTFVRVLRIVTKPIISKKNKKKTGPSD-DSFFQKWKGLSLYKAAPGDAKPSD 360

Query: 342  DDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPP 401
             D   F+   HEYA+++ ++KC  + I Y  D  G VPHGA PT+  +DGPDVGN GAPP
Sbjct: 361  LDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNGAPP 420

Query: 402  DFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIM 461
            DF+LD+Q+ G +I YGPWA  ++  +Q+V SPVVSR S P ++L  GS R++T  R++++
Sbjct: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRMNVL 480

Query: 462  IMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGF 521
            IM D+ WRIPTRE SKD +FL+ YKET ++ RPFGW++L   + +    N+ +CPT  GF
Sbjct: 481  IMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTVEGF 540

Query: 522  DNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFIL 581
             N   +HF++ EIR+SVNHDILL ++  +++  IGYPLGWN+KA W  ++KS Q   F+L
Sbjct: 541  QNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEAFLL 600

Query: 582  KDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNEN 641
            ++HITL+ D LSDF  G+PTPY+LFRPF+Y+ NWE+ GYS+YLNVND NIVNNP+DFNEN
Sbjct: 601  REHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660

Query: 642  CYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGR 701
            CYLS HGD L I   VP++SI G  T I Y + TP+FR+ +NTP WNTL+EFMK KEVGR
Sbjct: 661  CYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720

Query: 702  ACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFK 761
            A DF++ GSYL +S+LD++N+DT++IEC S  T L CYG+V+R+L  VKMNYFG+F +F 
Sbjct: 721  AYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780

Query: 762  TTEEYMEELRDAYVEPKANSEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRM 821
            T+EEY   L    V          +   T  +G    + ++ KN + D    K+  LKR 
Sbjct: 781  TSEEYTGVLGAREVGEIITKSSVLDLASTLDSGY---QNSSLKNESEDKDPVKRSDLKRT 837

Query: 822  VNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVR 881
             NE D+WFTF V +G LILP+ +Y  + C A  F  L +D R  NYYMD+ A L+   ++
Sbjct: 838  TNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIK 897

Query: 882  NLSDCDPAHLFSG-SEGRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVXX 940
                     +F         +    G++SDL IH HRMFGLPP E TYFC+WD ++G   
Sbjct: 898  RHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLGDLT 957

Query: 941  XXXXXXXXXXFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDY 1000
                      F +++ K+ F + D ENI+ Y    + DMTS+  HA  I++  ND  +  
Sbjct: 958  IDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISFNDPVMKS 1017

Query: 1001 YIIVEVENVTARGVDFENERYSSRADVDIHSITVQ---VKEGGKDGSLIGDFSSSLKITK 1057
              +V  E++    +DFENERYS R DV I  + +    V   G D S +  F + L+ T 
Sbjct: 1018 QSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFL-KFETKLRFTN 1076

Query: 1058 FCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVE 1117
            F Q K+      +Q+ +I  +D+P+HRC FLLPL  Q SD Y+KL G+I P  SIP +  
Sbjct: 1077 FEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPL 1136

Query: 1118 PITPENVTMILDEFLKGEKNSLQMGNEHFCSKKEEDGYAFNFASGLMSSTENDSNVESES 1177
            P  P+ +  I+++ + GE  +L      F     E       +    SSTE+D++  ++ 
Sbjct: 1137 PTLPDTIDFIIEDIV-GEYATLLETTNPFKDIFAETPSTVEPSRA--SSTEDDNDERADP 1193

Query: 1178 LVVKLIK-------------PQASISACCIKPF-----RSFSDQAYSNFVEQLIDSNEIE 1219
            L  K I                 S     + P      +S   + YS  + Q++D  EI 
Sbjct: 1194 LEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIG 1253

Query: 1220 VVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREE 1279
            +V              N+ V      +     G +      D +D  + E S++      
Sbjct: 1254 IVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLE------ 1307

Query: 1280 PSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCSTSIKDLEFWMTSED 1339
                 +  S + ++  L +++++ + V N  RN  L       L S  ++  E W ++ED
Sbjct: 1308 ----KNRTSKLLEVATLARIKTVRVTV-NQKRNPDLSEDRPPAL-SLGLEGFEVWSSTED 1361

Query: 1340 IRKSSFNATSIDTWVHSDKTELCCIFLKNTAANI-DTITEVVSVHKERLQKAQRDFFYRI 1398
             + +S N TS D  +   + E    +  +    I + +    S+   R+  ++ +   ++
Sbjct: 1362 RQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRIS-SKTELISKL 1420

Query: 1399 STASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGA 1458
            + AS+ YQI HDP VITKPA+I RL   HVREN+SWKIITRLRHIL YLP      I   
Sbjct: 1421 TAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKV 1480

Query: 1459 LKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEGQAGPLNLRVEVDS 1518
            LK   + +  +A  IF+++FS WR+WE SDV + Y+Y K F    +      NL  ++  
Sbjct: 1481 LKERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLF--SVDNAEHKQNLMKKLLK 1538

Query: 1519 CS-ATVSDSTHKEGDMIAVXXXXXXXXXXXXSEMVGSILAIDDGTATDGNSLSCSLKAVK 1577
            C+  +   + + EG    V             ++   + ++      +   ++  + +VK
Sbjct: 1539 CTMGSFYLTVYGEG--YEVEHNFVIADANLVVDLTPPVTSL-SLNREETIEITGRVGSVK 1595

Query: 1578 ASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLMELALLIDRCEIKISLDSKT 1637
               S+  +KL     L  +    D       L   K  K M   LL+D+ EI++ +D   
Sbjct: 1596 GKFSDRLLKLQDLIPLVAAVGGGDKSDAKAEL--SKQFK-MNTVLLVDKSEIQLVMDQTK 1652

Query: 1638 ANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAIIVDAFARRGSLGSFIS 1697
               ++ G  +S    + + +     S+ +     E  ++H + I+ +A  R  S+ +   
Sbjct: 1653 LMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQLRDFSILATTE 1712

Query: 1698 QSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLAPKLKFNTRSKDLSPEMK 1757
                     ++     L  +  S+T+     I  + ES   +  ++KF  +SK  S  + 
Sbjct: 1713 AWSHKPTILINNQCADLHFRAMSTTEQTVTVITEIRESVLKIKDRIKFKPKSKKRSQFVG 1772

Query: 1758 NFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEM 1817
                +    +  + +SEI  LSP  I    K L + F K  ++ + L + + D  + S  
Sbjct: 1773 PKINIVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQ 1832

Query: 1818 TAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQ 1877
            T +QYL+ S   +E+   I  K +     + +  ++ K    +PR I+ +  QD   A Q
Sbjct: 1833 TKEQYLRFSFGDIEIKGGI-SKEDYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQ 1891

Query: 1878 NLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTX------ 1931
             +  L         LF +    ++          W     + Y G+LVP+ +T       
Sbjct: 1892 GINLLS---SLKSLLFTSGLPKKKKKKAPARMINWTLDTSITYFGILVPVASTYFVFELH 1948

Query: 1932 XXXXXXXXXXXXXCDEAAEFSFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLA 1991
                           E A+     V G+ S+  I FLI ++ LP  LSK+L+F+ ++   
Sbjct: 1949 MLLLSLTNTNNGMLPEEAK-----VTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTL 2003

Query: 1992 KVAENSMKSLQIESTHFRIALCPFSLIRILSLA---------YEATHLSGLQALKDNAGV 2042
            +   ++ +S Q+ES+HFR+ L P SL+R++  A         Y   H   +  +K   G 
Sbjct: 2004 QRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPNIWDIKMFTG- 2062

Query: 2043 KSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKL 2102
              SD  K+   I   F SI ILSY FC+GW+F     S+ GL  GY RLF+A+EK +GK 
Sbjct: 2063 -KSDKPKE---IPINFRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFGKF 2118

Query: 2103 TLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERL 2162
            T++DA+F +A G+ S+ F+ + +E D+ NRS LP+MQI YWF+  G   + F R +GE L
Sbjct: 2119 TVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEAL 2178

Query: 2163 DVSFLSKSIGIAGGFARSLHLFQELKRQYLDP-----FKPEEPVKRVPAGSAFSKL-PIL 2216
            DV+F+   + +     +S+  FQELK+  LD       + + P       SA + L P L
Sbjct: 2179 DVNFVPSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDDNPYATSSMESASNSLAPFL 2238

Query: 2217 SSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRA 2276
             +I  VN   +Y GGVF++Y+ DDI+ K+ PSF+++SP V +   Y       + H +R 
Sbjct: 2239 DNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAKPHRIRI 2298

Query: 2277 LMSVDSSHNTLFPTCVPIISEMALDIRQLLKDL---NKSSVETPRTSNMQEGINYRSLLQ 2333
            L++VD + NTL+  C P++ E +  +++++K     +K S   P + N    ++Y+ LL 
Sbjct: 2299 LIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFTKPSSQN----VDYKRLLD 2354

Query: 2334 DVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITA 2393
              D++  +   KQQ+SLSCEPKAKVQADVGFE F   + TN+FD  +PL  SL +    A
Sbjct: 2355 QFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQTKA 2414

Query: 2394 TSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINI 2453
            + RHIFSREVSTS  +  +    + THPD I  YG + +  + V+FN+KQLQ+L +F++I
Sbjct: 2415 SIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLFLDI 2474

Query: 2454 WKLDSKILSQPELDNKFVIGPTNLEKPLTS--KYKKVISNSSFPWNFVVILSRIRGEIDL 2511
            W+  S + ++P      V G  + E  ++S      V   +  PW F +I + + G++DL
Sbjct: 2475 WRFSSILHTRP------VQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFTNVSGDVDL 2528

Query: 2512 GISLGVLSLTTEKIWAVTDHYSDWXXXXXXXXXXXXXXXXGRLGGTFLLQNFRWMSQIKW 2571
            G SLGV+SL T++ W  TDHYS+                 GRL G F + N  W+S++KW
Sbjct: 2529 GPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKW 2588

Query: 2572 PLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSV 2631
             L +     PLV  ++ +D+ AVK  FDYH+ LI ++  +   L N++D +G++ +LL V
Sbjct: 2589 SLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQV 2648

Query: 2632 SLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGXXXXXXXXX 2691
            S SSD   +  TAL  ANI D+YNTI+RMR+DN+ SY+ETL DSN  ++K          
Sbjct: 2649 SFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQPILYKDILR 2708

Query: 2692 XXXXXRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHN 2751
                 RT+LS+ +  + +Q+ P +LFD+EV+  + ++ S  S+T   KKLKT L+L+V +
Sbjct: 2709 SLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLD 2768

Query: 2752 VKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVEL 2811
            V  ALST K +L E + + I + +YI +ASK+ GGTI+  P + + MTT  +  TN +E 
Sbjct: 2769 VSAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEY 2828

Query: 2812 LYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNGQSKSFFEDEHXXXXXXXXX 2871
            L++ SF  KI V+WNLG +NF++EMW TH +A+A+R+S          +E          
Sbjct: 2829 LFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQTEEELEESIKTKE 2888

Query: 2872 XXXEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAE 2931
               ++ YI LEEP I++PQ +DLG+ATPP+EWFGVNRK+FP  THQ  ++P+QKL +LAE
Sbjct: 2889 TTSKFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAE 2948

Query: 2932 SEWARIL 2938
             ++ +IL
Sbjct: 2949 KQYVKIL 2955

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 1926 bits (4989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1085/3008 (36%), Positives = 1654/3008 (54%), Gaps = 130/3008 (4%)

Query: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62
            S+ R VP++  +DFSWVFL DW+L +   L   FY GR+  Y ++ ILE+L WKR  VK+
Sbjct: 5    SQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRAKVKI 64

Query: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSL----ESQSEKA 107
                       GR+ FK+L+VI +D T SIL GSITW+YWLL+ RK  L    +S S+  
Sbjct: 65   NVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELIDNNKSPSKNN 124

Query: 108  AKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSD---PSPRATEETST 164
             KLPC+F +EC+GLE FIYNRT A+DN+++ L +++++  +K+ ++   P P +   ++ 
Sbjct: 125  VKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDGSSAD 184

Query: 165  ENDSAAQKSHLXXXXXXXXXXXXXLNDRTYQLPN--SMPSFLRLLPLEYSVQKGALIIGN 222
            + D    +S               +NDR YQ  +    P FL+ LP+E +  +G+L++GN
Sbjct: 185  KLDEDLSES-----AYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGSLLLGN 239

Query: 223  KKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNL 282
            K T SVM+ S+E  +G +D   P  ++DLY+ K Q +   F++S++ N+ YD+   LK  
Sbjct: 240  KFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFK 299

Query: 283  PKANRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKDLRNPLERWRGLGLY------WKE 336
                ++ KL   +      V K  +S+ +K ++TR    +  ++W+GL LY       K 
Sbjct: 300  LDTGKVSKLWKAFIRVLQLVSKPVVSKRTK-KNTRSSNDSFYQKWKGLSLYKATSGEAKA 358

Query: 337  NDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGN 396
            ND   DD+  F+L  HEYA+++ ++KC  + I Y  D PGVVPHGA PT+  +DGPDVGN
Sbjct: 359  ND--LDDI-EFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGPDVGN 415

Query: 397  GGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRL 456
             GAPPDF+LD+Q+ G +I YGPWA  ++  +Q+V SPVVSR + P ++L  GS RV+T  
Sbjct: 416  NGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLF 475

Query: 457  RISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCP 516
            R++I I  D+ WRIPTRE SKD +FL+ YKET ++ RPFGW++L   + +    NI++CP
Sbjct: 476  RMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVCP 535

Query: 517  TSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQA 576
            T  GF N   +HF++ EIR+SVNHDILL ++  +I+  IGYPLGWN+KA W  ++KS Q 
Sbjct: 536  TVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQL 595

Query: 577  RMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPV 636
              F+L++HITL+ D LSDF  GDPTPY+LFRPF+Y+ NWE+ GYS+YLNVND NIVNNP+
Sbjct: 596  EAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPL 655

Query: 637  DFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKD 696
            DFNENCYLS HGD L I   VP++SI G  T I Y + TP+FR+ +NTP WNTL+EFMK 
Sbjct: 656  DFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKH 715

Query: 697  KEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGD 756
            KEVGRA DF++ G+YL +S+LD++N+DT++IEC S  T L CYG+V+R+L  VKMNYFG+
Sbjct: 716  KEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGE 775

Query: 757  FVHFKTTEEYMEELRDAYVEPKANSEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKL 816
            F +F T+EEY   L    V          +   T  +G    + ++ KN++      K+ 
Sbjct: 776  FFNFVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGY---QNSSVKNNSEAKGPMKRS 832

Query: 817  SLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALS 876
             LKR  NE D+WFTF V +G LILP+ +Y  + C A  F  L +D R  NYYMD+ A L 
Sbjct: 833  DLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAVLD 892

Query: 877  PVIVRNLSDCDPAHLFSG-SEGRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFS 935
               ++         +F              GS+SDL IH HRM+GLPP E TYFC+WD +
Sbjct: 893  GTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWDIN 952

Query: 936  MGVXXXXXXXXXXXXFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKIND 995
            +G             F  ++ K+ F + D ENI+ Y    I DMTS+  HA  IR+ + D
Sbjct: 953  LGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRISLED 1012

Query: 996  VAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQ---VKEGGKDGSLIGDFSSS 1052
              +    ++  E++    +DFENE YS R DV +  + +    V   G D S +  F + 
Sbjct: 1013 PVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFL-KFETK 1071

Query: 1053 LKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSI 1112
            L+ T F Q K+      +Q+ +I  +D+P+HRCSFLLPL  Q SD Y+KL G+I P  SI
Sbjct: 1072 LRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGAIAPSSSI 1131

Query: 1113 PGMVEPITPENVTMILDEFLKGEKNSLQMGN---EHFCSK---------------KEEDG 1154
            P +  P  P+ +  I+++ +      L+  N   + F                   +E+ 
Sbjct: 1132 PTLPLPTLPDTIDFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFTEDDNDEEA 1191

Query: 1155 YAFNFASGLMSSTENDSNVESESLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLID 1214
             +  F  G  +   +D   E ++ VV +      I        +S  +Q YS  + Q++D
Sbjct: 1192 SSSGFKPGAFTEDGDD---EKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSENMVQVLD 1248

Query: 1215 SNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDI 1274
              EI +V              N+ +      +     G +      D +D  ++E S++ 
Sbjct: 1249 DIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMREKSLE- 1307

Query: 1275 SMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCSTSIKDLEFW 1334
                      +  + + ++ AL +V+++ + V N  +N  L       L S  ++  E W
Sbjct: 1308 ---------KNRTTKLLEVAALARVKTVRVTV-NQKKNPDLSEDRPPAL-SLGLEGFEIW 1356

Query: 1335 MTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKERLQKAQRDF 1394
             ++E  + +S N TS D  +   + E    +  + A  +  +       ++    ++ + 
Sbjct: 1357 SSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTEL 1416

Query: 1395 FYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAE 1454
               ++ AS+ YQI HDP VITKPA+I RL   HVREN+SWKIITRLRHIL YLP      
Sbjct: 1417 ISELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNN 1476

Query: 1455 IYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEGQAGPLNLRV 1514
            I   LK   + +  +A  IF+++FS WR+WE SDV + Y+Y K F +  E      NL  
Sbjct: 1477 IDKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDNEKHKQ--NLIK 1534

Query: 1515 EVDSCS-ATVSDSTHKEGDMIAVXXXXXXXXXXXXSEMVGSILAIDDGTATDGNSLSCSL 1573
            ++  C+  +   + + EG    V             ++   + ++      +   ++  +
Sbjct: 1535 KLLKCTMGSFYLTVYGEG--YEVEHNFVVADANLVVDLTPPVTSL-SLNREETIEITGRI 1591

Query: 1574 KAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILK--LMELALLIDRCEIKI 1631
             +VK   S+  +KL     L  +    D     +  P  ++ K   M   LL+D+ E+++
Sbjct: 1592 GSVKGKFSDRLLKLQDLIPLVAAVGEDD-----KSDPKTELSKQFRMNTVLLVDKSELQL 1646

Query: 1632 SLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAIIVDAFARRGS 1691
             +D      ++ G  +S    + + +     S+ +     E  ++H + I+ +A  R  S
Sbjct: 1647 VMDETKLMSRTVGGRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFS 1706

Query: 1692 LGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLAPKLKFNTRSKD 1751
            + +            ++     L  +  SST+     I  + ES   +  ++KF  +SK 
Sbjct: 1707 ILATTEAWSHKPTILINNQCADLHFRAMSSTEQTVTAITEIRESALKIKERIKFKPKSKK 1766

Query: 1752 LSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDL 1811
             S  +          +  + +SEI  LSP  I    K L + F K  ++ + + + + D 
Sbjct: 1767 KSQFVGQKINTVLTCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDF 1826

Query: 1812 DLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQD 1871
             + S  T +QYL+ S   +E+   +  +   + + + +  ++ K    +PR I+ +  QD
Sbjct: 1827 FMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLIN-VDISISMIKLTFSEPRRIVNSFLQD 1885

Query: 1872 LVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTX 1931
               A Q +      L +L +LF + +  ++          W     + Y G+L+P+ +T 
Sbjct: 1886 EKLASQGINL----LCSLKSLFFSSNIPKKEKQVPALMINWTLDTSISYFGILIPVASTY 1941

Query: 1932 XXXXXXXXXXXXXCDEAAEFSFPL-VHGELSVAGISFLINDKELPEDLSKVLEFAFRIKL 1990
                                     V G+ S+  I FLI ++ LP  LSKVL+F+ ++  
Sbjct: 1942 FVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVST 2001

Query: 1991 AKVAENSMKSLQIESTHFRIALCPFSLIRILSLA---------YEATHLSGLQALKDNAG 2041
             +   ++ +S Q+ES+HFR+ L P SL+R++  A         Y   H   +  +K   G
Sbjct: 2002 LQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMFTG 2061

Query: 2042 VKSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGK 2101
               SD  K+   I   F SI ILSY FC+GW+F     S+ GL  GY RLF+A+E+ +GK
Sbjct: 2062 --KSDKPKE---IPLNFRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGK 2116

Query: 2102 LTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGER 2161
             T++D++F +A G+TS+ F+ + +E D+ NRS LP+MQI YWF+  G   + F R +GE 
Sbjct: 2117 FTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEA 2176

Query: 2162 LDVSFLSKSIGIAGGFARSLHLFQELKRQYLD----------PFKPEEPVKRVPAGSAFS 2211
            LDV+F+   + +     +S+  FQELKR  LD                 V+  P+  A  
Sbjct: 2177 LDVNFVPSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNIYAASSVENAPSSLA-- 2234

Query: 2212 KLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRK 2271
              P L++I  VN   +Y GGVF++Y+ +DI+ K+ PSF+++SP V +   Y       R 
Sbjct: 2235 --PFLNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKVRP 2292

Query: 2272 HLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPR-TSNMQEGINYRS 2330
            H +R L++VD +HNTL+  C P++ E +  +++++K    S+ E P  T    + ++Y+ 
Sbjct: 2293 HKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIK--KHSTDEKPNFTKPSPQNVDYKR 2350

Query: 2331 LLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHN 2390
            LL   D++  +   KQQ+SLSCEPKAKVQADVGFE F   + TN+FD   PL  SL + +
Sbjct: 2351 LLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEH 2410

Query: 2391 ITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVF 2450
              A+ +HIFSREVSTS  +  +    + THPD I  YGI  +  ++V+FN+KQLQ+L +F
Sbjct: 2411 TKASIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLF 2470

Query: 2451 INIWKLDSKILSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEID 2510
            ++IW+  S + ++P    + V    ++   LTS    V   +  PW F +I + + G++D
Sbjct: 2471 LDIWRFSSILHTRPA--QRSVNKGIDMHS-LTST-SHVDLGTEIPWCFTLIFTNVSGDVD 2526

Query: 2511 LGISLGVLSLTTEKIWAVTDHYSDWXXXXXXXXXXXXXXXXGRLGGTFLLQNFRWMSQIK 2570
            LG SLGV+SL T++ W  TDHY +                 GRL G F + N  W+S++K
Sbjct: 2527 LGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVK 2586

Query: 2571 WPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLS 2630
            W   +G    PLV  ++ +D+ A+K  FDYH+ LI ++  +   L N++D +GV+ +LL 
Sbjct: 2587 WSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQ 2646

Query: 2631 VSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGXXXXXXXX 2690
            VS SSD   +  TAL  ANI D+YNTI+RMR+DN+ SY+ETL DSN  +++         
Sbjct: 2647 VSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPVLYKDIL 2706

Query: 2691 XXXXXXRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVH 2750
                  RT+LSV +  + +Q+ P +LFD+EV+  +    S  S+T   KKLKT L+L+V 
Sbjct: 2707 RSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVL 2766

Query: 2751 NVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVE 2810
            +V  ALST K +L E V + I + +Y+ +ASK+ GGTI+  P + + MTT  +  TN +E
Sbjct: 2767 DVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLE 2826

Query: 2811 LLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNGQSKSFFEDEHXXXXXXXX 2870
             L++ SF  KI VRWNLG +NF++EMW TH +A+A+RRS          +E         
Sbjct: 2827 YLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTEEELEESINKE 2886

Query: 2871 XXXXEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLA 2930
                ++ YI LEEP IE+PQ +DLG+ATPP+EWFGVNRK+FP  THQ  ++P+QKL +LA
Sbjct: 2887 ETASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLA 2946

Query: 2931 ESEWARIL 2938
            E ++ +IL
Sbjct: 2947 EKQYVKIL 2954

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score = 1926 bits (4989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1091/3002 (36%), Positives = 1655/3002 (55%), Gaps = 118/3002 (3%)

Query: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62
            S+ R VP++  +DFSWVFL DW+L + V L   FY GR+  Y ++ ILE+L WKR  +K+
Sbjct: 5    SQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRAKIKI 64

Query: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSL----ESQSEKA 107
                       GR+ FKNL+VI +D T S+L GS+TW+YWLL+ RK  L    +S S K 
Sbjct: 65   NVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSSSGKK 124

Query: 108  AKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSD---PSPRATEETST 164
            AKLPC+  +EC+GLE FIYNRT A+DN+++ L +++++  +K+ ++   P P +   ++ 
Sbjct: 125  AKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDGSSAD 184

Query: 165  ENDSAAQKSHLXXXXXXXXXXXXXLNDRTYQLPN--SMPSFLRLLPLEYSVQKGALIIGN 222
            + D    +S               +NDR YQ  +    P  L  LP+E    +G+L++GN
Sbjct: 185  KLDEDLSES-----AYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLLGN 239

Query: 223  KKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNL 282
            K T SVM+ S+E  KG +D   P  ++DLY+ K Q +   F++S++ N+ YD+   LK  
Sbjct: 240  KFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFK 299

Query: 283  PKANRLPKLLHKYYETFLRVRK-----RYLSRGSKTESTRKDLRNPLERWRGLGLYWKEN 337
                ++ KL    ++TF+RV +         +  K+  T  D  N   +W+GL LY    
Sbjct: 300  IDRGKVSKL----WKTFVRVFQIVTKPVVPKKTKKSAGTSDD--NFYHKWKGLSLYKASA 353

Query: 338  DPA----WDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPD 393
              A     DDV  F+L  HEYA+++ ++KC  + I Y  D PGVVPHGA PT+  +DGPD
Sbjct: 354  GDAKASDLDDV-EFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPD 412

Query: 394  VGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVF 453
            VGN GAPPDF+LD+Q+ G +I YGPWA  ++  +Q+V SPVVSR + P ++L  GS R++
Sbjct: 413  VGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIY 472

Query: 454  TRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIA 513
            T  R++I IM D+ WRIPTRE SKD +FLK YKET ++ RPFGW++L   + +    NI+
Sbjct: 473  TLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNIS 532

Query: 514  MCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKS 573
            +CPT  GF N   +HF++ EIR+SVNHDILL ++  DI+  IGYPLGWN+KA W  ++KS
Sbjct: 533  VCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKS 592

Query: 574  HQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVN 633
             Q   F+L++HITL+ D LSDF  GDPTPY+LFRPF+Y+ NWE+ GYS+YLNVND NIVN
Sbjct: 593  EQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVN 652

Query: 634  NPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEF 693
            NP+DFNENCYLS HGD L I   VP++SI G  T + Y + TP+FR+ +NTP WNTL+EF
Sbjct: 653  NPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEF 712

Query: 694  MKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNY 753
            MK KEVGRA DF++ GSYL +S+LD++N+DT++IEC S+ T L CYG+V+R+L  VKMNY
Sbjct: 713  MKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNY 772

Query: 754  FGDFVHFKTTEEYMEELRDAYVEPKANSEQSANSTETTTAGEGEDKQNAPKNHTTDPVMA 813
            FG+F +F T+EEY   L    V         A+   T  +G    + ++ KN + D    
Sbjct: 773  FGEFFNFVTSEEYTGVLGAREVGDVTTKSSVADLASTVDSGY---QNSSLKNESEDKGPM 829

Query: 814  KKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQA 873
            K+  LKR  NE D+WFTF V DG LILP+ +Y  + C A  F  L +D R  NYYMD+ A
Sbjct: 830  KRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMA 889

Query: 874  ALSPVIVRNLSDCDPAHLFSG-SEGRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKW 932
             L+   ++         +F              G +SDL IH HRM+GLPP E TYFC+W
Sbjct: 890  VLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQW 949

Query: 933  DFSMGVXXXXXXXXXXXXFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVK 992
            D ++G             F +++ K+ F + D ENI+ Y    I DMTS+  H  +IR+ 
Sbjct: 950  DINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIG 1009

Query: 993  INDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQ---VKEGGKDGSLIGDF 1049
            + D  +    ++  E++    +DFENE+YS R DV I  +T+    V   G D S +  F
Sbjct: 1010 LKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFL-KF 1068

Query: 1050 SSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPG 1109
             + L+ T F Q K+      +Q+ +I  +D+P+HRC FLLPL  Q SD Y+ L G+I P 
Sbjct: 1069 ETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGAIAPS 1128

Query: 1110 VSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNEHFCSKKEEDGYAFNFASGLMSSTEN 1169
             SIP +  P  P+ +  I+++ + GE  +L      F +   E       +    S  +N
Sbjct: 1129 SSIPTLPLPTLPDTIDYIIEDIV-GEYATLLETTNPFKNIFAETPSTMEPSRASFSEDDN 1187

Query: 1170 DS----------------NVESESLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLI 1213
            D                 N E ++ VV +      +        +S  +Q YS  + Q++
Sbjct: 1188 DEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVL 1247

Query: 1214 DSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVD 1273
            D  EI +V              N+ +      +     G +      D +D  + E S++
Sbjct: 1248 DDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLE 1307

Query: 1274 ISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCSTSIKDLEF 1333
                       +  + + ++ AL KV+++ + V N  +N  L       L S  I+  E 
Sbjct: 1308 ----------KNRTNKLLEVAALAKVKTVRVTV-NQKKNPDLSEDRPPAL-SLGIEGFEV 1355

Query: 1334 WMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKERLQKAQRD 1393
            W ++ED + +S N TS D  +   + E    +  +    I  +    +  +     ++ +
Sbjct: 1356 WSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTE 1415

Query: 1394 FFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLA 1453
               +++ AS+ YQI HDP VITKPA+I RL   HVREN+SWKIITRLRHIL YLP    +
Sbjct: 1416 LISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQS 1475

Query: 1454 EIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEGQAGPLNLR 1513
             I   LK   + +  +A  IF+++FS WR+WE SDV + Y+Y K F ++ E      NL 
Sbjct: 1476 NIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQ--NLI 1533

Query: 1514 VEVDSCS-ATVSDSTHKEGDMIAVXXXXXXXXXXXXSEMVGSILAIDDGTATDGNSLSCS 1572
             ++  C+  +   + + EG    V             ++   + ++      +   ++  
Sbjct: 1534 KKLLKCTMGSFYLTVYGEG--YEVEHNFVVADANLVVDLTPPVTSL-PSNREETIEITGR 1590

Query: 1573 LKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLMELALLIDRCEIKIS 1632
            + +VK   S+  +KL     L  +    D     + L   K  K M   LL+D+ E+++ 
Sbjct: 1591 VGSVKGKFSDRLLKLQDLIPLIAAVGEDDKSDPKKEL--SKQFK-MNTVLLVDKSELQLV 1647

Query: 1633 LDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAIIVDAFARRGS- 1691
            +D      ++ G  +S    + + +     S+ +     E  ++H + I+ +A  R  S 
Sbjct: 1648 MDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSV 1707

Query: 1692 LGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLAPKLKFNTRSKD 1751
            L +  + S   T+  ++     L  +  SST+     I  + ES   +  ++KF  +SK 
Sbjct: 1708 LATTEAWSHKPTI-LINNQCADLHFRAMSSTEQLVTAITEIRESLMMIKERIKFKPKSKK 1766

Query: 1752 LSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDL 1811
             S  +          +  + +SE+  LSP  I    K L + F K  ++ + L + + D 
Sbjct: 1767 KSQFVDQKINTVLSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDF 1826

Query: 1812 DLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQD 1871
             + S  T +QYL+ S   +E+   I  +   + + + +  ++ K    +PR I+ +  QD
Sbjct: 1827 FMTSHQTKEQYLRFSFGDIEIKGGISREGYSLIN-VDISISMIKLTFSEPRRIVNSFLQD 1885

Query: 1872 LVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTX 1931
               A Q +      L +L  LF + +  ++          W     + Y G+LVP+ +T 
Sbjct: 1886 EKLASQGINL----LYSLKPLFFSSNLPKKEKQAPSIMINWTLDTSITYFGVLVPVASTY 1941

Query: 1932 XXXXXXXXXXXXXCDEAAEFSFPL-VHGELSVAGISFLINDKELPEDLSKVLEFAFRIKL 1990
                                     V G+ S+  I FLI ++ LP  LSK+L+F+ ++  
Sbjct: 1942 FVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVST 2001

Query: 1991 AKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSGLQALKDNAGV-------K 2043
             +   ++ +S Q+ES+HFR+ L P SL+R++  A++   LS   + +    +        
Sbjct: 2002 LQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRRHAPNIWNTKMFTG 2061

Query: 2044 SSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLT 2103
             SD +K+   +   F SI ILSY FC+GWIF     SN GL  GY RLF+A+EK +GK T
Sbjct: 2062 KSDKSKE---MPINFRSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFT 2118

Query: 2104 LLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLD 2163
            ++DA+F +A G+TS+ F+ + +E D+ NRS LP+MQI YWF+  G   + F R +GE LD
Sbjct: 2119 VVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALD 2178

Query: 2164 VSFLSKSIGIAGGFARSLHLFQELKRQYLD---PFKPEEP---VKRVPAGSAFSKLPILS 2217
            V+F+   + +     +S+  FQELK+  LD     + E            ++ S  P L 
Sbjct: 2179 VNFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNSYASTSVESASSSLAPFLD 2238

Query: 2218 SISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRAL 2277
            +I  VN   +Y GGVF++Y+ +DI+ K+ PSF+++SP V +   Y       + H  R L
Sbjct: 2239 NIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDEDKVKPHKFRTL 2298

Query: 2278 MSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPR-TSNMQEGINYRSLLQDVD 2336
            ++VD +HNTL+  C P++ E +  +++++K    S+ E P  T    + ++Y+ LL   D
Sbjct: 2299 ITVDPTHNTLYAGCAPLLMEFSESLQKMIK--KHSTDEKPNFTKPSSQNVDYKRLLDQFD 2356

Query: 2337 ISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSR 2396
            ++  +   KQQ+SLSCEPKAKVQADVGFE F   + TN+FD  +PL  SL + +  A+ +
Sbjct: 2357 VAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTLEHTKASIK 2416

Query: 2397 HIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKL 2456
            HIFSREVSTS  +  +    + THPD I  YG   +  + V+FN+KQLQ+L +F++IW+ 
Sbjct: 2417 HIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIWRF 2476

Query: 2457 DSKILSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLG 2516
             S + ++P    + V     +    ++ Y    + +  PW F +I + + G++DLG SLG
Sbjct: 2477 SSILHTRPV--QRTVNKEIEMSSLTSTNYAD--AGTEIPWCFTLIFTNVSGDVDLGPSLG 2532

Query: 2517 VLSLTTEKIWAVTDHYSDWXXXXXXXXXXXXXXXXGRLGGTFLLQNFRWMSQIKWPLNEG 2576
            ++SL T++ W  TDHY++                 GRL G F + N  W+S++KWP  + 
Sbjct: 2533 MISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKS 2592

Query: 2577 SFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSD 2636
                PLV  ++ +D+ AVK  FDYH+ LI ++  +   L N++D +GV+ +LL VS SSD
Sbjct: 2593 KNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSD 2652

Query: 2637 STQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGXXXXXXXXXXXXXX 2696
               +  TAL  ANI D+YNTI+RMR+DN+ SY+ETL DSN  +++               
Sbjct: 2653 EIILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDILRSLKLL 2712

Query: 2697 RTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLAL 2756
            RT+LSV +    +Q+ P +LFD+EV+  +    S  S+T   KKLKT L+L+V +V  AL
Sbjct: 2713 RTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAAL 2772

Query: 2757 STYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNS 2816
            ST K +L E V + I + +Y+ +ASK+ GGTI+  P + + MTT  +  TN +E L++ S
Sbjct: 2773 STSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACS 2832

Query: 2817 FGGKIGVRWNLGSINFLREMWATHARAMALRRSHNGQSKSFFEDEHXXXXXXXXXXXXEY 2876
            F  KI VRWNLG ++F++EMW TH +A+A+RRS          +E             ++
Sbjct: 2833 FSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTEEELEESIKKEEAASKF 2892

Query: 2877 TYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWAR 2936
             YI LEEP IE+PQ +DLG+ATPP+EWFGVNRK+FP  THQ  ++P+QKL +LAE ++ +
Sbjct: 2893 NYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEKQYVK 2952

Query: 2937 IL 2938
            IL
Sbjct: 2953 IL 2954

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score = 1883 bits (4878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1100/3033 (36%), Positives = 1649/3033 (54%), Gaps = 154/3033 (5%)

Query: 2    SSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVK 61
            SSEF+ VPIS  ++FSWVFL DW+L++ + L   FY GR + Y  + ILE+L WKR  +K
Sbjct: 4    SSEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRAHIK 63

Query: 62   V-----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTS--LESQS---- 104
            V           GR+FFKN+T+I +D T S+L G++TWRYWLL +RK S  LES+     
Sbjct: 64   VNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDSNGV 123

Query: 105  --EKAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKF-----FSDPSPR 157
              +K  +LPCRF + C+G E F+YNRT ++DNI++   +E++   +KF     F+D S  
Sbjct: 124  TMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDHSSY 183

Query: 158  ATEETSTENDSAAQKSH--------LXXXXXXXXXXXXXLNDRTYQLPNSMPS--FLRLL 207
            +++ T+  N S  + +                        NDR +    S     FL+  
Sbjct: 184  SSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFLQTF 243

Query: 208  PLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSL 267
            P+E  V + +L  GNK T S+++ S E   G +D C P  K+DLYK+KL  +   F +++
Sbjct: 244  PVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFAVTV 303

Query: 268  RPNLCYDNDEPLKNLPKANRLPKLLHKYYE-TFLRVRKRYLSRGSKTESTRKDLRNPLER 326
            +PN+ Y  +  LK      +L +L  ++   T +  R   L++  K  +   DL   +++
Sbjct: 304  KPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLF--IQK 361

Query: 327  WRGLGLYWKE-NDPAWDDV--FHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAF 383
            W+GL LY     +P  DD+    F+   HEYA++S V+KC   +  Y +D PG VPHGA 
Sbjct: 362  WQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGAH 421

Query: 384  PTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTE 443
            PT   +DGPDVGN GAPP  SLDIQ+FG +I YGPW   ++  I  + +P VSR   P +
Sbjct: 422  PTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPVK 481

Query: 444  RLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLA 503
            R   GSTR++T  ++SI IM D+ WRI TREPSKD  FLK YKET DD RPFGW++L  +
Sbjct: 482  RRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRFS 541

Query: 504  EGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNA 563
            + S      A+ PT+ GF N +++H  + EIR+SVNHDIL+  +  D +  + YPL WN 
Sbjct: 542  KESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWND 601

Query: 564  KAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMY 623
            +A W  D+ S+Q   F+L++HITL+ D L+DF +G+PTPY+LFRP     NW++  Y +Y
Sbjct: 602  RATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFIY 661

Query: 624  LNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMN 683
            LNVND NIVNNP+DFNENCYLS HGDDL I+  +P + I      I YN+ TP+FRL +N
Sbjct: 662  LNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRLLLN 721

Query: 684  TPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVV 743
            TP WNTL+EFMK KEVGR+ DFS  GSYL +S+LDV+N+DTI I C+SR TTL+CYG+V+
Sbjct: 722  TPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFVI 781

Query: 744  RFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKA-NSEQSANSTETTTAGEGEDKQ-N 801
            R+L  VKMNYFGDF +F T+EEY    RD  +E +  +S  S N        +GE    +
Sbjct: 782  RYLANVKMNYFGDFFNFITSEEYTGITRDEELEEELISSNLSDNEDNGDVYSDGESGMDD 841

Query: 802  APKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDID 861
            A      +    K+  L+R  NE D++ TF V DG +ILP+ +Y+C+ C A +F  L ID
Sbjct: 842  AISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGELIID 901

Query: 862  LRYINYYMDLQAALSPVIVRNLSDCDPAHLFSG--SEGRCPSRANFGSISDLHIHAHRMF 919
            LR  NYYMDL A+L   ++   ++  P  +F     + R  S A  G +SDL IH HRMF
Sbjct: 902  LRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQ-GFLSDLSIHGHRMF 960

Query: 920  GLPPDEETYFCKWDFSMGVXXXXXXXXXXXXFGDAWSKLAFSFKDYENIMNYKIVPILDM 979
            GLPP+E TYFCKWDF +GV            F  ++S++ F FKD ENI+ Y    I DM
Sbjct: 961  GLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVINDM 1020

Query: 980  TSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQVKEG 1039
            TS+  +A EI V + +      + ++ ++V    +DFE+  YSSR D+ I S+ + +   
Sbjct: 1021 TSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSMYGL 1080

Query: 1040 GKDG--SLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSD 1097
              DG  + + +F++ + +T F Q KNF  H   Q+++I  NDA FHR SFLLP + Q+ +
Sbjct: 1081 DIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQKKE 1140

Query: 1098 NYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNEHF----------- 1146
             Y +L GSIVP  S+P +  PI P+ V  IL++FL GE  SL      F           
Sbjct: 1141 LYNELYGSIVPSSSLPVLALPILPKTVDFILEDFL-GEYVSLLDDRTIFRMPFGSTNTPN 1199

Query: 1147 --CSKKEEDGYAFNFASGLMSSTENDSNVESESLVVKLIKPQASISACCIKPFRSFSDQA 1204
               +  EED     F++  +S+   + N + ++LV+ +      I+        S S   
Sbjct: 1200 QASTHHEEDMDPLEFSNSTVST---EKNYQCDNLVIDIEYISVEINPSISTYIESLSSTV 1256

Query: 1205 YSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVD 1264
            Y   + Q+ID  EIE +              N+K         L    SD      D   
Sbjct: 1257 YEENIVQVIDDIEIETIKILSTFQEGTSSITNIK---------LRVLYSDIYWGERDRYG 1307

Query: 1265 IVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHED-QL 1323
            I +    +D  M +       EK  ++ IT L K  S+   +   S  G  +N  E    
Sbjct: 1308 IELYLDKLDFEMSQRNIEKDREKGLLE-ITMLAKTRSIRASI---SEEGSTKNEKERPPA 1363

Query: 1324 CSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVH 1383
             S  ++  E W  + + + +S +  S D  +   + E   +F+     N+  I   ++  
Sbjct: 1364 LSLVVEGCELWSATAEKQVNSIDTISTDITIDESQLEWLFLFVNEQNQNLQNIITTLNSV 1423

Query: 1384 KERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHI 1443
            +     ++R    +++ A+D YQI HDP VITKPA+ITRL   HVREN+SWKIITRLRHI
Sbjct: 1424 QAEHTVSRRKLISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHI 1483

Query: 1444 LNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYS-Q 1502
            L Y+P    + +   LK  S      A ++F+++FS WR+WE SDV + Y+Y + F + Q
Sbjct: 1484 LTYIPSDWESGVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQ 1543

Query: 1503 YEGQAGPLNLRVEVDSCSATVSDSTHK---EGDMIAVXXXXXXXXXXXXSEMVGSILAID 1559
             E     +   ++V+  S  ++  T     + + +              +E         
Sbjct: 1544 AEKHKQSMRRIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEA-------- 1595

Query: 1560 DGTATDG-NSLSCSLKAVKASISETAIKLLAFRELF----ESQNSQDILSNTQVLPSGKI 1614
             G + +   +L+ S+ +VK + S+   +LL  +EL     + Q   +   + QV    K 
Sbjct: 1596 -GVSREKLINLTGSIGSVKGNFSD---ELLRLKELIPLLNKEQEKMERSPSFQVDNIPKS 1651

Query: 1615 LKLMELALLIDRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFD 1674
             KL  L LL ++ E+++ +       +     +S  L   + A     S+ L     E  
Sbjct: 1652 FKLNAL-LLFEKTEVQLVIGESKLTNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETL 1710

Query: 1675 VRHNNAIIVDAFARRGSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSE 1734
            + H N  +V+   R  SL + +    S     V        +K  + T    N +  + +
Sbjct: 1711 ITHRNTTLVENQVRDFSLSATVESWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQ 1770

Query: 1735 SWSSLAPKLKFNTR---SKDLSPEMKNFSKVAFEA--HVDDFTSEISALSPLSISKRFKG 1789
            +  ++  +L  + R    ++ SP+ K    V  E    + + + EI  +SP  I    K 
Sbjct: 1771 TVKNIDKQLSISDRLAEGENKSPK-KKLKDVEIEVVCQLSNVSFEIMPISPFYIRHETKK 1829

Query: 1790 LTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQL 1849
              ++F++  + ++ + V + D  L S++T QQY ++S    ++T  + +  E +     +
Sbjct: 1830 FDLKFKQFGSQNVMIDVWDTDFFLRSDLTKQQYFRISFGDFQITYNLIEG-EFIIVDANV 1888

Query: 1850 ESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWP 1909
             +++ K    +P  I+ +  QD   A ++ + LK    AL   F    T+  +       
Sbjct: 1889 SASMIKLTFSEPNRILSSFLQDERTASESFKLLK----ALKP-FLLPQTEGRLQPATTKE 1943

Query: 1910 REWLWQLDMKYVGLLVPLGTTXXXXXXXXXXXXXXCDEAAEFSFP-LVHGELSVAGISFL 1968
              WL   D+KY G+LVP+ TT                +  +++       ++S+  + FL
Sbjct: 1944 MRWLLDTDIKYFGILVPISTTYFVFETHALVLSMSDIDTEKYTEKDETQSQVSIENVVFL 2003

Query: 1969 INDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEAT 2028
            I D+ +P  LS++L+F+      +       S Q+ES HFRI L P+SL+R   L +   
Sbjct: 2004 IKDRGIPSALSRMLDFSISFSTIQKMMELDTSFQVESNHFRIFLSPYSLVR---LVWGGQ 2060

Query: 2029 HLSGL-QALKDNAGVKSSDDAKDFF--------NISQTFHSIQILSYDFCLGWIFNNDGA 2079
               GL    K+  G    D              +I     S  +LSY+FC+GW+F    A
Sbjct: 2061 QFLGLANYYKEQRGTDLWDIKASKLKKEKKGSSSIGMNMSSFHVLSYNFCIGWMFPEANA 2120

Query: 2080 SNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQ 2139
            S  G+  G+ RLF+A+E  YGKLTL+DA+F +ARG+TS  FY +  E++  NRS LP+MQ
Sbjct: 2121 SAPGIMLGFSRLFSAYEGGYGKLTLVDAFFSVARGATSATFYPRESELESVNRSYLPNMQ 2180

Query: 2140 ICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEE 2199
            I YW + +G   ++F+R +GE LDVSFL+  I +     +S  +FQELK   + P     
Sbjct: 2181 IAYWVKKSGLMKDVFIRFHGEALDVSFLTTFITVIESMLQSFQVFQELKTSLIQPNTSTT 2240

Query: 2200 PVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVI 2259
                 P   + +  P LS+I  VNC+ +Y GGVFK++S +DI+    PSF+L++P V + 
Sbjct: 2241 ENNTEPKIKSLA--PFLSNIKSVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIID 2298

Query: 2260 FEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLK----DLNKSSVE 2315
            F Y   +   + H +RAL+++ S+HNTLF  C P+I+E    I +++K    +    S+ 
Sbjct: 2299 FNYKHNIGSLKPHWIRALVAIGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIA 2358

Query: 2316 TPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTND 2375
            T  +    + I+Y+ LL   DI+F +   +Q++SLSCEPKAKVQADVGF+ F + + TN+
Sbjct: 2359 TNLSKAPSQNIDYKRLLDGFDIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNN 2418

Query: 2376 FDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTI 2435
             D  EPL+ SL I    A+ +HIFS+E STS  ++ +   FM THPD I+ YG   I  +
Sbjct: 2419 LDETEPLTFSLSIKKTKASIKHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEV 2478

Query: 2436 DVYFNIKQLQDLNVFINIWKLDSKILSQP-------ELDNKFVI--GPTNLEKPLTSKYK 2486
            D+YFN+KQLQ+L +FI+IWKL S I   P       + +NK +    P+NL       Y 
Sbjct: 2479 DLYFNVKQLQNLYLFIDIWKLSSFIRPGPKGKSNNGKRENKHLTLPQPSNL-------YG 2531

Query: 2487 KVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWXXXXXXXXXXX 2546
            ++      PW+F +I + I G  DLG SLGVLSL  ++ W  +DHY D            
Sbjct: 2532 EI------PWSFTLIFTNINGSADLGPSLGVLSLKLKRTWVASDHYQDKRQVIRAFTDYL 2585

Query: 2547 XXXXXGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIA 2606
                 GRL G F L    WMS++ WP  + +   PLV +++ +D  ++K  FDYH+ LI 
Sbjct: 2586 SFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPLVNVSVNIDNLSLKAAFDYHMFLIG 2645

Query: 2607 SVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRK 2666
            ++     SL +++D  G + +LL V+ + +   +  TAL  ANI D+YNT++RMR+DN+ 
Sbjct: 2646 TISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICSTALVAANILDLYNTVMRMRQDNKI 2705

Query: 2667 SYLETLGDSNTRDTKGX-XXXXXXXXXXXXXRTELSVMLKFVHIQVYPSTLFDMEVMTFK 2725
             YLETL +S+T +T+G               +T++S  +  + +QV P  LFD+EV+   
Sbjct: 2706 LYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVSTNIHVLKLQVSPIALFDLEVLVIN 2765

Query: 2726 ARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDG 2785
              + S  + T   +KLKT L+L+V++  +ALST K ++ E   S I V +Y+E+ASK+ G
Sbjct: 2766 IENISARAGTFAGEKLKTILELEVYDGYVALSTSKREIDEDTVSAISVADYMEYASKISG 2825

Query: 2786 GTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMA 2845
            GTI+  P + I MT+W +  ++ +E LY  +F  KI V+WNLG +NF++EMW TH +A+A
Sbjct: 2826 GTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKIAVKWNLGPVNFIKEMWTTHVKALA 2885

Query: 2846 LRRSHNGQSKSFFEDEHXXXXXXXXXXXXEYTYIPLEEPHIEIPQTKDLGEATPPVEWFG 2905
            +RRS N        DE             +  Y+P+EEP I++PQ +DLG+ATPP+EWFG
Sbjct: 2886 VRRSQNVLDTDMQTDEEVQKRIKEEENISKLKYVPIEEPRIDMPQIRDLGDATPPLEWFG 2945

Query: 2906 VNRKQFPGLTHQGVIVPLQKLAHLAESEWARIL 2938
            VNRK+ P  THQ V+VP+QKL H AE ++A +L
Sbjct: 2946 VNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLL 2978

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score = 1838 bits (4761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1062/3035 (34%), Positives = 1686/3035 (55%), Gaps = 182/3035 (5%)

Query: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62
            S+F+R+P++  +DFSWVFL DW+LIL V+L   FY  R L Y I+ ILE+  WKR  VK+
Sbjct: 5    SQFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRSNVKI 64

Query: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLES------QSE 105
                       GRVFFKN+ +I QD T S L  ++TWRYWLL+ RK+  ++       S 
Sbjct: 65   NIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPDKASA 124

Query: 106  KAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKF-----FSDPSPRATE 160
             + KLPCRF +E +GLE F+YNR  A+DNI+    +E++   +KF     F+D     + 
Sbjct: 125  NSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTDSKAEVSN 184

Query: 161  -ETSTENDSAAQKSHLXXXXXXXXXXXXXLNDRTYQLPNS-MPSFLRLLPLEYSVQKGAL 218
             E+++E D+                     NDR +Q   S  P FL  LP+++ V  G+L
Sbjct: 185  SESNSEEDTFESAGTFKSDSSTT-------NDRVFQEELSERPQFLDFLPIDFKVSHGSL 237

Query: 219  IIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEP 278
            IIGNK T S+M+ S     G +D C P  K+DLYK++   D   F + ++ N+ ++ +  
Sbjct: 238  IIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFS 297

Query: 279  LKNLPKANRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKDLRNPL-ERWRGLGLYWKE- 336
            +K     NR+ K+  ++ +  L        + S   S +    +P  E+WRGL LY    
Sbjct: 298  MKFKIDRNRVSKMWQQFNKVLLTCYSHM--KLSHLRSNKVSEEDPFYEKWRGLSLYRGTI 355

Query: 337  --NDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDV 394
                    +   F+   HEYA++S +++    +  +  D PG+VPHGA PTL   DGPDV
Sbjct: 356  FGKSNDDINDIDFDFANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDV 415

Query: 395  GNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFT 454
            GN GAPP+FSL+IQ+ G +I +GPWA  ++  + ++ SP+ SR++ PT+RL+ G TR++T
Sbjct: 416  GNSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYT 475

Query: 455  RLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAM 514
            + + +I    ++ WRIPTRE SKD +FL+ Y+ET ++ RPFGW++L  ++ + +   +A 
Sbjct: 476  QFKTTISTTEETTWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQ 535

Query: 515  CPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSH 574
            CPT  GF N LD+H    EIR+SVNHDILL  ++ +    IG+PLGWN +A W  DL+S 
Sbjct: 536  CPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLEST 595

Query: 575  QARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNN 634
            Q   FIL++HITL+ D L+DF +G+PTPY+LFRPF+Y  NW++ GYS+YLNVND NIVNN
Sbjct: 596  QLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNN 655

Query: 635  PVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFM 694
            P+DFNENCYLSFHGD L+I   VP+  ++   T + Y +YTP+FRL +NTP WNTL+EFM
Sbjct: 656  PLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFM 715

Query: 695  KDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYF 754
            K+KEVGR+ DF + GSYL +S+LD++N+DTIIIEC S+ T L+CYG+V+R+L  VKMNYF
Sbjct: 716  KNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYF 775

Query: 755  GDFVHFKTTEEYMEELRDAYVEPKANSEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAK 814
            GDF HF T+EEY  E+R   V+ +    Q      + ++ E  +  +  K  T D  + K
Sbjct: 776  GDFFHFVTSEEYTGEIRANEVQNQFTDRQLYEDKASLSSYESIETSSVRKEQTGDSKI-K 834

Query: 815  KLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAA 874
            +  LKR  NE D+WFTF V +G ++LP+ +Y+C+ C    F  L ID R  NYYMDL A+
Sbjct: 835  RSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLAS 894

Query: 875  LSPVIVRNLSDCDPAHLFSG--SEGRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKW 932
            ++ + +R         ++     +  C ++  +GS+SD+ IHAHRM+GLPP E TYFC+W
Sbjct: 895  MNDISLRRYIGKQQNEIYESVRQDNGCGNK-KYGSLSDMVIHAHRMYGLPPLEPTYFCQW 953

Query: 933  DFSMGVXXXXXXXXXXXXFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVK 992
            DFS+G             F  +++K++F   D ENI+ Y+   I DMTS+     +I + 
Sbjct: 954  DFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIM 1013

Query: 993  INDVAVDYYIIVEVENVTARGVDFENERYSSRAD--VDIHSITVQVKEGGKDGSLIGDFS 1050
            I +  +D +++   E +    ++FENE+Y +R D  + I ++ +    G K   L  +F 
Sbjct: 1014 IRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEKLF-EFE 1072

Query: 1051 SSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGV 1110
            + + ++ F +  +   H  +Q+ +I  +DAP+HRC+F+LP ++Q S+ Y+ L GSI P  
Sbjct: 1073 TKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGSIAPSS 1132

Query: 1111 SIPGMVEPITPENVTMILD-------EFLKGEK---------NSLQMGNEHFCSKKEEDG 1154
            S+P +  P+ P  +  I+D       E L+ E           S ++GN    S  E D 
Sbjct: 1133 SLPPLPIPLLPATIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGSDTESDE 1192

Query: 1155 YAFNFASGLMSSTENDSNVE---SESLVVKLIKPQASISACCIKP-FRSFSDQAYSNF-- 1208
                    L   TE   + E   S++ V+ +     S  +  I P   S+ D    +F  
Sbjct: 1193 E----LDPLEFKTETSGDSETFASDNFVIDI-----SYCSLSINPRLWSYLDNCREHFCS 1243

Query: 1209 --VEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIV 1266
              + Q++D  EI +V H  +     +  +N+K+     ++   +  +  IS   D +D+ 
Sbjct: 1244 QDIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLE 1303

Query: 1267 IKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCST 1326
            + +      M EE     + ++ + ++T L K+ S+   ++  S  G  +        S 
Sbjct: 1304 MCQ-----KMLEE-----NNETKITEVTFLNKIRSVRATINEASSVGKAD--ERPPALSL 1351

Query: 1327 SIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKER 1386
             I+  E W    + + +S N  S D  +   + +    ++         I   +   +E 
Sbjct: 1352 VIEGSEIWSCITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQES 1411

Query: 1387 LQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNY 1446
                ++    +++ AS+ YQI HDP VITKPA+ITRL   HVREN+SWKIITRLRHIL Y
Sbjct: 1412 RSTTRKQLVSKLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTY 1471

Query: 1447 LPPSLLA---EIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAF---Y 1500
            LP   L    E+     S +   P NA   F+++FS WR+WE SD+ + Y+YR  F   +
Sbjct: 1472 LPIDWLRVIDEMRNQQDSHTLPDPGNA---FISVFSNWRNWEFSDIARSYIYRNMFSEGH 1528

Query: 1501 SQYEGQAGPLNLRVEVDSCSATVSDSTHK-EGDMIAVXXXXXXXXXXXXSEMVGSILAID 1559
            S+ +  +   ++++++ S   TV  + ++ E + I                +V ++ AI 
Sbjct: 1529 SKKQENSMENSIKLKLASLFFTVYSTGYEVEHNFILTRTNV----------VVETLPAIS 1578

Query: 1560 DGTATDGN--SLSCSLKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKL 1617
            D +       +++ SL  +K    +T+ KL+  ++L    + +  L      PS   L+ 
Sbjct: 1579 DSSIIQEKIINVTGSLGTIKG---KTSHKLINLKKLLPELSMKKNLK-----PSTPFLRC 1630

Query: 1618 MEL--ALLIDRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGS---SMALAWSWFE 1672
             +L   LL +R E++  L +     + FG  +S      ES +D  S   SM +     E
Sbjct: 1631 FKLNMLLLFERSELQFVLGASKVMSRVFGGKLSMLW---ESPKDLASKAISMTVYAQRSE 1687

Query: 1673 FDVRHNNAIIVDAFARRGSLGSFISQSESTTLH---RVHLGSQKLRLKVPSSTKDYCNFI 1729
              ++H+N I+ ++  R  S+   I  +ES +      V+L    +  +  ++T      +
Sbjct: 1688 MWMKHHNIILAESQMREFSI---IITAESWSYKPTVLVNLQCTDIHFRAMTATDVLAKSV 1744

Query: 1730 NSLSESWSSLAPKLKFNTRSKDLS-----PEMKNFSKVAFEAHVDDFTSEISALSPLSIS 1784
              + E+   L  KL ++     +      P M+    +    +  +   EI  LSP S  
Sbjct: 1745 GEIIENIKELE-KLFYSDSDSGIQQISQYPVMEQKINMVLTCYFTNVNLEIMPLSPFSFR 1803

Query: 1785 KRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVA 1844
               K L + F +  ++ L L V + DL L+S +T ++Y + S   ++L   I +      
Sbjct: 1804 HNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFGNIQLKGNILEN-PNYT 1862

Query: 1845 SKMQLESALTKFKLCDPREIIETLTQD---LVNAKQNLEQLKIHLLALGALFGTDSTDEE 1901
              + + +++ K  L D R +I +  QD   L+ + +    LK+      A   T+ +   
Sbjct: 1863 INIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQFSSLKLFQRKKPAP-STEKSGRT 1921

Query: 1902 VFAGALWPREWLWQLDMKYVGLLVPLGTTXXXXXXXXXXXXXXCDEAAEFSFPLVHGELS 1961
            V         W  + ++ Y GLLVP+ +T                +     +  + G+ S
Sbjct: 1922 V--------TWSLESNINYFGLLVPISSTYFILELHMLLMSLNKIQGISSKYNGLSGQFS 1973

Query: 1962 VAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRIL 2021
            +  + FL+ +K LP DLSK+L+F+ ++   +  + + +S QIES HFR+ L P SL  +L
Sbjct: 1974 IDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCLSPGSLAHML 2033

Query: 2022 SLAYEATHLSGLQALKDNAGV--------KSSDDAKDFFNISQTFHSIQILSYDFCLGWI 2073
                +A  L+ ++  K++  V        K+++++ +   +   F S  +LSY+FC+GW+
Sbjct: 2034 WRGNQA--LTNIRYYKEHTSVAWEKVINFKNTNNSAE---VQADFPSFHVLSYNFCVGWL 2088

Query: 2074 FNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRS 2133
            F+ +  +  GL  GY RLF+A+EK +GKLTL+DAYF +A G TS+ F+ +  E DR NRS
Sbjct: 2089 FSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKDRYNRS 2148

Query: 2134 SLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLD 2193
             LP+MQI YW +  G   ++++R +GE LDV+FL+  I +      S+  FQELKR  + 
Sbjct: 2149 YLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELKRDLVG 2208

Query: 2194 PF----KPEEPVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSF 2249
                  +  +   + P G      P  + I  +NC+ +Y GGVFK++S  +      PSF
Sbjct: 2209 TASNIKEQTQSTTQEPIGDI---SPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKPSF 2265

Query: 2250 QLESPSV--DVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLK 2307
            +++SP+V  D+ ++Y +  T +    +R L++++S+HNTLF  C P+I+E +  I++++K
Sbjct: 2266 EIKSPNVIIDMNYKYNEKKT-QTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMVK 2324

Query: 2308 DLNKSSVETPRTSNM-QEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEK 2366
                SS   P  +N+ ++ I+Y+ +L   D++  +   KQ +SL CEP+AKVQAD+GF+ 
Sbjct: 2325 --RHSSDREPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQS 2382

Query: 2367 FAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHT 2426
            F   + TND+D  EPL  +L +    A+ +HIFSRE STS  ++ +    M THP++I+ 
Sbjct: 2383 FTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINI 2442

Query: 2427 YGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVIGPTNLEKPLTSKYK 2486
             G   I  + V+FN+KQLQ+L +F++IWKL + + S+P   N+ V   T+L K L+S   
Sbjct: 2443 LGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPM--NEVVKSRTDL-KSLSSVQS 2499

Query: 2487 KVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWXXXXXXXXXXX 2546
            K  ++S+ PW F +I S I G++DLG +LGVLSL  ++ W  TDHY              
Sbjct: 2500 KD-TDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGI 2558

Query: 2547 XXXXXGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIA 2606
                 GRL G   L    W+S++ WP+ E   + PLV +++ +D    K+ FDYH+ L+ 
Sbjct: 2559 TLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVG 2618

Query: 2607 SVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRK 2666
            ++  + + + +++D  G+  +LL V++  ++ ++  TAL  ANI D+YNT++R+R+DN+ 
Sbjct: 2619 AINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKI 2678

Query: 2667 SYLETLGDSNTRDTKGXXXXXXXXXXXXXXRTELSVMLKFVHIQVYPSTLFDMEVMTFKA 2726
            SY+ETL +SNT + +               +T++SV +  ++IQ+ P +LFD E++    
Sbjct: 2679 SYIETLKESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNI 2738

Query: 2727 RDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGG 2786
             + S  S+T    KLKT+L+++V++  +ALST K +L E + + I V++Y+ +A ++ GG
Sbjct: 2739 ENISARSETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGG 2798

Query: 2787 TILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMAL 2846
             I+  P +LI MTT+    ++ +E LY+ SFG KI VRWNLG +NF++EMWATH RAMA+
Sbjct: 2799 VIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAV 2858

Query: 2847 RRSHNGQSKSFFEDEHXXXXXXXXXXXXEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGV 2906
            RRS    +     +E              + Y+PLEEP I++PQ +DLG+ATPP+EWFG+
Sbjct: 2859 RRSQIDVTFGPVSEEDVGKRIKKEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGL 2918

Query: 2907 NRKQFPGLTHQGVIVPLQKLAHLAESEWARILGRA 2941
            NRK+FP  THQ  ++ +QKL H AE E+  ILG +
Sbjct: 2919 NRKRFPAFTHQTAVILVQKLVHTAEKEYGSILGHS 2953

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score = 1833 bits (4747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1070/3020 (35%), Positives = 1662/3020 (55%), Gaps = 153/3020 (5%)

Query: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62
            S+F+ VP++  ++FSW+FL  W+L + +SL   FY GR + Y IT ILE+L WK   VKV
Sbjct: 5    SQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHAKVKV 64

Query: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRK----------TSLE 101
                       GR+FFKN+T+I +D T SIL G+ITWRYWL ++RK          T  +
Sbjct: 65   NIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDETQTK 124

Query: 102  SQSEKAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPSPRATEE 161
              S K  +LPCRF +  +GLE F+YN+T A+DNI+    +E++   +KF ++     +  
Sbjct: 125  PTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQILSDSAT 184

Query: 162  TSTENDSAAQKSHLXXXXXXXXXXXXXLNDRTYQLPNS-MPSFLRLLPLEYSVQKGALII 220
              + +DS    S                NDR +Q   +   SFLR LP+++ V +G+LI+
Sbjct: 185  VKSMDDSQFDTSE---STSTDKSESSATNDRVFQEEETDTSSFLRFLPIQFLVTRGSLIL 241

Query: 221  GNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLK 280
            GNK T S+++ S +     +D   P  K+DLYK KL +++   + +L+ N+ +D D  +K
Sbjct: 242  GNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFDEDVSMK 301

Query: 281  -NLPKA------NRLPKLLHKYYE--TFLRVRKRYLSRGSKTESTRKDLRNPLERWRGLG 331
              L +       N   ++L   Y+   F  + +R      K ++          +WRGL 
Sbjct: 302  FKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQA----------KWRGLA 351

Query: 332  LY----WKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLE 387
            LY      E     DD+  F+   HEYA++S ++K   +     HD PG+VPHGA PT+ 
Sbjct: 352  LYKGTGLGERRNDIDDI-EFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTIS 410

Query: 388  PLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSA 447
             LDGPDVGN GAPPD+SLDIQ+FG ++ +GPWA  +   + K+ SPVVSR + P +RL+ 
Sbjct: 411  VLDGPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTP 470

Query: 448  GSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSE 507
            G  R++T  ++ + IM D+ WRIPTRE SKD +FL+ Y+ET  + RPFGW++L  ++ + 
Sbjct: 471  GCRRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETT 530

Query: 508  VRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKW 567
            V    A+CPT  GF N + +H  + E R+SVNHDILL  +  D +    +PLGWN +A W
Sbjct: 531  VNTTFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATW 590

Query: 568  NFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVN 627
              +L S Q   FIL++HITL+ D L+DF +G+PTPY+LFRPFIY  NW++ GYS+YLNVN
Sbjct: 591  TINLNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVN 650

Query: 628  DANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSW 687
            D NIVNNP+DFNENCYLSFHGD+L + F +P+ SI    T I Y + TP+FRL +NTP W
Sbjct: 651  DHNIVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRLLLNTPPW 710

Query: 688  NTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLV 747
            NTL+EFMK KEVGR+ DF + GSYL +S LD++N+DTI+++C S+ TTL+CYG+VVR+L+
Sbjct: 711  NTLNEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLI 770

Query: 748  GVKMNYFGDFVHFKTTEEYMEELR--DAYVEPKANSEQSANSTETTTAGEGEDKQNAPKN 805
             VKMNYFGDF HF T+EEY   +R  +  ++  + S+   +S  +    +G D     + 
Sbjct: 771  NVKMNYFGDFFHFVTSEEYTGAIRANEDDMQYASESDDDRSSISSFDTMQGNDAPGRRRL 830

Query: 806  HTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYI 865
            HT      ++  LKR  NE D+WFTF V +G L+LP+ +Y+C+ C    F  L IDLR  
Sbjct: 831  HTE----LQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSC 886

Query: 866  NYYMDLQAALSPVIVRNLSDCDPAHLFSG-SEGRCPSRANFGSISDLHIHAHRMFGLPPD 924
            NYYMDL A ++ V ++      P  +F    +         GS+S L IH HRM+GLPP 
Sbjct: 887  NYYMDLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPM 946

Query: 925  EETYFCKWDFSMGVXXXXXXXXXXXXFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIF 984
            E TYFC+WDF +G             F  +++++ F + D ENI+ Y+     DMTS+  
Sbjct: 947  EPTYFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTV 1006

Query: 985  HAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQVKEGGKDGS 1044
            +  ++ V + +  ++ Y   ++ N+    +DFENE+YS+R D+ I ++   +    +DG+
Sbjct: 1007 NLEKLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGT 1066

Query: 1045 LIGDFS--SSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKL 1102
                F+  + +KIT F Q ++F  H   Q+ +I  +DAP+HRCSF+LP   Q ++ Y++L
Sbjct: 1067 TKKLFTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQEL 1126

Query: 1103 LGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNEHFCSKKEEDGYA------ 1156
             G+I P  S+P +  P+ P     I+++ L GE   L   +  F     +  YA      
Sbjct: 1127 FGAIAPSSSLPPLPVPLIPSTTDFIIEDLL-GEFQDLLETSSPFRMPFSDQDYATDVSDD 1185

Query: 1157 ----------FNFASGLMSSTENDSNVESESLVVKLIKPQASISACCIKPFRSFSDQAYS 1206
                      FN  S    + +ND   E +S ++ +      I    +    +F     +
Sbjct: 1186 ETEEDIDPLEFNTPS---EAIQND-KCERDSFIIDVSFISIEICPDILDSIGTFLMLFST 1241

Query: 1207 NFVEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIV 1266
              + Q+ID  EI  V           +  NVK+     ++          S+T   V I 
Sbjct: 1242 ENIVQIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWG-------SRTDTGVGIY 1294

Query: 1267 IKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCST 1326
            +  I  D +M E+    + EK  ++ +T L K+ S+   V+ T+ N   +N       S 
Sbjct: 1295 LDRI--DFAMCEKTVEENKEKKLIE-LTVLNKIRSVRGTVNQTAANS--KNEERPPALSL 1349

Query: 1327 SIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKER 1386
             I+  E W ++ + + +S N  S D  V   + E    +  N    I  + +     ++R
Sbjct: 1350 VIEGWEIWSSTVEDQVNSLNILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKR 1409

Query: 1387 LQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNY 1446
              +++++    ++ AS+ YQI HDP VITKPA+ITRL   HVREN+SWKIITRLRHIL Y
Sbjct: 1410 KIESRKELISSLTAASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTY 1469

Query: 1447 LPPSLLAEIYGALKSASFEAPT-NAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEG 1505
            LP    + I  +L  +   A T +A  IF+++FS WR+WE SD+ + Y+YRK F +Q+  
Sbjct: 1470 LPEDWHSTINRSLTQSKTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSN 1529

Query: 1506 Q---AGPLNLRVEVDSCSATVSDSTHK-EGDMIAVXXXXXXXXXXXXSEMVGSILAIDDG 1561
            Q       ++ +++ S   TV  + ++ E + I              S+   S   I + 
Sbjct: 1530 QEIHTTKKSITIKIASFFVTVYSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFNI 1589

Query: 1562 TATDGNSLSCSLKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLMELA 1621
            T T G +        K  +S+   K++  + L  S    D   + +     K  KL  L 
Sbjct: 1590 TGTLGTA--------KGKLSD---KIIMIKNLLPSLKITDGGKSKETFDFVKSFKLNTL- 1637

Query: 1622 LLIDRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAI 1681
            +L +R E++I + +     + FG  +S      +       S+A+     E  ++H NA 
Sbjct: 1638 ILCERGELQIDIGNTRLVSRVFGARLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINAT 1697

Query: 1682 IVDAFARRGSLGSFISQSESTTLH-RVHLGSQ--KLRLKVPSSTKDYCNFINSLSESWSS 1738
            + +   R  SL   I  +ES +    + + SQ   L L   ++T      I  + E+   
Sbjct: 1698 LAEIQIRDFSL---IVTTESWSYKPTILVNSQCSDLHLMAMTATDILVASIKEIMENIHR 1754

Query: 1739 LAPKLKFNTRSKDLSPEMKNFSKVAFEAHVDDFTSEIS----ALSPLSISKRFKGLTVQF 1794
            +   L   TR++ ++    +  K      +  F + IS     +SP  I    K L + F
Sbjct: 1755 IEQDLLAGTRAEKITKVESHGPKPKVNTILTCFFTNISFELMPISPFFIRHEAKQLDIYF 1814

Query: 1795 EKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALT 1854
             +  ++ + L V + D+ L S +T QQY + S   ++L   + +    +   + L +++ 
Sbjct: 1815 NRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFGDLQLKGNMVNDPYHI--NLYLSASIL 1872

Query: 1855 KFKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLW 1914
            K  + D +++I +  QD     +++E   I L   G      S  E+         ++ W
Sbjct: 1873 KLTVSDVQKLIPSFLQDEKILTESIEDF-ITLDLFGLSKNQKSKPEKD------NNKFSW 1925

Query: 1915 QLD--MKYVGLLVPLGTTXXXXXXXXXXXXXXCDEAAEFSFPLVHGELSVAGISFLINDK 1972
             +D  + Y GLL P+G+                  +   +   + G+ SV  + F I ++
Sbjct: 1926 SIDTNINYFGLLAPIGSAYFLFELRMLLASLTKMGSDIPNQSDISGQFSVENVLFFIKER 1985

Query: 1973 ELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSG 2032
             LP  LSK+L+F+ ++   +  +N+  + QIES+HFR+ L P SL+R+L    + +  + 
Sbjct: 1986 ALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLSPESLVRLLWATNQVS--TS 2043

Query: 2033 LQALKDNAGVKSSDDAKDFFNISQT------FHSIQILSYDFCLGWIFNNDGASNSGLTW 2086
            +Q  KD+      D      NI +         S  ILSY+FC+GW+F+ D  S  GL  
Sbjct: 2044 IQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNVPSFHILSYNFCVGWLFSVDSKSEPGLIL 2103

Query: 2087 GYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFET 2146
            GY RLF+A+EK  GKLTL+D +F IA G++S++F+ +  E D+ NRS LP+MQI YWF+ 
Sbjct: 2104 GYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKDKYNRSYLPNMQISYWFKD 2163

Query: 2147 NGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPA 2206
             G+  +LFVR +GE LDV+FLS  + +      S+  FQELK+  +     ++ V     
Sbjct: 2164 AGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKKDLIPGLPKKQKVNDDKT 2223

Query: 2207 GSAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKML 2266
                +  P L++I  ++C+ +Y GGVFK++SL+D + ++ PSF++ SP+V +   Y  + 
Sbjct: 2224 LELNTLSPFLANIRSISCQFKYDGGVFKIFSLEDAETQSEPSFEVNSPNVVIDLNYKHLE 2283

Query: 2267 TGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPRTSNMQEGI 2326
               ++H +R+L+ ++S+HN L+  C P++S+    I+ ++K  + SS E+  +    + +
Sbjct: 2284 NRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMVKK-HSSSEESTLSKPSSQNL 2342

Query: 2327 NYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSL 2386
            +Y+ LL   DI+  +   KQQ+SLSCEPKAKVQAD+GF+ F   + TND D  EPLS SL
Sbjct: 2343 DYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSFIFTVTTNDLDAAEPLSFSL 2402

Query: 2387 DIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQD 2446
             +    A+ +HIFSRE STS+ ++ +    M THPD I+ +G A I  I+++FN+KQLQ+
Sbjct: 2403 SVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVHGTALISNINLFFNVKQLQN 2462

Query: 2447 LNVFINIWKLDSKILSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIR 2506
            L +F++IW+L   + S+P  D       ++L     S  + +I     PW F +I + ++
Sbjct: 2463 LYLFLDIWRLSDLLKSKPANDIVKAKTDSSLSIAQLSDPESII-----PWCFTLIFTNVK 2517

Query: 2507 GEIDLGISLGVLSLTTEKIWAVTDHYSDWXXXXXXXXXXXXXXXXGRLGGTFLLQNFRWM 2566
            G++DLG SLGV+S+  ++ W  TDHY +                 GRL G F L+   W+
Sbjct: 2518 GDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSLSSKGRLSGIFELKGASWI 2577

Query: 2567 SQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIR 2626
            S++ WP +      PLV + + +DE + K  FDYH+ LI ++    + L +++D  GV+ 
Sbjct: 2578 SEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAINNTRVHLHSEKDVNGVMP 2637

Query: 2627 NLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGXXXX 2686
            +LL V+   +S  +  TAL  ANI D+YNT +RMR+DN+ SY+ETL +SN  ++K     
Sbjct: 2638 DLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISYIETLRESNEAESKPPINY 2697

Query: 2687 XXXXXXXXXXRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLK 2746
                      +T++SV +  ++IQ+ P TLFD+EV+       S  S+T   KKL T+L+
Sbjct: 2698 TDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIESISARSETHSGKKLMTELE 2757

Query: 2747 LKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVAT 2806
            ++V++  ++LST K ++ E   S+I VK Y+++ASK+ GGTI+  P +L+ MTT+ +  +
Sbjct: 2758 MQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTIIEIPKLLVSMTTFQEEKS 2817

Query: 2807 NKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSH-----NGQSKSFFEDE 2861
            + +E LY+  F  K+ VRWNLG INF++EMW TH RA+A+RRS      +GQS     +E
Sbjct: 2818 DILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRRSQVVGVLDGQS-----EE 2872

Query: 2862 HXXXXXXXXXXXXEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIV 2921
                          + Y+ LE P I++PQ +DLG+ATPP+EWFGVNRK+FP  THQ  + 
Sbjct: 2873 DVEKRIKEEENFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVNRKRFPAFTHQTAVF 2932

Query: 2922 PLQKLAHLAESEWARILGRA 2941
             +QKL + AE E+A ILG +
Sbjct: 2933 LVQKLVYSAEREYANILGSS 2952

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 1806 bits (4678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1046/3048 (34%), Positives = 1633/3048 (53%), Gaps = 182/3048 (5%)

Query: 2    SSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVK 61
            S+ FR   +   ++FSWVFL DW+L + ++L + FY  R   Y +T ILE+L WK+  VK
Sbjct: 7    SAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVK 66

Query: 62   V-----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTS----------- 99
            V           GRVFFKNLT+I +D+T +IL GSITWRYWL+ +RK+            
Sbjct: 67   VSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASA 126

Query: 100  -------------LESQSEKAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQEN 146
                         + +  EK  KLPCRF  EC+G E FIYNRT A+DNI++ L + ++E 
Sbjct: 127  GSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVEREK 186

Query: 147  VKKFFSD----------PSPRATEETSTENDSAAQKSHLXXXXXXXXXXXXXLNDRTYQ- 195
             +KF ++           S    EETS+  +S  +++                NDRT+Q 
Sbjct: 187  FEKFMAENDFLDPSSDGSSDDKIEETSSATNSTDEET--------------IANDRTFQN 232

Query: 196  -LPNSMPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKI 254
                ++P +L  LP+E  + KG+++IGNK T  V++ SFE      D     +K+DLY++
Sbjct: 233  DTRKTLPRYLEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRM 292

Query: 255  KLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRYLSRGSKTE 314
            K +  +   ++ ++ N+ YDN++         +L +L H++   F  V   + S   K +
Sbjct: 293  KYEVRLKNLEIMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSNRRKEQ 352

Query: 315  STRKDLRNPLERWRGLGLYWKENDPAWD--DVFHFELPKHEYARYSKVMKCEHMLIEYSH 372
                   N +++W+GL +Y  +    +D  D   F++  HEYA+++ ++K   + I + +
Sbjct: 353  PHD----NFMQKWKGLSMYRNDMFGEFDEFDDIEFDISSHEYAKFTSLLKSPRVTIHHDY 408

Query: 373  DTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFS 432
            D PG VPHGA P     DGPDVGN  APP +  +I +FG  + YGPWA  +   +Q + S
Sbjct: 409  DMPGWVPHGAHPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLS 468

Query: 433  PVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDT 492
            P VSR + P ++L  GS R++T L+++I  M D  WRIPTRE SKD++FL  YKET DD 
Sbjct: 469  PSVSRTAKPIKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDY 528

Query: 493  RPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIE 552
            RPFGW+++ ++  S    ++AMCPTS GF N +D+  +  EIR+SVNHDI L +++    
Sbjct: 529  RPFGWIDIKVSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFN 588

Query: 553  AQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYE 612
              IGYPLGWNA+A W   + S+Q  +F+L++H+TL+ D L+DF +G+P PY+LFRPF+Y 
Sbjct: 589  CDIGYPLGWNAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYH 648

Query: 613  FNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYN 672
              W + GYS YLNVND NIVNNP+DFNENCYLS HGDDL ++  VP+ +I    T + Y+
Sbjct: 649  IKWNMKGYSFYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYD 708

Query: 673  LYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSR 732
            +YTP+FRL +NTP WNTL+EFM++KEVGR+ DF L GSYL +S+LD++N+DT+ +EC SR
Sbjct: 709  IYTPMFRLLLNTPPWNTLNEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSR 768

Query: 733  MTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANSEQSANSTETTT 792
             T L  YG+V+R+L+ VKMNYFG+F HF T+EEY    R   +E   + ++  +   +  
Sbjct: 769  GTALHIYGFVIRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYE 828

Query: 793  AGEGEDKQNAPKNHTTDPVMAKKLS-LKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACF 851
            +       ++ KN       + K S LKR  NE D+WFTF V DG LILP+ +Y+ + C 
Sbjct: 829  SVSRISSNSSDKNPKAKKKHSLKKSDLKRTSNETDIWFTFSVWDGALILPETIYNADPCI 888

Query: 852  AFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSD------CDPAHLFSGSEGRCPSRANF 905
            A  F  L +DLR  NYYMD+ A    + ++           +  HL +G +         
Sbjct: 889  ALHFAELIVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEV-----H 943

Query: 906  GSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVXXXXXXXXXXXXFGDAWSKLAFSFKDY 965
            G++SD++IH HRM+GLPP E TYFC+WD   G                A+ K+ F +KD 
Sbjct: 944  GTLSDIYIHGHRMYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDL 1003

Query: 966  ENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRA 1025
            ENI+ Y+   I DMTS+      I +++NDV    +  +++E      +DFENERYS R 
Sbjct: 1004 ENILLYETEIIDDMTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRM 1063

Query: 1026 DVDIHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRC 1085
            D+ I S+   +     +   + +F   +  T F Q ++F  H   Q+ +I  NDAP+HRC
Sbjct: 1064 DIKIPSLEFNIFSNEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRC 1123

Query: 1086 SFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNEH 1145
            +FLLP + Q+S  Y +L G+I P  S+P +  P+T + +  +L++ L+ +   L  GN  
Sbjct: 1124 AFLLPESYQKSRIYNELFGAIAPSSSLPPLPIPLTADTIEYVLEDLLE-DYMGLFEGNYD 1182

Query: 1146 FCSKKEED-----GYAFNFASGLMSS-------TENDSNVESESLVVKLIKPQASISACC 1193
                  E+       A    +G+ +        T +D  VES++ VVK+      I+   
Sbjct: 1183 IKESSVENLELSAIEATRAITGIGAERTHSNPITLSDYAVESDNYVVKVESIVIDINPAL 1242

Query: 1194 IKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGS 1253
                       Y     Q+ID  EI +V              NVKV    F +      S
Sbjct: 1243 YTTIEKLLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKES 1302

Query: 1254 DNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNG 1313
            DN+S   D +D  + E +++          +SEK+ ++ +T L K++++ L V    + G
Sbjct: 1303 DNVSMFFDKMDFALTEKTLE---------QNSEKNLLE-MTVLAKIKAVRLTV--VQQPG 1350

Query: 1314 PLENIHEDQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFL-KNTAAN 1372
             +         +  ++  EFW T+ + + +S + +S D  V   + E    ++ +     
Sbjct: 1351 LIPTQERPPAITVGVEGFEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFF 1410

Query: 1373 IDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENK 1432
            +D +     +   R++ +Q++   R++ AS+ YQI HDP VITKPA+I RL   HVRENK
Sbjct: 1411 LDMLQSYNRIQNNRIE-SQKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENK 1469

Query: 1433 SWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQC 1492
            SWKIITRLRHIL YLP      +   L+   F+   +A  IF++IFS WRSWE SDV + 
Sbjct: 1470 SWKIITRLRHILTYLPKDWYLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARS 1529

Query: 1493 YMYRKAF---YSQYEGQAGPLNLRVEVDSCSATVSDSTHKEGDMIAVXXXXXXXXXXXXS 1549
            Y+Y K F   +++ + Q+     ++ + +   TV  + +     I V            S
Sbjct: 1530 YIYGKLFLNDHAEKKKQSLQKLFKLNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSS 1589

Query: 1550 EMVGSILAIDDGTATDGNSL--------SCSLKAVKASISETAIKLLAFRELF-ESQNSQ 1600
                        T    NSL        S ++  +K  +S   +KL     +  E    Q
Sbjct: 1590 ------------TEPKENSLQREELIDISGTVDVIKGKLSTKLLKLQKLIPILTEGSEKQ 1637

Query: 1601 DILSNTQVLPSGKILKLMELALLIDRCEIKISLDSKTANLKSFGNSISFALVDTESARDT 1660
             +      +P  K  K M  A +++ C+I++ +D+   N+      IS    + + +   
Sbjct: 1638 PVKPPQDTIP--KPFK-MNAAFMVNSCDIQLVMDATKLNMNVNDGRISVLWENLQDSTAQ 1694

Query: 1661 GSSMALAWSWFEFDVRHNNAIIVDAFARRGSLGSFISQSESTT-----LHRVHLGSQKLR 1715
              S+ L     E  ++H N+++ +     G + +F +   + T      + +H  S  + 
Sbjct: 1695 AGSVVLFSKHTELVLKHINSVLAE-----GRVSNFYATFTTDTWAQRPTYLIHSKSSSIH 1749

Query: 1716 LKVPSSTKDYCNFINSLSESWSSLAPKLKFNTR-SKDLSPEMKNFSKVAFEAHVDDFTSE 1774
             +  + T+     I  +      ++ +L+   R ++  +    N S V       + + +
Sbjct: 1750 FRTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQHPTVYDPNKSNVIASCLFSNVSMD 1809

Query: 1775 ISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTA 1834
            I  +SP ++    K +   + K  + S  +K+++ D  L S+ T +QY+++S  ++++  
Sbjct: 1810 IMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFLTSDQTKEQYMRLSMKKLQIRV 1869

Query: 1835 KIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLL-ALGALF 1893
             +     K+   + L + L K    +P+ I+ +  +D   A ++     +HLL  L  LF
Sbjct: 1870 NVSSSKPKLVD-INLSTNLVKLTFSEPKNIVYSFLKDERVASES-----VHLLQTLKPLF 1923

Query: 1894 GTDSTDEEVFAGALWPREWLWQLD--MKYVGLLVPLGTTXXXXXXXXXXXXXXCDEAAEF 1951
                  E          E+LW LD  + Y G+L+P+ +T                  A  
Sbjct: 1924 SISDDKESTPQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYVMEFHSYVSSISNANGAPS 1983

Query: 1952 SFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIA 2011
                + G +SV  I FLI +  LP+ LSKV++ A  +   +  +++ +S+Q+ES+H RI 
Sbjct: 1984 GNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVDDNSRSIQVESSHARIC 2043

Query: 2012 LCPFSLIRILSLAYEATHLSGLQALKDNAG------VKSSDDAKDFFNIS-------QTF 2058
            L P SL+R+L   +   H      LK ++        KS D  +D  +I         + 
Sbjct: 2044 LSPDSLLRLL-WGFNQGHKLSEHYLKYHSKSLWQSFAKSDDKQQDTNSIKSNETSFFSSI 2102

Query: 2059 HSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSN 2118
            +SI  LSY+ C+GW+F  +     GL  GY RLF+A+E   GKLT++D+YF  A+G+TS+
Sbjct: 2103 NSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGKLTVIDSYFAAAQGNTSS 2162

Query: 2119 DFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFA 2178
             FY + +  +  NR  LP+MQI +W++      +++VR  GE LDV +LS  +       
Sbjct: 2163 TFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGETLDVKYLSDFMLTIESTL 2222

Query: 2179 RSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLYSL 2238
             S+ +FQ+LK++ +      E V         S   IL +I  VNC  +Y GG + ++++
Sbjct: 2223 HSIKMFQKLKKELIVETPKREVVHIKEDKPVNSSNNILKNIKSVNCHFKYDGGTYSVFNI 2282

Query: 2239 DDIKRKTGPSFQLESP--SVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIIS 2296
             D      P+ +++SP  SVDV++++ K  T  + H +R L+++D +HN L+ TC P++ 
Sbjct: 2283 SDGSLNPTPAIEIKSPVISVDVLYKHEKQNT--KHHSIRCLVNIDPTHNVLYATCAPLVK 2340

Query: 2297 EMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKA 2356
                D+R +       +  +  T    + I+Y  LL+D D++  +   KQQ+SLSCEPKA
Sbjct: 2341 NFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLLEDYDLAITVTSAKQQLSLSCEPKA 2400

Query: 2357 KVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVF 2416
            KVQADVGFE   + + TN FD+ EPL+ S  I +  A+ +H+FSRE STS  +  L    
Sbjct: 2401 KVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSRETSTSFGVGYLDLTL 2460

Query: 2417 MLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVI---G 2473
            + TH + I+TYG + I  ID+YFN+KQLQ+L +F++IW+L S++L+      + VI    
Sbjct: 2461 LFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQL-SELLNPVTSSQEQVIRKDK 2519

Query: 2474 PTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYS 2533
              +++KP+ ++       S  PW F +I + ++G+IDLG SLG++SL   + W  TDH+S
Sbjct: 2520 KKSVDKPIHNE-------SQLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTWLATDHFS 2572

Query: 2534 DWXXXXXXXXXXXXXXXXGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETA 2593
                              GRL G   +    W+S++ W  +      PLV L++  D+  
Sbjct: 2573 GKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALSLNTDKIE 2632

Query: 2594 VKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDV 2653
            +K  FDYH+ LI +V  +   L ++RD  GV  +LL VS S +  ++  TAL  ANI D+
Sbjct: 2633 IKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALVAANILDI 2692

Query: 2654 YNTILRMRKDNRKSYLETLGDSNTRDTKGXXXXXXXXXXXXXXRTELSVMLKFVHIQVYP 2713
            YNTI+RMR+D + SY+ETL DSN    K               RT+L+V +  + +Q+ P
Sbjct: 2693 YNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRTDLTVSICSLQLQISP 2752

Query: 2714 STLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGV 2773
             +LFD+EV+       S  S+T    KL T L ++V++  L+LST K +L E   S+I V
Sbjct: 2753 ISLFDVEVVVINVVSVSARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDEDALSKITV 2812

Query: 2774 KEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFL 2833
             +Y+ +ASK+ GGTI+  P + + MTTW +  ++ +E LYS  F  K+ VRWNLG +NF+
Sbjct: 2813 ADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWNLGPVNFM 2872

Query: 2834 REMWATHARAMALRRSHNGQSKSFFEDEHXXXXXXXXXXXXEYTYIPLEEPHIEIPQTKD 2893
            +EMW TH +A+A+RRS          ++             +  Y+P+EEP I++PQ KD
Sbjct: 2873 KEMWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENITKLNYVPVEEPQIDMPQIKD 2932

Query: 2894 LGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARILGRA 2941
            LG+ATPPVEWFGVNRK+FP  THQ  +VP+Q L +LA+ ++A+ LGR+
Sbjct: 2933 LGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGRS 2980

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score = 1793 bits (4645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1070/3069 (34%), Positives = 1634/3069 (53%), Gaps = 207/3069 (6%)

Query: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62
            S+F  + +   +DFSWVFL DW+L L +S+   FY GR + + I+ I E+L WKRY +KV
Sbjct: 6    SQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYRLKV 65

Query: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSR----KTSLESQSEKA 107
                       GR+FFKNLT+I +D T S L G I+WRYWL   R     T L ++ +  
Sbjct: 66   NIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAEDDDG 125

Query: 108  A------KLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKF-----FSDPSP 156
            A      KL CR  +EC+G+E F+YNRT A+DN +    +E++   ++F     F+D + 
Sbjct: 126  ASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTDRAS 185

Query: 157  RATEETSTENDSAAQ-----KSHLXXXXXXXXXXXXXLNDRTYQLPNSMPS-FLRLLPLE 210
              +   S+  +S AQ     KS+               NDR +    +  + FL  LPL+
Sbjct: 186  TESSNGSSSEESKAQDEVEIKSYTESSFDESNESQMA-NDRIFHDEETGKNLFLNYLPLQ 244

Query: 211  YSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPN 270
              V   + ++GNK T S+++ S +  +G +D C P  K+D+YK KL  D     +SL+ N
Sbjct: 245  IKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVSLKQN 304

Query: 271  LCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRY-LSRGSKTESTRKDLRNPLERWRG 329
            + Y+ +  LK      +L KL   + +    VRK   LSR  K   +     N  ++WRG
Sbjct: 305  IGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVT--ANFHQKWRG 362

Query: 330  LGLY----WKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPT 385
            L LY    +++     DD+  F+L  HEYA+++ ++KC   ++ Y  D PG VPHGA PT
Sbjct: 363  LSLYKNYMFEDVQNDLDDI-EFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHPT 421

Query: 386  LEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERL 445
            L  +DGPD+GN GAPP F L+IQ+FG ++ YGPWA  ++  IQ + +P +SRD  P + L
Sbjct: 422  LSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKPL 481

Query: 446  SAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEG 505
              G  R++T  ++ I++  D  WRIPTRE SKD +FL+ YK T +D RPFGWL+L  ++ 
Sbjct: 482  QPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSKD 541

Query: 506  SEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKA 565
            S    N A+C T+ G  N + +H    EIR+SVNHDI + +++ D +  +G+PLGWN KA
Sbjct: 542  SYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEKA 601

Query: 566  KWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLN 625
            KW  ++ S Q   F+L++HITL+ D +SDF TG+PTPY+LFRPF+Y  NW+L GYS+YLN
Sbjct: 602  KWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYLN 661

Query: 626  VNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTP 685
            VND NIVNNP+DFNENCYLSFHGD L +   VP+D I   +T I YN+YTP+FRL +N P
Sbjct: 662  VNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNAP 721

Query: 686  SWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRF 745
             WNTL+EFMK KEVGRA DF   G+YL +++LDV+N+D I I C S+ T L CYG+V+R+
Sbjct: 722  PWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIRY 781

Query: 746  LVGVKMNYFGDFVHFKTTEEYMEELRD-AYVE----PKANSEQSANSTETTTAGEGEDKQ 800
            L+ +KMNYFGDF HF T+EEY E++    Y E     K + + S   ++     E +DK 
Sbjct: 782  LMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFDKNNEEDDKV 841

Query: 801  NAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDI 860
              P+             ++R  NE D+W TF + +G L+LP+ +Y+C+ C A  F  L I
Sbjct: 842  KVPRGPA---------DVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAI 892

Query: 861  DLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEGRCPSRANFGS--ISDLHIHAHRM 918
            D+R  NYYMDL A+L  +I+R  S+  P  +F     +C  R   G   IS+++IH HRM
Sbjct: 893  DVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVR-QCNGRDVKGHSYISNINIHGHRM 951

Query: 919  FGLPPDEETYFCKWDFSMGVXXXXXXXXXXXXFGDAWSKLAFSFKDYENIMNYKIVPILD 978
            +GLPP E TYFCKWDF +G                ++ K+ F F D EN++ Y+   + D
Sbjct: 952  YGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDD 1011

Query: 979  MTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQV-- 1036
            MT++  +  + ++ I++  +     + + N+    +DFENE+YS+R D+ I  + + +  
Sbjct: 1012 MTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYG 1071

Query: 1037 --KEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQ 1094
               E  K+ S   +F + +  T FC  KN + H   Q+ +I  NDAPFHRC F+LP + Q
Sbjct: 1072 YNYEASKELSFF-NFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQ 1130

Query: 1095 RSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQ---MGNEHFCSKKE 1151
             S  Y+KL GSIVP  S+P +  P+  E    I+ +FL  E N+     + N  +     
Sbjct: 1131 NSVIYQKLYGSIVPSSSLPPLPLPLLEETFEFIIQDFLH-EYNTTSDCIILNLPYPDSTN 1189

Query: 1152 EDGYAFNFASGLMSSTENDSNV--------ESESLVVKLIKPQASISACCIKPFRSFSDQ 1203
             +  +FN        T +D+ +        E ++ V+       SI            + 
Sbjct: 1190 LNSDSFNSYPDTAPHTLSDTIIRKSPLPEDERDNYVIDFRYISISIDPELFFYIEKLLNH 1249

Query: 1204 AYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTV 1263
             Y +   Q+IDS EI +V              N K+    F++      +  I    DT+
Sbjct: 1250 FYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGIELYLDTL 1309

Query: 1264 DIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQL 1323
            D  + E S++          + EKS + ++T L+K+ S+   V+     G  E   +   
Sbjct: 1310 DFEMNEKSIE---------KNREKS-LTEVTTLMKLNSIRASVNAKYSRGKTEG--QPPA 1357

Query: 1324 CSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVH 1383
             S  ++ ++FW T+     +S   TSID  +  D+T++  +F  N   +   +   V   
Sbjct: 1358 LSLMVEGVKFWSTTAKKVINSIILTSIDATI--DETQVVWLF--NFFGDQKELIGSVVKT 1413

Query: 1384 KERLQK----AQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITR 1439
             E++QK    ++++   R++ AS+ YQI HDP VITKPA+ITRL   HVREN+SWKIITR
Sbjct: 1414 FEKVQKLRTQSRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITR 1473

Query: 1440 LRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAF 1499
            LRHI+ YLP      +   LK   + A  +A  IF+++FS WR+WE SDV + Y+Y K F
Sbjct: 1474 LRHIMTYLPDDWNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVF 1533

Query: 1500 YS-QYEGQAGPLNLRVEVDSCSATVSDSTHKEGDMIAVXXXXXXXXXXXXSEMVGSILAI 1558
             + Q E Q   +N   +    S  ++  T   G   +              +   S    
Sbjct: 1534 LANQAEKQQKTVNKGWKAAFVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQ 1593

Query: 1559 DDGTATDGNSLSCSLKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLM 1618
            +      GN     L ++K  IS+   KL     L + Q    + S +    S K    +
Sbjct: 1594 EKVINVTGN-----LGSIKGKISDKMFKLHNLMNLVQQQEDPALKSISSFSRSFK----L 1644

Query: 1619 ELALLIDRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHN 1678
             +ALL D  ++       +          SF   + +      +S+ L     E  ++H 
Sbjct: 1645 NIALLFDSSDLLFVFGETSLTNTIHSGKASFLWENPKGPTKETASLVLYAKRCETSMKHR 1704

Query: 1679 NAII----VDAFARRGSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFI----- 1729
            N+++    +   A   +  S IS          +     + L+V   T+    F+     
Sbjct: 1705 NSMLFENQITGIALSAAADSIISHPSIVA----NFQCDDINLRVMPQTEVIVTFLQEFIA 1760

Query: 1730 --NSLSESWSS-LAPKLKFNTRSKDLSPEMKN---FSKVAFEAHVDDFTSEISALSPLSI 1783
              N + ES+ +   PK      S   +P   N      + F     + + +I  + P   
Sbjct: 1761 KFNLVKESFETDDLPKPTPTNDSPKPTPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQF 1820

Query: 1784 SKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKV 1843
             +  K +  +F  +   + +  + + DL L S +T QQY ++S   + +    + ++   
Sbjct: 1821 RQETKKMEFKFSSQRTQNFQFNIWDSDLYLGSHLTKQQYFRLSLGNI-IVGYTNGRLVNT 1879

Query: 1844 ASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVF 1903
               + + +++ K    +P  ++ +  QD     +++++L++    LG LF ++     + 
Sbjct: 1880 IHNLDVSASIVKLTFSEPHRMLFSFLQDEREVSRSVKKLQV----LGNLFSSEPEINTIP 1935

Query: 1904 AGALWPREWLWQLDMKYVGLLVPLGTTXXXXXXXXXXXXXXCDEAAEFSFPL--VHGELS 1961
            AGA    +W    D+KY+G+L+P+ TT                +  E         G++S
Sbjct: 1936 AGA--KIDWRLNADIKYLGILIPVSTTFFVFEMHTLLASLADVDYGEIYREADEASGQVS 1993

Query: 1962 VAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRIL 2021
            V  I FLI D+ +P  LS++++ +F+I   +    S  S QIES H R    P+SL+RIL
Sbjct: 1994 VDNILFLIKDRTIPSTLSRIIDLSFKISAIQKIMESHHSYQIESPHLRFCFSPYSLVRIL 2053

Query: 2022 SLAYEATHLSGLQALKDNAGVKSSDDAKDF---------------FNISQTFHSIQILSY 2066
               ++      L AL  +     S +  DF               F  + TF S  ILSY
Sbjct: 2054 WGGHQ------LLALHSHYRRHHSKNLWDFLPKKEKKVEEDKTTSFFSTLTFGSCHILSY 2107

Query: 2067 DFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDE 2126
            +FC+GW+F N+G +++GL  GY RLF+A+EK  GKLTL+DA+F ++ G TS+ FY   +E
Sbjct: 2108 NFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLVDAFFSVSNGRTSDTFYSDGNE 2167

Query: 2127 VDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQE 2186
             D+ NRS LP++QI YW +      ++F+R++GE LDV+FLS  + I     +S+ +FQE
Sbjct: 2168 EDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVNFLSSFVKIIEATLQSIQVFQE 2227

Query: 2187 LKRQYLDPF----------------------------KPEEPVKRVPAGSAFSKLPILSS 2218
            LK+  ++P                             K + P K +         P LS 
Sbjct: 2228 LKKVLVNPLTQSEARSEEEEEESEEHNRRETVPGKEKKEDAPRKDIA--------PFLSD 2279

Query: 2219 ISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALM 2278
            I  VNC+ +Y GG+FK+YS +DI+    PSF++ SP V +  +Y   +   + HL+R L+
Sbjct: 2280 IRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDYKNNIGDVKPHLIRTLI 2339

Query: 2279 SVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETP--RTSNMQEGINYRSLLQDVD 2336
            +V+S+HN LF  C P++  ++ DI+ ++K  +      P  R S   + I+Y+ LL   D
Sbjct: 2340 TVNSTHNVLFARCAPLLMALSQDIQHMVKKHSSKKKPEPKQRVSRPSQNIDYKRLLNSFD 2399

Query: 2337 ISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSR 2396
            I F +   +Q++SLSCEPKAKVQA+VGF+ F   + TND D  EPLS +L + N  +  R
Sbjct: 2400 ILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTSEPLSFALVVKNTRSAIR 2459

Query: 2397 HIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKL 2456
            HIFSRE S S  ++ +   FM THP+ I+ +G   I  ++VYFN+KQLQ+L +F++IWKL
Sbjct: 2460 HIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYFNVKQLQNLYLFLDIWKL 2519

Query: 2457 DS----KILSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLG 2512
             +    K + +PE  +  +  P +   P+          +  PW F +I + I G++DLG
Sbjct: 2520 SNLLRPKPMKKPEDHHVAIDAPPS--SPMD-------VGNIIPWCFTLIFANINGKVDLG 2570

Query: 2513 ISLGVLSLTTEKIWAVTDHYSDWXXXXXXXXXXXXXXXXGRLGGTFLLQNFRWMSQIKWP 2572
             SLG+LSL+  K W  +DHY                   GRL G   L    W +++ WP
Sbjct: 2571 PSLGLLSLSMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVELDGALWAAEVNWP 2630

Query: 2573 LNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVS 2632
              +  +  PLV L+  +   ++K+ FDYH+ LI +V      L ++RD  G + +LL V 
Sbjct: 2631 KYDDPY--PLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERDTSGFMPDLLKVM 2688

Query: 2633 LSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGXXXXXXXXXX 2692
            L+ +   +  TAL  AN+ D+YNTI+RMR+D   SYLETL +SNT DTK           
Sbjct: 2689 LTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDTKETVDYKDILKV 2748

Query: 2693 XXXXRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNV 2752
                +T++ V +  +++Q+ P +LFD+EV+     +     +T   +KL+T L L+++N 
Sbjct: 2749 LNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGEKLETYLHLQLYNA 2808

Query: 2753 KLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELL 2812
              +LS+ K ++ E + S+I V++Y+ +ASK+ GGTI   P + I M T+    ++ +E  
Sbjct: 2809 HGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMHTFQKSNSDILEYG 2868

Query: 2813 YSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNGQSKSFFEDEHXXXXXXXXXX 2872
            Y ++FG KI VRWNLG +NF++EMW TH +A+A+RRS +    +  E+            
Sbjct: 2869 YRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGDEEGDVEKRMRDEET 2928

Query: 2873 XXEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAES 2932
              + TYI +EEP I+ PQ KDLG+ATP +EWFG+NRK+FP  THQ VIVP+QKL H AE 
Sbjct: 2929 LSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTVIVPVQKLIHSAEK 2988

Query: 2933 EWARILGRA 2941
            E+A I+G +
Sbjct: 2989 EYANIVGHS 2997

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score = 1748 bits (4527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1040/3021 (34%), Positives = 1626/3021 (53%), Gaps = 168/3021 (5%)

Query: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62
            S+F RV +S  ++FSWVFL DWVL+  V+L   FY GR+  Y IT +LE+  WK + VK+
Sbjct: 5    SQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHWKVKI 64

Query: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQSE------ 105
                       G + F+NL +I +DQT SIL GS+ WRY LL++R++  E  S       
Sbjct: 65   SVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQKDGLG 124

Query: 106  ---------KAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPSP 156
                     K   LPCRF + C+G E FIYNRT A++NI+    RE++   +KF S    
Sbjct: 125  VGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS--KQ 182

Query: 157  RATEETSTENDSAAQKSHLXXXXXXXXXXXXXLNDRTY-QLPNSMPS-FLRLLPLEYSVQ 214
              +E     ++ +  K                +NDR + ++ N   S F+R LP+E  + 
Sbjct: 183  EMSELFHCHSERSDDKGSTDSVLSSSVSDVPNINDRVFDEVHNQKKSIFMRFLPMELQLS 242

Query: 215  KGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYD 274
            +G++++GNK T S++++S    +G +D C P  K+DLYK+  Q D     +S+R N+ Y 
Sbjct: 243  RGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIEY- 301

Query: 275  NDEPLKNLPKANRLPKLLHKYYETFLRV------RKRYLSRGSKTESTRKDLRNPLERWR 328
                  N  KA      L + + TF++V       K + ++G+++E         + +W+
Sbjct: 302  ------NRKKATFKNGKLSRMWATFVKVLHIPFYNKSHNNKGTESEPF-------MTKWK 348

Query: 329  GLGLY----WKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFP 384
            GLGLY    +  +   +D+V HF+   HEYA+ S ++K    ++ YS+D PGVVPHGA P
Sbjct: 349  GLGLYKGLTFDRDGEDYDEV-HFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHP 407

Query: 385  TLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTER 444
            TLE   GP+VGN GAPP+F +D+Q +G  I YGPWA  EI  + ++ SP V+R S P + 
Sbjct: 408  TLE---GPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKT 464

Query: 445  LSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAE 504
            LS GS R++T  + +  ++  S WRIPTRE SKD +FLK++K T ++ RPFGWL+L  A 
Sbjct: 465  LSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAM 524

Query: 505  GSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAK 564
             S   +   +CP   GF NK+ +HF + E  +SVNHD++L     D+   +GYPLGWN+ 
Sbjct: 525  DSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSS 584

Query: 565  AKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYL 624
            A W  +L S Q   F+L++H+TL+ DI +DF +G+PTPY+LFRPFIY+ NW + GYS+YL
Sbjct: 585  ATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYL 644

Query: 625  NVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNT 684
            NVND NIVNNP+DFNENCYLS HG++L I    P DSI G    + Y + TP+FRL +NT
Sbjct: 645  NVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRLLLNT 704

Query: 685  PSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVR 744
            P WNTL+EFMK+KEVGR+  F++ G Y  +S+LD++N+DT+ +EC S  TTL CYG+V+R
Sbjct: 705  PPWNTLNEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMR 764

Query: 745  FLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANSEQSA---NSTETTTAGEGEDKQN 801
            +L+ VKMNYFGDF HF T+EEY   +R    E    +E+ +   NST  +T   G    +
Sbjct: 765  YLMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGG--LSD 822

Query: 802  APKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDID 861
                   DP +++   +KR  NE D+WFTF V +G L+LP+ +Y+C+ C A  F  L +D
Sbjct: 823  PYVRLRADPPVSRS-DVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVD 881

Query: 862  LRYINYYMDLQAALSPVIVRNLSDCDPAHLFSG---SEGRCPSRANFGSISDLHIHAHRM 918
            LR  NYYMDL A +S   ++         LF       GR  +    GS++ L IH HRM
Sbjct: 882  LRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGR--TEKEHGSLAALTIHGHRM 939

Query: 919  FGLPPDEETYFCKWDFSMGVXXXXXXXXXXXXFGDAWSKLAFSFKDYENIMNYKIVPILD 978
            +GLPP E TYFC+W   +              F   ++ + F + + EN + Y +    D
Sbjct: 940  YGLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDD 999

Query: 979  MTSIIFHAGEIRVKI-NDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQVK 1037
            MTS+     ++ V + ND +     +V+V N+T   +DFENERYS R D+ + S+++ + 
Sbjct: 1000 MTSVTVRVRDMNVVVENDSS---RAVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLL 1056

Query: 1038 EGGKDGSLIG--DFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQR 1095
                D   I   D ++ + +T F Q ++F  H  +Q+ +I  ND+PF+RCSFLLP  +Q 
Sbjct: 1057 TSEDDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQE 1116

Query: 1096 SDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNEHFCSKKEEDGY 1155
            S  Y+ LLGSI P  S+P +  P+  E +  I+++ L      L+   +   +  + D  
Sbjct: 1117 SPLYKSLLGSISPSSSLPPLPMPLLAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSP 1176

Query: 1156 AFNFASGLMSSTENDSNVESESLVVKLIKP----QASISACCIKPFRSFSDQAYSNFVEQ 1211
            + +F +       +D   +  + + K++ P    Q       +K      D    ++V+ 
Sbjct: 1177 SESFDTSQEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDG 1236

Query: 1212 LIDS----NEIEVVLHFIETTLKR--KQCKNVKVFSPTFEMTLSNF--GSDNISQTSDTV 1263
            L+      N ++++     + +KR  +   N  V +    +   NF  G  N    +  V
Sbjct: 1237 LLGEFWKVNTVDIIDEIEMSIVKRLGQLWNNTCVLNLKLYVVDINFFWGDKN----AKVV 1292

Query: 1264 DIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQL 1323
            D+   ++  D+  R   + +   ++ V +   L K+ S+   V + S    +E       
Sbjct: 1293 DLYFDKLDFDLGQR---TRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVE--ERPPA 1347

Query: 1324 CSTSIKDLEF--WMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVS 1381
             S +++  E   WM  + +   S +  S D  V   + E   +++      I  +    +
Sbjct: 1348 LSLAVEGWEAYSWMREKIV--GSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFT 1405

Query: 1382 VHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLR 1441
               E  Q  +RD    I+TAS+ YQI H+P VITKPA+I RL N HVREN SW+IITRLR
Sbjct: 1406 KLHEYWQGTRRDLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLR 1465

Query: 1442 HILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYS 1501
            HIL YLP         A++ +     T+A     ++ S WR WE SD+ + Y+YR  F S
Sbjct: 1466 HILTYLPNEWRNN--SAIQVSPTVDSTDA-----SVASHWRRWEISDITRSYIYRTIFLS 1518

Query: 1502 -QYEGQAGPLN--LRVEVDSCSATVSDSTHKEGDMIAVXXXXXXXXXXXXSEMVGSILAI 1558
             Q + Q   L   L+V+  S   T+    ++      +            +E+     A+
Sbjct: 1519 DQSKTQCQSLKKMLKVDFHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQAL 1578

Query: 1559 DDGTATDGNSLSCSLKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLM 1618
            D     +   L+ SL A+K  +++   +LL  R +F    +  +  +   +   K  K+ 
Sbjct: 1579 DYDNVMN---LTVSLGAIKGELND---QLLKLRNIFSKAQTPALKRSKTSINISKSYKV- 1631

Query: 1619 ELALLIDRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHN 1678
             + L  DR E++  L       +      +  L   +++     S        E  ++H 
Sbjct: 1632 NVLLAFDRSELQFVLGQTRLTNRILNGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHA 1691

Query: 1679 NAIIVDAFARRGSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSS 1738
            + ++ +A +R  SL              +++      ++  +ST+   N I  + ES S 
Sbjct: 1692 DLVLAEALSRELSLTMTAELWSYMPSLSINIQCSNSHIRAMTSTELLVNSIKQIMESISE 1751

Query: 1739 LAPKLKFNTRSKDLSPEMKNFS----KVAFEAHVDDFTSEISALSPLSISKRFKGLTVQF 1794
            L         + ++     N S      A      D T+E+  L+P  +    K L +  
Sbjct: 1752 LKRHFAMEKTTPNVQGTSTNLSIPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYL 1811

Query: 1795 EKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALT 1854
             +  ++ + + + + ++ L S  T +QY   +   +++   +  +   + + + L ++L 
Sbjct: 1812 NRVQSNEILISIWDANIILKSHQTTEQYFNFALGDLQVKCNLPTESSAILN-VGLSTSLM 1870

Query: 1855 KFKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLW 1914
            K  L +PR I+ +  QD     ++L  +K  LL L +    + T             W  
Sbjct: 1871 KLTLSEPRRILSSFLQDEKLIGESLGYIK-GLLQLFSPLARNKTQSSAL-------RWSL 1922

Query: 1915 QLDMKYVGLLVPLGTT-XXXXXXXXXXXXXXCDEAAEFSFPLVHGELSVAGISFLINDKE 1973
              ++ Y G+LVP+ +T                 +  +     V G++S+     LI +  
Sbjct: 1923 DANLNYFGILVPMASTFFVFEIHMLLAAMNNASDGQDEGDHHVTGQVSIENCLLLIKEPS 1982

Query: 1974 LPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRIL--------SLAY 2025
            LP DLSK+L+F+ R+  ++   NS +S QIES+HFR+ L P SL+++L         L Y
Sbjct: 1983 LPADLSKLLDFSIRVMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEY 2042

Query: 2026 EATHLSGLQALKDNA---GVKSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNS 2082
               H    +A+   +   G  S+D   D       F SI ILSY+ C+GW+F       +
Sbjct: 2043 FRKHRKQDKAISPFSLFDGSASADRQID-------FRSIHILSYNLCIGWMFQLGDDVKT 2095

Query: 2083 GLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICY 2142
            GL  G+ RLF+A+EK YGKLTL+D YF +A G +++ FY Q  E  R NRS L ++QI Y
Sbjct: 2096 GLIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNVQITY 2155

Query: 2143 WFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVK 2202
            W +   S  +LF+R+NGE L+VS LS S  I      S+  FQ LK++ +   +   P  
Sbjct: 2156 WLKEIDSMKDLFIRVNGEALEVSLLSNSFDIIESTLASIQKFQTLKKERMHK-RDSGPRN 2214

Query: 2203 RVPAGSAFSKL-PILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFE 2261
            ++   +  + + P LS I  ++C+ +Y GGV K+YSLDD+ R  GPS +++SP V +  +
Sbjct: 2215 KLNLENTSNNISPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALK 2274

Query: 2262 YTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPRTSN 2321
            Y      +R H +R L+S+D +HN L+  CVPI++++    +++++    S  ETP  S+
Sbjct: 2275 YNHNEAERRPHRIRCLVSIDPTHNILYSQCVPILNDIVEASQRMVQ--KHSPDETPLESS 2332

Query: 2322 MQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEP 2381
              + I+Y+SLL   DI+F +   +QQ+SLSCEP+AKVQADVGF+ F   + TND     P
Sbjct: 2333 --QSIDYKSLLDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNP 2390

Query: 2382 LSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNI 2441
              +SL +  I ++ RHIFSRE S S +++ + F  + THPD    +G+A +  I+V+FN+
Sbjct: 2391 TGVSLSVEKIQSSVRHIFSRETSASFSVDFVDFTSIFTHPD---VFGVALVSDINVFFNM 2447

Query: 2442 KQLQDLNVFINIWKLDSKILSQPELDNKFVIGPTNLEKPLTSKY--KKVISNSSFPWNFV 2499
            KQLQ+LN+F++IW+L+ K      L+NK      + +K   S    K+  + +S  W+F 
Sbjct: 2448 KQLQNLNLFLDIWQLNGK------LNNKGRAKDDDRKKQTKSMTLSKRTSTPTSICWSFT 2501

Query: 2500 VILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWXXXXXXXXXXXXXXXXGRLGGTFL 2559
            +I + ++G++DLG SLGVLSL   + W  TDHY                   GRL G F 
Sbjct: 2502 LIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQRRVLHAFADELSIKSEGRLSGVFD 2561

Query: 2560 LQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKR 2619
            L+N  W+S++ +P       S  + L++ +   A+K  FDYH+ LI +++++   L ++ 
Sbjct: 2562 LKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIKTAFDYHMFLIGTIDEMKFHLRSES 2621

Query: 2620 DPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRD 2679
            D  G++ +LL V+LS        TAL  ANI D+YNTI RMR+DNR SY+ETL +SN+ +
Sbjct: 2622 DLYGILPDLLVVALSCKEMDFCATALTAANILDIYNTITRMRQDNRISYIETLRESNSTE 2681

Query: 2680 TKGXXXXXXXXXXXXXXRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSK 2739
             +               RT+LS  +     Q+ P +LFD+EV+     + S  S+T+  +
Sbjct: 2682 ARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPISLFDVEVLVLNIDNVSARSETQSGE 2741

Query: 2740 KLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMT 2799
            KLKT+L L+V N K++LST K +L E   ++I +++Y+ +ASK+ GGTI+  P +L+ MT
Sbjct: 2742 KLKTELHLQVSNAKVSLSTSKEELDEERVAKISIEDYMLYASKISGGTIVKVPRLLVSMT 2801

Query: 2800 TWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNGQSKSFFE 2859
            TW    ++ +E L++  F  ++ V+WNLG INF++EMW+TH +++A+R++ + ++ S  E
Sbjct: 2802 TWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKEMWSTHIKSLAVRQTQSNKTMS--E 2859

Query: 2860 DEHXXXXXXXXXXXXEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGV 2919
             +             +  Y+PL+EP+IE+PQ KDLG+ATPP+EWFGV+RK+ P  THQ  
Sbjct: 2860 KDKQADLDPEEEIKAKLQYVPLDEPYIEMPQIKDLGDATPPMEWFGVHRKRLPAATHQLA 2919

Query: 2920 IVPLQKLAHLAESEWARILGR 2940
            IV +QKL H AE E+A++ GR
Sbjct: 2920 IVLIQKLVHAAEKEYAKVQGR 2940

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score = 1711 bits (4432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1043/3096 (33%), Positives = 1615/3096 (52%), Gaps = 251/3096 (8%)

Query: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62
            S F++V +   ++FSWVFL DWVL   V+L   FY GR+ G+ +T ILE++ WKR  VK+
Sbjct: 5    SPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRCKVKI 64

Query: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSL----------- 100
                       G + F+NL +I +D T S L G+I WRYWL +SRK+             
Sbjct: 65   NIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQENLDNEEERL 124

Query: 101  ----ESQSEKAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKF------ 150
                E +S    K PCRF + C+GLE F+YN+T +++NI+    +E++   +KF      
Sbjct: 125  ENGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVDDQTM 184

Query: 151  -------------FSDPSPRA-TEETSTENDSAAQKSHLXXXXXXXXXXXXXL-----ND 191
                          S+ +P + T ET   ND    +                      ND
Sbjct: 185  TELFNESEQENKVLSESTPSSVTMETVGSNDRNNNEDSNEEEDAGRNQNDGQAPNNLEND 244

Query: 192  RTY--QLPNSMPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKI 249
              +  Q  N    ++R LP++ S ++ +L++GN+ T S++V S +  KG +D C P  K+
Sbjct: 245  ELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPPKEKL 304

Query: 250  DLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRYLSR 309
            DL+KIKL+ ++     S++ N+ +D+D          RL KL  K+   FL       + 
Sbjct: 305  DLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFL-----LPTL 359

Query: 310  GSKTESTRKDLRNPLERWRGLGLYWKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIE 369
            G K   T++D+    E W+GL LY +  +    +   F+   HEYAR   ++K   ++  
Sbjct: 360  GPKHLQTQEDI-TFRENWKGLSLYRQNMEEDELENVDFDFANHEYARVISILKSAKIVFT 418

Query: 370  YSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQK 429
            Y +D PG+VP     TL+   GP+VGN GAPP+F +DIQ++GANI YGPWA  ++  ++ 
Sbjct: 419  YEYDIPGLVPKEPEETLQ---GPEVGNSGAPPEFGVDIQLYGANICYGPWAERQLSYLRA 475

Query: 430  VFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETE 489
            + SPVVSR   P + L+ GS R++T  + SI IM +S WRIPTRE SKD +FL+ Y ET+
Sbjct: 476  LLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLRHYVETK 535

Query: 490  DDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETH 549
            ++ RPFGW++L   + S   L+  +CPT  G  N ++ HF   EIRTSVNH++LL A++ 
Sbjct: 536  EEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELLLRAKSF 595

Query: 550  DIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPF 609
            D EA +GYPLGWN +A WN +L S Q  +FIL++HITL+ D+ +DF +GDPTPY+LFRPF
Sbjct: 596  DFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPYELFRPF 655

Query: 610  IYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTI 669
            IY  NW L GYS+YLNVND NIVNNP+DFNENCYLS HGD L    ++P+ ++A   T I
Sbjct: 656  IYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVANRCTEI 715

Query: 670  DYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIEC 729
             Y++ TP+FRL +NTP WNTL+EFMK+KEVGR+ +F + G Y   S+LD++N+DTI +EC
Sbjct: 716  TYHISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVDTISVEC 775

Query: 730  KSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANS---EQSAN 786
             S  TTL CYG+VVR+L+ VKMNYFGDF HF T EEY     +   EPK  +   E S  
Sbjct: 776  SSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNA--NHTEEPKNENLGDEHSGF 833

Query: 787  STETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYD 846
            +  +T   E +      +       M K+  LKR  NE D+WF F V +G LILP+ +Y+
Sbjct: 834  NISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALILPETIYN 893

Query: 847  CNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFS---GSEGRCPSRA 903
             + C A  F+ L++DLR  NYYMDL A ++   ++      P  LF       GR     
Sbjct: 894  SDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNGR--QEK 951

Query: 904  NFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVXXXXXXXXXXXXFGDAWSKLAFSFK 963
            + G +S L IH HRM+GLPP E TYFC+W   +              F   +SK+ F FK
Sbjct: 952  SHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKIGFGFK 1011

Query: 964  DYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSS 1023
            + ENI+ Y+   + DMTS+     E++  +ND       ++  + +T   +DFENE YS 
Sbjct: 1012 NLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFENEAYSQ 1071

Query: 1024 RADV---DIHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDA 1080
            R D    DI+ +  ++ E  K+G  +    + L  T F Q + F  H  +Q+ +I  +D+
Sbjct: 1072 RVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYITLHDS 1131

Query: 1081 PFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFL-------- 1132
             ++RCSFLLP   Q S  Y++LLGSI P  ++P +  P+  E +  I+++ L        
Sbjct: 1132 AYYRCSFLLPCFFQESVLYKELLGSISPSATLPPLPLPVLAETIDYIIEDCLGEYAPTVK 1191

Query: 1133 ----------KGEKNSLQMGNEHFCSKKEEDGYAFNFASGLMSSTENDS--------NVE 1174
                      +G++  L   +  F   +   G+   F+  +  +  N+         +VE
Sbjct: 1192 PDDSSSSDTSEGQRTPLTNEDTRF---QANSGF---FSPHMPHNPPNNRDRYNNYVLDVE 1245

Query: 1175 SESLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQC 1234
              +L VK      S++   +   + F    Y+     +ID NEI +V          K+ 
Sbjct: 1246 YVNLEVK-----PSVTGVLLNYLKKF----YTEDTTDIIDKNEIAIV----------KKL 1286

Query: 1235 KNVKV---FSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQ 1291
             N++    F  T  + + +       +    V++ +   S D  +R +   N  EK  ++
Sbjct: 1287 GNLQYGASFVTTSRLHVKDLHFLYDFEEGSGVELALN--SFDFDLRRKTIENEDEKVILE 1344

Query: 1292 DITALVKVESLALCVSNTSRNGPLENIHEDQLCSTSIKDLEFWMTSEDIRKSSFNATSID 1351
              T    + +L + +       P     +      SI+DLE W ++ D   +S N TS  
Sbjct: 1345 K-TMFSNIHTLRISLLEAH---PSSISMKPAALQLSIEDLELWSSTVDENVNSVNVTSFG 1400

Query: 1352 TWVHSDKTELCCIFLKNTAANI-DTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHD 1410
              +   + E    +L      + DTIT    +   R +K Q+D    +++AS+ YQI HD
Sbjct: 1401 FTLDESQLERISGYLFGQIKVLRDTITSAKELENLR-KKTQKDLICDLTSASEYYQISHD 1459

Query: 1411 PPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLA--EIYGALKSASFEAPT 1468
            P VITKPA+I RL   HVREN+SW+IITRLRHIL YLP        +     S +   P 
Sbjct: 1460 PYVITKPAFIMRLSEGHVRENRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQ 1519

Query: 1469 NAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEGQAGP---LNLRVEVDSCSATVSD 1525
               +IF+++FS WR+W+ SD+ + Y+Y+K F  Q E          L++   S   TV  
Sbjct: 1520 RDEDIFVSVFSNWRNWDLSDITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLI 1579

Query: 1526 STHKEGDMIAVXXXXXXXXXXXXSEMVGSILAIDDGTATDG-------NSLSCSLKAVKA 1578
            S ++                   + ++  +L     T+++         +L+ ++ A+K 
Sbjct: 1580 SGYE----------VARSTIFTRTNIIVDVLPPSVNTSSENLFKQEKVITLTANMGAIKG 1629

Query: 1579 SISETAIKLLAFRELFE--SQNSQDILSNTQVL-----------------------PSGK 1613
               E   KL   +ELF   S+N  D LSN   +                       P  +
Sbjct: 1630 EWGEEVFKL---KELFSKFSENELDDLSNLGSISRSASISGFGSQMDRLESSRASGPGDR 1686

Query: 1614 ILKLMELALLI-DRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFE 1672
               L   A +I +RC++   +       +      S  L +++       S        E
Sbjct: 1687 FRNLKIFATMIFERCDLHFVVGDTRLTNRIINGKNSMLLENSKENTPPALSAVFFAQRHE 1746

Query: 1673 FDVRHNNAIIVDAFARRGSLGSFISQSESTTLHRVHLGSQKLR--LKVPSSTKDYCNFIN 1730
              ++H+  ++ +   ++  +    + ++   +  V L  Q     ++   ST    N + 
Sbjct: 1747 IWLKHSTNVLAEVLLKQLHVA---ATAQLGVIPFVSLNCQATNSFIRAMPSTVVLRNSVE 1803

Query: 1731 SLSESWSSLAPKLKFNTRSKDLSPEMKNFSKVA-----------FEAHVDDFTSEISALS 1779
             +      L P+ K        S E+KN S V               +  D +SEI  LS
Sbjct: 1804 KIKRQVEVLIPQFK--------SHEVKNSSAVTKKTPRIPIKFDIRFNFTDMSSEIMLLS 1855

Query: 1780 PLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDK 1839
            P  + +  K L +      N  L L    +D+ L S+++++Q+ K S + ++   ++ D+
Sbjct: 1856 PFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQFFKFSSTDLQFKCEVADE 1915

Query: 1840 IEKVASKMQLESALTKFKLCDPREIIETLTQD---LVNAKQNLEQLKIHLLALGALFGTD 1896
            +  V  ++Q+ ++L K  LC+PR  +  L QD   LV +  ++++L   L +     G D
Sbjct: 1916 VVPVV-EVQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQKLWNFLRSASG--GND 1972

Query: 1897 STDEEVFAGALWPREWLWQLD--MKYVGLLVPLGT-TXXXXXXXXXXXXXXCDEAAEFSF 1953
             +           R   W LD  +KY GLLVP+ +                 +E  E   
Sbjct: 1973 RSPS---------RNTRWALDANLKYFGLLVPVSSICYIFELHSLFASLTNANEQYEEYD 2023

Query: 1954 PLVHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALC 2013
                G++ V     L+ +  LP +LSKVL+F+ R   ++   NS++S QIES++FR+ L 
Sbjct: 2024 RHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSYFRLCLF 2083

Query: 2014 PFSLIRIL-SLAYEATHLSGLQA-------LKDNAGVKSSDDAKDFFNISQTFHSIQILS 2065
            P  L+ IL S+ Y  + L+  +           N   KS +   D       F SI ILS
Sbjct: 2084 PELLVDILWSVHYLQSLLNHFKKHHTPWLPYSSNKTAKSGESTLD-------FRSIHILS 2136

Query: 2066 YDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPD 2125
            Y+FC+GW+F     S  GL  GY RLF+A+EK +GKLTL+D Y  +A G+TS+ FY Q  
Sbjct: 2137 YNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKS 2196

Query: 2126 EVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQ 2185
            E D   R+ L +MQI YW +      +LFVR +GE +DV FLS S  +      S+  F 
Sbjct: 2197 EKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFN 2256

Query: 2186 ELKRQYLDPFKPEEPVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKT 2245
            E+K+  +         K     ++ +  P L+ I  +N ++ +AGGVFK+YS  ++  K 
Sbjct: 2257 EMKKAKIKQTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSKA 2316

Query: 2246 GPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQL 2305
             P  +++SP V +   Y    T ++ H +R   +++ +HN LF  C P++S+   +I+ +
Sbjct: 2317 EPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKNM 2376

Query: 2306 LKDLNKSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFE 2365
            +++L+      P +  + + I+Y+SLL   DI+F +   KQ++S SCEPKAKVQ D GF 
Sbjct: 2377 IRNLSSEDKSHP-SKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGFN 2435

Query: 2366 KFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIH 2425
             F  ++ T+  D +EP ++S  +  I ++ RHIFSR+ S +  ++ +  V M T+P+   
Sbjct: 2436 SFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFTYPN--- 2492

Query: 2426 TYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVIGPTNLEKPLTSKY 2485
             YG+A +  +++Y N+KQ Q+LN+F++IW+L ++  ++P  +                  
Sbjct: 2493 VYGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKSLSPPFSP 2552

Query: 2486 KKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWXXXXXXXXXX 2545
                S   FPW+F +I + + G +DLG SLGVL+L  E++W  T H  D           
Sbjct: 2553 SSNDSRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHTFAHG 2612

Query: 2546 XXXXXXGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLI 2605
                  GRL G F L     +S+I WP  +     PL+ +++ ++  ++K  FDYH+ LI
Sbjct: 2613 ITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFDYHMFLI 2672

Query: 2606 ASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNR 2665
             S++ + + L N+ D   ++ +LL VSL  +S  +  TAL  AN  D+YNTI+RM++DNR
Sbjct: 2673 GSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCATALTAANALDIYNTIMRMQQDNR 2732

Query: 2666 KSYLETLGDSNTRDTKGXXXXXXXXXXXXXXRTELSVMLKFVHIQVYPSTLFDMEVMTFK 2725
             SY+ETL +SN   +                RT++SV++K + + + P +LFD EV+   
Sbjct: 2733 ISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAEVLVVS 2792

Query: 2726 ARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDG 2785
             RD +  S+T+  +KLKT+L+L++ +V  +LS+ K +L E   S+I V +Y+ +ASK  G
Sbjct: 2793 VRDVNARSETQSGEKLKTELQLQISDVNASLSSSKEELDEETVSKIAVDDYMLYASKFSG 2852

Query: 2786 GTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMA 2845
            GTI+  P +L+ MTTW   ++  +E L++  F  KI ++WNLG +NF++EMWATH R++A
Sbjct: 2853 GTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWATHVRSLA 2912

Query: 2846 LRRSHNGQSKSFFEDEHXXXXXXXXXXXXEYTYIPLEEPHIEIPQTKDLGEATPPVEWFG 2905
            +RR+  G S    E E             ++ Y+PL+EP+IE+PQ KDLG+ATPP+EWFG
Sbjct: 2913 VRRTQLGNSSP--ELEVANESDKEDTVKSKFIYVPLDEPYIEMPQIKDLGDATPPLEWFG 2970

Query: 2906 VNRKQFPGLTHQGVIVPLQKLAHLAESEWARILGRA 2941
            V+RK  P  THQ  ++ +QKL H AE E+A++  RA
Sbjct: 2971 VHRKNLPAATHQTAVLLIQKLVHTAEKEYAKLQQRA 3006

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score = 1667 bits (4317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1011/3055 (33%), Positives = 1599/3055 (52%), Gaps = 180/3055 (5%)

Query: 1    MSSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGV 60
            + S+F  + +   + FSWVFL  WVL    SL   FY  RV G   T IL +  WK+Y V
Sbjct: 3    VDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKYKV 62

Query: 61   KV-----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQS----- 104
            K+           G VF KN+++I QD T S L   I WRYWLL+SR+   + Q+     
Sbjct: 63   KINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLSSE 122

Query: 105  -------------EKAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFF 151
                         EK +KLPC   IEC+G E F+YNR  A++N+L    +E++E    F 
Sbjct: 123  QSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSSFL 182

Query: 152  S--DPSPRATEETSTENDSAAQKSHLXXXXXXXXXXXXXLNDRTYQL-PNSMPSFL-RLL 207
            +  D     +E+T   N ++  K +              +NDRTY+   +   S L   L
Sbjct: 183  NEHDLGDIVSEDT---NVNSMDKDYFESVTTENSSESTVINDRTYKKNKDERKSILFNFL 239

Query: 208  PLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSL 267
            P++  +  GA+ +GN+ T S++V+S+E   G LD    + KIDLYK K+        +S+
Sbjct: 240  PIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISV 299

Query: 268  RPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRV----RKRYLSRGSKTESTRKDLRNP 323
            +PNL YD++   +      +L ++ + + +    +     K Y     K E   + +   
Sbjct: 300  KPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMF-- 357

Query: 324  LERWRGLGLY---WKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPH 380
            + +WRGL LY    ++      D   ++    EYA++S ++KC +  + Y  D+PG+VPH
Sbjct: 358  VNKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPH 417

Query: 381  GAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSH 440
            GA  T    DGPD+GN G+PP+F +D+QV  A+I+YGPW + ++  + ++ SPVVS++  
Sbjct: 418  GAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQI 477

Query: 441  PTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLEL 500
            P ++L  GS R+ T  ++S+ I+ +S WRIPTREPSKD +F+K++ +T DD RPFGWL+ 
Sbjct: 478  PIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDF 537

Query: 501  SLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLG 560
            +L +G++   N ++ PT  G  N  D+HF+  E+ TSVNHDILL ++  D+ A IGYPLG
Sbjct: 538  NLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLG 597

Query: 561  WNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGY 620
            WN++A W FD+ + Q   F+LK+HI+L  D+ SDF + DPTPY+LFRPF Y  NW++ GY
Sbjct: 598  WNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGY 657

Query: 621  SMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRL 680
            S+YLNVND NIVNNP+DFNENCYLS HGD+L I   +P   I+   T I +N+YTP+FRL
Sbjct: 658  SIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRL 717

Query: 681  NMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYG 740
             +NTP WNTL EFMKDKEVGRA DF + GSYL +S LD++N+DTI +EC SR TTL CYG
Sbjct: 718  LLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYG 777

Query: 741  YVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANSEQSANSTETTTAGEG---E 797
             V+R+L+ V+ NYFGDFVHF T+EEY E L+      ++N EQ + +  TT++ +    +
Sbjct: 778  VVIRYLMNVQANYFGDFVHFITSEEYSEILQKN--NKRSNDEQGSFTYSTTSSVQNSSSD 835

Query: 798  DKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDS 857
            D     K         ++  + R  NE D+WFTF V DG LILP+ LY+ N C +  F  
Sbjct: 836  DTVLYTKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSE 895

Query: 858  LDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEGRCPSR---ANFGSISDLHIH 914
            L I  R  NYYMD    L  + +    +  P  +F     R P        G++SD+ IH
Sbjct: 896  LMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYV--RDPDHNLNIVHGTLSDVTIH 953

Query: 915  AHRMFGLPPDEETYFCKWDFSMGVXXXXXXXXXXXXFGDAWSKLAFSFKDYENIMNYKIV 974
            AHRMFGLPP++ TYFC+W    G             F   ++KL F + + EN + YK+ 
Sbjct: 954  AHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVE 1013

Query: 975  PILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITV 1034
               DMT +  +  ++ + ++D        +E+  +    +DF+NERYS R ++ I   ++
Sbjct: 1014 SSDDMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSI 1073

Query: 1035 ---QVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPL 1091
                V+       L+G F + +  T F   ++F      Q+++I  +D+P+HRC F+LP 
Sbjct: 1074 SIFDVRNPTIKPILLG-FKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPT 1132

Query: 1092 AIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQ----------- 1140
              Q S  Y +L G I P  SIP +  P+ P  +  ++++FLK   + L+           
Sbjct: 1133 MYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLENPFLNIRSINN 1192

Query: 1141 MGNEHFCSKKEEDGYAFN---FASGLMSSTENDSNVESESLVVKLIKPQASISACCIKPF 1197
            +      ++   D Y      F +   ++   D   E ++ ++ +   +  I+       
Sbjct: 1193 LDTSSLFNEYRVDTYISEKAIFKAEEKNTVNYDPKYEYDNYILNVEYIRVDINPLFSDFI 1252

Query: 1198 RSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKR-KQCKNVKVFSPTFEMTLSNFGSDNI 1256
             S S + YS         N ++++       ++R    K V +     ++ +S       
Sbjct: 1253 DSMSTKLYS--------ENMVDIIDEIEMIIVRRLGSPKKVLLRETNLKLKISYVDIFWG 1304

Query: 1257 SQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLE 1316
            S+ S+ ++I + ++  D  MR+    + +++S +++ T L K++SL    S T      E
Sbjct: 1305 SRNSEGIEIYLDKL--DFEMRQRIFDDFNQRS-LEERTILSKLKSLRCSFSETQ----YE 1357

Query: 1317 NIHEDQ--LCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANID 1374
             I  ++    S +++ LE W  +   + +S N  S D  V   +T     +L        
Sbjct: 1358 EIEYERPPALSLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFY 1417

Query: 1375 TITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSW 1434
             +   V + ++R    Q+    +++TAS+ YQI HDP VITKPA I RL N HVREN+SW
Sbjct: 1418 NLKGSVDLLQKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSW 1477

Query: 1435 KIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYM 1494
            +I+TRLRHILNYLP          +++    + ++   +FL++FS WR+WE SDV + Y+
Sbjct: 1478 RIVTRLRHILNYLPEGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYI 1537

Query: 1495 YRKAFYSQYEGQAGPLNLRVEVDSCSATVSDSTHKEGDMIAVXXXXXXXXXXXXSEMVGS 1554
            YR+ F    E        ++ ++S   T+    +     I V             E   +
Sbjct: 1538 YRRVFLPDIEKNLINNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKA 1597

Query: 1555 ILAIDDGTATDGNSLSCSLKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKI 1614
              A  +    D   ++ ++   K  + +  I+L   ++L+    ++     +      K 
Sbjct: 1598 ATANKNDKIYD---ITGTVGTFKGELGDQLIRL---KKLYSEDKAKIRSEKSTDFSIPKF 1651

Query: 1615 LKLMELALLIDRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFD 1674
             K+  + L++++ E+ ++  +     +     IS    +     +   S+    +  E  
Sbjct: 1652 FKI-NIVLIVEKGELTLAAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELW 1710

Query: 1675 VRHNNAIIVDAFARRGSLGSFISQSESTTLHR----VHLGSQKLRLKVPSSTKDYCNFIN 1730
            ++HN  I++DA         FIS      + +    V++ S  LR K   +TK+   F+ 
Sbjct: 1711 LKHNELILLDAHLD----DLFISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLR 1766

Query: 1731 SLSESWSSLAPKLKFNTRSKDLSPEMKNFSK----VAFEAHVDDFTSEISALSPLSISKR 1786
                  S +  +L      K  +     FS     ++F+ ++ D +SEI  LSP ++   
Sbjct: 1767 EFEREISKITGRLTDKDNKKRHTSTSPIFSTKKIDISFDINIFDISSEIVILSPFTVKHS 1826

Query: 1787 FKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASK 1846
             K L + F +E ++     + + DL L S     QY ++S   + L A + D   K+ + 
Sbjct: 1827 MKELKIVFNREGDNDTIFSILDADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLIT- 1885

Query: 1847 MQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGA 1906
            + + ++L K  L DP++I  +L QD    +Q+LE +K     L  LF   S++ EV   A
Sbjct: 1886 INIVTSLIKLTLADPKKITNSLLQDEKTFEQSLESIK----TLNTLF---SSNREVRTSA 1938

Query: 1907 L-WPREWLWQLDMKYVGLLVPLGTTXXXXXXXXXXXXXXCDEAAEFSFPLVHGE------ 1959
            +  P +++   D+ Y GLL P+ T+                  A FS   ++ +      
Sbjct: 1939 VDNPYKFMVNFDLTYFGLLFPVDTSYFILELHSL--------LATFSNVYMNPQQLKEKI 1990

Query: 1960 ---LSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFS 2016
               L++    F+I   E+   +SKVL+F+  +       NS +S ++ES+HFR+ L P S
Sbjct: 1991 TCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTETKILNSKRSFEVESSHFRVCLNPES 2050

Query: 2017 LIRIL--------SLAYEATHLSGLQALKDNAGVKSSDDAKDFFNISQTFHSIQILSYDF 2068
            L++IL        S  Y   H + LQ  K     K+S  +++        +SI  LSY+F
Sbjct: 2051 LLKILQGVFQTSSSFKYYKEH-TRLQIFKTKK--KASVVSENLIGAPLIEYSIHFLSYNF 2107

Query: 2069 CLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVD 2128
            C+GWIF N  +S  GL  GY RLF+A+E  YGKLT++D +F IA G +S+ FY Q +E +
Sbjct: 2108 CIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLTVVDGFFSIANGFSSDTFYSQGNEKE 2167

Query: 2129 RPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELK 2188
            + NRS LP++QI YW +   +  +LFVR  GE +DV FLS    I      S+  FQ +K
Sbjct: 2168 KYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETIDVRFLSNFATIINLTIESVQHFQMIK 2227

Query: 2189 RQYLDPFKPEEPVKRVPAGSAFSKLPI-LSSISHVNCKVRYAGGVFKLYSLDDIKRKTGP 2247
            ++ +     E   K+V      +K  +  S +  +NC+  Y GGVF +Y +      T  
Sbjct: 2228 KETVREMNVEAE-KKVGEDDISTKFSLFFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEH 2286

Query: 2248 SFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLK 2307
            + ++ +P V +  +Y   +  K+ H +R+ ++++ ++NTL       ++E    + +++ 
Sbjct: 2287 AIEITTPKVIIDVDYKYRIDMKKPHWIRSFINIEPTYNTLLSQFASFLTEFGESVHEMVA 2346

Query: 2308 DLNKSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKF 2367
              +    + P    +   I+Y+ +L+D D+SF ++  KQ++SLSCEP AKV A+VGFE F
Sbjct: 2347 KFSPKE-QPPAPKTVSPPIDYKRILEDFDVSFSISAGKQKVSLSCEPVAKVHANVGFESF 2405

Query: 2368 AMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTY 2427
               + TND D  EPLS SL +++I  +  H FS E + S +++ +    + THPD    Y
Sbjct: 2406 VFSIITNDDDPTEPLSCSLTVNDIKTSINHEFSTEPTASFSVDFVDITTLFTHPD---IY 2462

Query: 2428 GIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVIGPTNLEKPLTSKYKK 2487
            G   I  + +YFNIKQLQ+L VF++IW L   I  +P+      +     E  ++S  K 
Sbjct: 2463 GTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLIKLRPQKS----VPVKKPESRVSSSTKS 2518

Query: 2488 VISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWXXXXXXXXXXXX 2547
              + +  PW+F VI++ I G+I LG SLG LSL  +K W  T+H+ D             
Sbjct: 2519 SSNTTIIPWSFTVIITDINGDIHLGPSLGNLSLKLKKNWISTNHFQDRRKALRFFTDSLS 2578

Query: 2548 XXXXGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIAS 2607
                GRLGG   + N  W+  +++  NE   +SPLV + + ++  AVK  FDYH+ LI  
Sbjct: 2579 LTSVGRLGGLIDVANISWILNVRYVENEKLDQSPLVDITLNVENVAVKAAFDYHMFLIGR 2638

Query: 2608 VEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKS 2667
            V  +  +L +++D  G + +LL + L  D   +  TAL  +NI D+ NTI R R+D+R S
Sbjct: 2639 VHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTALVASNILDISNTISRTRQDSRNS 2698

Query: 2668 YLETLGDSNTRDTKGXXXXXXXXXXXXXXRTELSVMLKFVHIQVYPSTLFDMEVMTFKAR 2727
            Y+ETL +SN    K               RT++ + +  + +Q+ P +LFD+EV+     
Sbjct: 2699 YIETLLESNPPPQKSSISYTDILKSLNLLRTDVGIEIHKMQVQISPISLFDVEVIVTTVE 2758

Query: 2728 DFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGT 2787
            + S  S T+  +KL T L++K++   L+LS    +L E   S+I V +Y+ +A K+ GG 
Sbjct: 2759 NVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELDEEAVSEISVDDYMIYAMKLSGGK 2818

Query: 2788 ILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALR 2847
            ILS P + +GMTTW    +  +E L++  F  KI VRWNLG +NF++E+WATH +++A+R
Sbjct: 2819 ILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVRWNLGPVNFIKEVWATHVKSLAVR 2878

Query: 2848 RSH-------------NGQSKSFFEDEHXXXXXXXXXXX----------XEYTYIPLEEP 2884
            R+               G+       E                       ++ Y+PL+EP
Sbjct: 2879 RAQLKGDKEPQLVPGIIGEPSPLVSSEELEMLRSESSNADNDNNEYSEEDKFIYVPLKEP 2938

Query: 2885 HIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARILG 2939
             IE+P+ KDL +ATPP+EWFGVNRK+FP +THQ  I+ +QK+ H+A+ E+A++LG
Sbjct: 2939 QIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAIILIQKIVHVAQKEYAKVLG 2993

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score = 1490 bits (3857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 932/2944 (31%), Positives = 1521/2944 (51%), Gaps = 187/2944 (6%)

Query: 106  KAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPS-PRATEETST 164
            K  KL   F I C G E F+YNR +A++ I+ +  +E++     F          EE S+
Sbjct: 180  KNKKLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSS 239

Query: 165  E-------------NDSA------------AQKSHLXXXXXXXXXXXXXLNDRTYQLPNS 199
            E             N+SA            A    +             +++R     + 
Sbjct: 240  EIKNCNEYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQENDSDRSNIDNRNKISAHI 299

Query: 200  MPSF-LRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQS 258
            M    L +LPL+ ++ KGA+ IGNK T S++V +F +  G LD   PD+K+D++K K+  
Sbjct: 300  MRKLHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTF 359

Query: 259  DITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFL------RVRKRYLSRGSK 312
            +I    MS++ N+ Y+ +   +   +A  L ++   Y +  L      R++  Y S   K
Sbjct: 360  EINDIDMSIKRNIGYNPELASRFNFRAGVLTRIW-SYLQLVLNLIPTGRLKTWYESLRYK 418

Query: 313  TESTRKDLRNPLERWRGLGLY---WKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIE 369
             ++T       +++W GL LY    K +     D   F+   HEYA+ S   K   ++  
Sbjct: 419  EDTTF------VKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFS 472

Query: 370  YSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQK 429
               D PG+VPHG+ P L    GPD+GN  +PP F +D+Q+  A+I++G W +  I+ ++ 
Sbjct: 473  IESDIPGIVPHGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRD 532

Query: 430  VFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETE 489
            +  PV+S+D  P  +L  G TRV +    S+ ++ DS  R+PTREPSKD DFLK+Y ET+
Sbjct: 533  LMFPVISKDQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETK 592

Query: 490  DDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETH 549
            DD R FGW++LS  +GSE  LNI M PTS GF+N L   F + E+ TSVNH++L  + + 
Sbjct: 593  DDFRAFGWIDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSL 652

Query: 550  DIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPF 609
            +I A IGYPLGWN    W F++ S Q  +F+L++HITLL D++ DF T +PTPY+LFR F
Sbjct: 653  NIAANIGYPLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSF 712

Query: 610  IYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTI 669
             Y  N ++ GYS Y NVND NI+NNP+DFNENCYLSFHGD       +P  S+A    TI
Sbjct: 713  TYNLNLKIGGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTI 772

Query: 670  DYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIEC 729
             Y ++TP+FRL +NTPSWNTL EFM++KE+GR+ DF ++G+YL +S+LD++N+D++ I+ 
Sbjct: 773  SYEIFTPMFRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDF 832

Query: 730  KSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANSEQSANSTE 789
            +S  T L C+G+V+++++  + NYFG F+ F TTEEY E +R+       N    + +T 
Sbjct: 833  ESNSTVLYCFGFVIKYMMNFQANYFGSFIKFITTEEYSELIRN-----NVNDNLGSINTN 887

Query: 790  TTTAGEGEDKQNAPKNHTTD--PVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDC 847
              T+ EG  K ++  N   D      K+  L R  NE D+W  F V DG LILP+ LY+ 
Sbjct: 888  DLTSIEGLQKMDSITNDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNG 947

Query: 848  NACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEGRCPSRANFGS 907
            ++C +  F  L I++R  NYYMD+   L    +      DP  LF   + R  S +  G+
Sbjct: 948  DSCVSLSFGELFINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSSSVEGN 1007

Query: 908  ISDLHIHAHRMFGLPPDEETYFCKWDFSMGVXXXXXXXXXXXXFGDAWSKLAFSFKDYEN 967
            ISD+ IH HRM+GLPP E TYFC+W  ++G             F  + +K+ F   + EN
Sbjct: 1008 ISDITIHGHRMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKEN 1067

Query: 968  IMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADV 1027
             + Y+   + DMT +      ++V ++D  ++    +   ++  R +DFENE+Y+ R DV
Sbjct: 1068 SLLYESDTVNDMTLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDV 1127

Query: 1028 DIHSI-----TVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPF 1082
            +         ++++  G K+   I D  + L IT F +  N + H   Q+  I  +D+P+
Sbjct: 1128 NASEFYFSLDSLKIDSGKKN---ILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPY 1184

Query: 1083 HRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEP----ITPENVTMILD---EFLKGE 1135
            HRC FLLP   Q S +Y++L GSI P  S+P +  P     T   V  ILD   EFL  +
Sbjct: 1185 HRCFFLLPEKFQESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSD 1244

Query: 1136 KNSLQMGNEHFCS------KKEEDGYAFNFASGLMSSTENDSNVESESLVVKLIKPQASI 1189
             ++    N    S      K   D    NF + L  +TE+    E+++ VV +     ++
Sbjct: 1245 HHNQMSINAELNSVDTTPLKDSFDMQITNFQNIL--TTEDP--YETDNFVVNVKYLTVTV 1300

Query: 1190 SACCIKPFRSFSDQAYSNF-VEQLIDSNEIEVV--LHFIETTLKRKQCKNVKVFSPTFEM 1246
            +   +     FS +    F +   ID  E+ +V  L  ++  +  K   N+ V     E 
Sbjct: 1301 NPDIVFTIEKFSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNV-----EK 1355

Query: 1247 TLSNFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALCV 1306
              + +G  ++      ++++  E+S       + S  ++     +D+T L K  S+ + +
Sbjct: 1356 IDAAWGHRDVCFIGTYINMLKFELS-------QESTYNNNGGLQKDLTLLGKFRSVRIII 1408

Query: 1307 SNTSRNGPLENIHEDQL--CSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCI 1364
             N S N       +D+    S  ++  E W ++   + ++ N TS D  V   +      
Sbjct: 1409 QNHSYNS----FSDDRPPGLSLMLEGFEAWSSTTTKQLTTLNLTSFDITVDEYQIHWLIP 1464

Query: 1365 FLKNTAANIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLP 1424
            ++K+       I + V +  +     Q+ F   +  A ++YQI HDP VITKPA + RL 
Sbjct: 1465 YVKSQILLFTKIQDSVKLIYDEQASYQKTFITSLIWAGEKYQIDHDPYVITKPATVLRLS 1524

Query: 1425 NQHVRENKSWKIITRLRHILNYLPPSLLAEI--YGALKSASFEAPTNAGEIFLNIFSKWR 1482
              H+REN+SW+I+T+LRHIL YLP      +     +K +  E    A   FLN+FS WR
Sbjct: 1525 AWHIRENRSWRIVTKLRHILTYLPEDWEDRLDEEDLIKRSGLEKE--AASTFLNVFSNWR 1582

Query: 1483 SWESSDVEQCYMYRKAFYSQYEGQAGPLNLRVEVDSCSATVSDSTHKEGDMIAVXXXXXX 1542
            +WE SD+E+ Y+YR  F  +   +    +++V +++   T+    +       +      
Sbjct: 1583 NWEVSDIEKSYIYRMIFVEEVSKRILQNSIKVFLETFYFTIYSRNYSADQNFLI--TKAN 1640

Query: 1543 XXXXXXSEMVGSILAIDDGTATDGNSLSCSLKAVKASISETAIKL-----LAFRELFESQ 1597
                  ++ V  +  I      +   +   + ++K   +E  +KL        +   +S+
Sbjct: 1641 ILINNEADQVNEVDLI--RKQEEIVDVVTKIGSIKFEFTEAILKLKRDIEQIIKTSVDSK 1698

Query: 1598 NSQDILSNTQVLPSGKILKLMELALLIDRCEI-----KISLDSKTANLKSFGNSISFALV 1652
            +  D LS T+          + L+ + D  +        SL S+ +N+    N +S+   
Sbjct: 1699 SEGDKLSITKFFK-------VNLSFIFDHIDFNGQFYNSSLKSRMSNV----NILSYFEN 1747

Query: 1653 DTESARDTGSSMALAWSWFEFDVRHNNAIIVDAFARRGSLGSFISQSESTTLHRVHLGSQ 1712
            + ES+  +GS +  A       ++H N I++D   R     +      +     ++    
Sbjct: 1748 NIESSTPSGSFVYYA-DRTGIALKHLNNILIDCQVRNLFASTTAELHSAVNSLMINFRCS 1806

Query: 1713 KLRLKVPSSTKDYCNFINSLSESWSSLA------------------PKLKFNTRSKDLSP 1754
             L  K    T+ + N I ++     +L+                  P +    + +   P
Sbjct: 1807 NLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEHTPSVHEKNKMQKAKP 1866

Query: 1755 EMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLL 1814
              KN   +   A   + +SEI+ L P+ +      + + +       L ++V + DL L 
Sbjct: 1867 NSKN--NITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDELLVQVLDTDLYLN 1924

Query: 1815 SEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVN 1874
            S  T +QY ++S  ++ELT  + D  EK+   +++ S++ K    DPR ++ +  QD   
Sbjct: 1925 SSHTKEQYARLSYDKLELTTFLPDLNEKLID-LEISSSILKLTTSDPRRMLFSFLQDEKE 1983

Query: 1875 AKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPL-GTTXXX 1933
             K +L  L+  L +L      +S D E    +    EW+     KY+G+L+P+  T    
Sbjct: 1984 LKNSLTFLR-SLESLNR--KANSEDSETLFSSY---EWIVNFKSKYMGVLLPIQATYYVF 2037

Query: 1934 XXXXXXXXXXXCDEAAEFSFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKV 1993
                        +E +       HG+LS   I FLI D+ +P   SK+L+F+ ++   + 
Sbjct: 2038 ELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDFSIKLSTHRT 2097

Query: 1994 AENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSGLQALKDNAGVK---------- 2043
              N  +S +IES+ FR+ L PFSLI+ +   Y+  +L  L +  D + V           
Sbjct: 2098 VNNFDRSFEIESSFFRVCLTPFSLIQTMWGYYQLLYL--LNSYYDQSTVNFFVFNDNNID 2155

Query: 2044 --SSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGK 2101
              ++ + ++ F++ ++FH   ILSY+F +GW++ +   +  GL  GY RLF+ +E  +GK
Sbjct: 2156 GATNSEKENVFSV-RSFH---ILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDNHGK 2211

Query: 2102 LTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGER 2161
            LTL+D +F +A GS+ + FY   DE  + NRS LP++QI YW +       LF++ +GE 
Sbjct: 2212 LTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFHGET 2271

Query: 2162 LDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKL--PILSSI 2219
            LDV+F    + I     RS+ LFQ LKR+ ++P    +P +   + SA + +  PI   +
Sbjct: 2272 LDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSNSALTNIKGPIFGKL 2331

Query: 2220 SHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMS 2279
              VNC+  Y GG+F+L+S   +  K  P+  ++SP V ++  Y       +KH +  L+ 
Sbjct: 2332 KQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELKKHWINCLID 2391

Query: 2280 VDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQDVDISF 2339
            ++ + N L   CVP +S+    I+ ++ +L   ++E    +N+++ IN  SLL++ DI F
Sbjct: 2392 IEPTQNVLKSGCVPFLSDFISQIKDIV-ELQDVNMEENMDNNVKDPINITSLLENFDICF 2450

Query: 2340 MMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIF 2399
             +    Q ++L CEPKAK+  DVGF  F   + T   + ++PL +SL I++I  + +H F
Sbjct: 2451 KLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKINDIKTSVKHQF 2510

Query: 2400 SREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSK 2459
            S E S S  +  L  + + THP+    +G   +  + ++FN+KQ Q++++F++IW     
Sbjct: 2511 SNEASASFEVSKLDVILIFTHPE---VFGTGLVDDVKLHFNLKQFQNISIFLDIWD---- 2563

Query: 2460 ILSQPELDNKFVIGPTNLEKPLTSKYKKVISNSS-FPWNFVVILSRIRGEIDLGISLGVL 2518
             +S+      F      L    +S   + I NSS  PW+FV I + I G+I++G +LG L
Sbjct: 2564 -VSKSTEKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNINGDINMGSTLGNL 2622

Query: 2519 SLTTEKIWAVTDHYSDWXXXXXXXXXXXXXXXXGRLGGTFLLQNFRWMSQIKWPLNEGSF 2578
            +L  ++ W  TDH+ +                 GRLGG   + +  W   + +       
Sbjct: 2623 ALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKFV 2682

Query: 2579 ESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDST 2638
             SPLV L   + + ++K+ FDYH+ LI++V+ L   + +++D   ++ +LL+V+L+ D  
Sbjct: 2683 VSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDEI 2742

Query: 2639 QVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGXXXXXXXXXXXXXXRT 2698
            +V  TAL  +NI D+YNTI+R R+DN+ SY+ETL +SN    K               +T
Sbjct: 2743 KVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNLLQT 2802

Query: 2699 ELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALST 2758
             LS  +  +++Q+ PS+L+D EV+  + +D  + ++T   +K+KT L+++V+N  L+L++
Sbjct: 2803 SLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLTS 2862

Query: 2759 YKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFG 2818
            +  +L E   +++  + YI +AS +  G I   P + I MTT+ +     ++  YS SF 
Sbjct: 2863 FGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSFD 2922

Query: 2819 GKIGVRWNLGSINFLREMWATHARAMALRRSH-NGQSKSFFEDEHXXXXXXXXXXXXEYT 2877
            GK+ V WNLG INF++E+WATH R++ +R     G      E+E             E  
Sbjct: 2923 GKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHDISLENEGDTDESVKVLSNIE-- 2980

Query: 2878 YIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARI 2937
            YI LEEP+IE+PQ KDL +ATPP+EWFG+NRK FP  THQ VIVP+QKL ++A+ E+A++
Sbjct: 2981 YIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKV 3040

Query: 2938 LGRA 2941
            LG +
Sbjct: 3041 LGSS 3044

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 70/122 (57%), Gaps = 11/122 (9%)

Query: 1   MSSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGV 60
           + +EF  V +S  + FSWVFL  W+L++  +    FY  ++ G+ +T   E+L WK   +
Sbjct: 4   LGTEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNI 63

Query: 61  KV-----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQSEKAAK 109
           KV           G +FFKN+ +I QD+T SIL  S+TWRYWLL++RK+  E  ++    
Sbjct: 64  KVTIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTS 123

Query: 110 LP 111
            P
Sbjct: 124 KP 125

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 1431 bits (3705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 857/2611 (32%), Positives = 1383/2611 (52%), Gaps = 119/2611 (4%)

Query: 396  NGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTR 455
            N  APP+ +++ Q+F A+I+YGPWAH  IM IQ++FSP+VSR          G  R +T 
Sbjct: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649

Query: 456  LRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMC 515
             +IS+ IM DS WR+PTREPSKD DFLKRY +T D +R FGW +L+ +  SE    I+  
Sbjct: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709

Query: 516  PTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQ 575
            P   G+ NKL+L F   E+R+SVNHDI   ++++ +++ IGYPLGWN +  W+F   S+Q
Sbjct: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769

Query: 576  ARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNP 635
               F L++H+ L+ D  SDF +G+PTPY+ FRP IY+ +W   GYS YLNVND NI+NNP
Sbjct: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829

Query: 636  VDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMK 695
            +DFNENCY+S HGDD  I   +P+  I    T I + + TP+FRL +NTP WNTL+EFM+
Sbjct: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRLLLNTPPWNTLNEFMR 889

Query: 696  DKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFG 755
            +KE+GR  DF+  GSY+ +S LD++N+D++ IEC +R  TL  YG+V+ +L+ V+MNYFG
Sbjct: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949

Query: 756  DFVHFKTTEEYMEELR---DAYVEPKAN-SEQSANSTETTTAGEGEDKQNAPKNHTTDPV 811
            +F HF T EEY + +R   +  V   A+ S  S  ++ +  +    +  N+ K++  DP+
Sbjct: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFSVMSETNSVSNVSNSQHNPDNSSKSNIIDPL 1009

Query: 812  M---AKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYY 868
                 +K  +KR VNE D+WFTF V +G L+LP+ LY+ + C A  F  L ID R  +YY
Sbjct: 1010 YNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYY 1069

Query: 869  MDLQAALSPVIVRNLSDCDPAHLFSGSEGRC-PSRANFGSISDLHIHAHRMFGLPPDEET 927
            +DL A L+    +     +   +F         +    GS+S++ IH HRM+G PP   +
Sbjct: 1070 LDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPS 1129

Query: 928  YFCKWDFSMGVXXXXXXXXXXXXFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAG 987
            YF  W   +              F    +K+ F F + +NI+ Y    + +MTS+  H  
Sbjct: 1130 YFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGT 1189

Query: 988  EIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQVKEGGK--DGSL 1045
             I + + D +    +++ ++ +T   ++F N+RYSSR D+ +  +     + G   D + 
Sbjct: 1190 GIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFDNGSSMDKTC 1249

Query: 1046 IGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGS 1105
            + +F + +  T F Q+K+  +HS +Q+  IA ND+ FHRCSFLL   IQ S  Y +L G 
Sbjct: 1250 LFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYGG 1309

Query: 1106 IVPGVSIPGMVEPITPENVTMILDEFLK--GEKNSLQMGNE------HFCSK--KEEDGY 1155
            I P  S+P +  P+  E +  I+D+FL   G  ++  +G+       H  +K  K     
Sbjct: 1310 ITPSSSVPPLPIPVQAETIAFIIDDFLGPFGINSTELLGSISTSTPIHSSNKPLKPPSSS 1369

Query: 1156 AFNFASGLMSSTENDSNVESESLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDS 1215
              +    + S      +V   + ++ +      I+        +F D+ YS  + + ID 
Sbjct: 1370 VIHPIESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASNFLDEFYSENIIETIDG 1429

Query: 1216 NEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDIS 1275
             E+ +V      + +     N+K+     +     FG  N    ++ +++ + +I +++S
Sbjct: 1430 IEMAIVNRLGTKSEELDSVTNIKLQIKYLDFF---FGQRN----TEGLELYVDQIDLEVS 1482

Query: 1276 MREEPSPNSSEKSTV--QDITALVKVESLALCVSNTSRNGPLENIHE-DQLCSTSIKDLE 1332
             +        +KSTV   +I  L +  SL   ++       LE+  E     S +++  E
Sbjct: 1483 QK-----TFQKKSTVVLDEIAILSRFLSLRASIN---EKKVLEDFDERPPALSLALEGWE 1534

Query: 1333 FWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKERLQKAQR 1392
             W ++   + +S N +S D  V   + E    +L      +  +   +   +++    Q+
Sbjct: 1535 GWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQK 1594

Query: 1393 DFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLL 1452
                 ++ AS+ YQI HDP VITKPAY+ R+   HVR+N+SW+I+TRLRHI  YLP    
Sbjct: 1595 KLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWE 1654

Query: 1453 AEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEGQAGP--- 1509
              +   ++       +++ +IFL +FS WR+WE SDV + Y+Y+K F S  E  +     
Sbjct: 1655 IHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQ 1714

Query: 1510 LNLRVEVDSCSATVSDSTHKEGDMI----AVXXXXXXXXXXXXSEMVGSILAIDDGTATD 1565
              +++ ++S   T+  + +     I    AV              +  SIL         
Sbjct: 1715 TTVKLNLNSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPIEKSIL--------- 1765

Query: 1566 GNSLSCSLKAVKASISETAIKLLAFRELF-ESQNSQDILSNTQVLPSGKILKLMELALLI 1624
              +++ SL ++K   S+  ++LL     F + ++ + +  N+ ++        + L LL 
Sbjct: 1766 --NMTGSLGSIKGEFSDKFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPYFTIHLFLLF 1823

Query: 1625 DRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAIIVD 1684
            +   +++++   T +       IS  L  +  +++   S A      E  ++HN  II +
Sbjct: 1824 ENGGLQLTMGDTTLSNNVTDGKISALLEKSSYSKEFSYSGAYYMKKSEMCLKHNKDIIAE 1883

Query: 1685 AFARRGSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLAPKL- 1743
                   L S    +    +  ++L S  L  K  +ST+     I  ++E    L     
Sbjct: 1884 FQLHHLGLISTGIYTPICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYD 1943

Query: 1744 --KFNTRSK--DLSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEAN 1799
              K+ T+    D  PE  NF  V    ++   ++E++ +SP  +    K L + F +  +
Sbjct: 1944 LRKYTTKPTKVDQKPEKINFD-VRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGD 2002

Query: 1800 SSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLC 1859
              + L + + D+ + S  T +QY + S   +++      +  KV   + L ++L K    
Sbjct: 2003 GEILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINCNPMSEKNKVLV-VSLSASLVKLTFS 2061

Query: 1860 DPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGAL----WPREWLWQ 1915
            +PR I  +  QD     ++ ++LK     L  +F +++ + +     +     P +W  +
Sbjct: 2062 EPRRIFASFLQDERITIESFQELK----KLKKIFFSNAKNVKKLNNDVPKEDTPTKWALE 2117

Query: 1916 LDMKYVGLLVPLGTT--XXXXXXXXXXXXXXCDEAAEFSFPLVHGELSVAGISFLINDKE 1973
            L++ Y G+L+P+ +T                 +E  E +   + G++S+  I FLIND+ 
Sbjct: 2118 LNINYFGILLPIASTFFVLELHMLLGSLTNTTEEIQEVN-NQISGQISLENILFLINDRS 2176

Query: 1974 LPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRIL--------SLAY 2025
            LP  LSK+++F+ RI   +   +S +SLQIES+HFR+   P SL+ +L         L Y
Sbjct: 2177 LPLRLSKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEY 2236

Query: 2026 EATHLSGLQ--ALKDNAGVKSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSG 2083
               H +  Q        G KSS            F SI ILSY+FC+GW+   +     G
Sbjct: 2237 YKDHKTKRQWNLSSHKTGTKSSTSESPL----NYFRSIHILSYNFCIGWMLPENQKDIPG 2292

Query: 2084 LTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYW 2143
              +GY RLF+A+EK YGKLTL++ Y  +   ++SNDF+ Q +E +R NRS LPSMQI YW
Sbjct: 2293 WMFGYDRLFSAYEKNYGKLTLIEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYW 2352

Query: 2144 FETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKR----QYLDPFKPEE 2199
             +   S+ +LF+R++G+ LDV  LS  + I     +S  +F++ ++    Q ++  K  E
Sbjct: 2353 LKEFNSKKDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHE 2412

Query: 2200 PVKRVPAGSAFSKLP-ILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDV 2258
             +K   + +A   +P  LS I+ +NC+ +Y GG  +++S+DD++  + PS +L +P V +
Sbjct: 2413 HIK---SENATEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSI 2469

Query: 2259 IFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLN---KSSVE 2315
               Y       + H LR ++ + SSHN L+  C P + E    I+++L++     K SV 
Sbjct: 2470 YLNYKHFDDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPKQSVS 2529

Query: 2316 TPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTND 2375
               T N      Y+ +L   DI+F +   KQ +S SCEP AKVQA+VG + F   + T  
Sbjct: 2530 KIATPNR----TYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGG 2585

Query: 2376 FDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTI 2435
              V +PLSL+L I+ I+ + +HIFS+E S S ++  +   F+ T P T++  G+  I  I
Sbjct: 2586 SSVEDPLSLTLCINKISTSVQHIFSKEASASFSLNFIDLTFIFTQP-TLYCVGL--ISDI 2642

Query: 2436 DVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVI---GPTNLEKPLTSKYKKVISNS 2492
            D++FN+KQ Q+L +F++IW L   I  +P    +      G T +  P T +  K+I   
Sbjct: 2643 DIFFNMKQQQNLLLFLDIWHLSESIGIRPNRKKRKHKKHKGHTQI--PETPQPGKII--- 2697

Query: 2493 SFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWXXXXXXXXXXXXXXXXG 2552
              PWNF +I + +  +I LG +LG++S   EK W ++D Y D                 G
Sbjct: 2698 --PWNFNIIFTNVNADIHLGPALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMVLKSRG 2755

Query: 2553 RLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLS 2612
            RL G   + N  W  ++ +  NE ++ SP+V + I +   A+K  FDYH+ +I+ V  + 
Sbjct: 2756 RLSGMLDISNAGWRLEVNYADNELNYNSPIVAIGIDIGCVALKTAFDYHMFMISKVNNIH 2815

Query: 2613 LSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETL 2672
              L ++RDP G + +LL  +L  +   +  T L  +NI D+YNTI+R R+D + SY ETL
Sbjct: 2816 FRLHSERDPEGKLPDLLLTTLLCEEISICSTTLVASNILDIYNTIIRTRQDTKNSYFETL 2875

Query: 2673 GDSNTRDTKGXXXXXXXXXXXXXXRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTF 2732
             +SN +DT+               RT++ + +  + +Q+ P +LFD EV+     + S  
Sbjct: 2876 MESNNQDTRTNIPYSDILKSLNLLRTDVQIDVSKLQLQISPISLFDFEVLVINIDNMSAR 2935

Query: 2733 SQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTP 2792
            S+T  + KLKT+L+L+V N  +ALST K +L E   ++I V +Y+ +ASK+ GGTIL  P
Sbjct: 2936 SETTSTDKLKTRLELQVCNASVALSTAKEELDEESVNKISVADYMTYASKIKGGTILIIP 2995

Query: 2793 AILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALR--RSH 2850
             +L+GMTTW  V +N +E  ++  F GK+ VRWNLG +NF++EMWATH +++A+R  R  
Sbjct: 2996 KLLVGMTTWQKVTSNTIEYTFTCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVRQARIE 3055

Query: 2851 NGQSKSFFEDEHXXXXXXXXXXXXEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQ 2910
                 S  E E             ++TY+ L EP IE+PQ KDL +ATPP+EWFG+NRK+
Sbjct: 3056 EPVEYSSEELESSPESIYLEPAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFGLNRKK 3115

Query: 2911 FPGLTHQGVIVPLQKLAHLAESEWARILGRA 2941
            FP  THQ  ++ +QKL H  E E+A+I+G +
Sbjct: 3116 FPSFTHQTAVIVVQKLVHAVEKEYAKIIGHS 3146

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 98/172 (56%), Gaps = 24/172 (13%)

Query: 4   EFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV- 62
           +F  V +S  + FSWVFL  W+L   + LL  FY  RV  Y++T IL++L W+ Y VK+ 
Sbjct: 6   KFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIH 65

Query: 63  ----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQSE------- 105
                      R+ FKNL +IT++ T SIL G I W+YWLL++R ++ E   +       
Sbjct: 66  CESIRLSLLSARISFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYI 125

Query: 106 ------KAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFF 151
                 K  +LPC+F  +C+G E F+YN+T A++NI+ S   +++   K+F 
Sbjct: 126 TPGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFL 177

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 97/190 (51%), Gaps = 14/190 (7%)

Query: 204 LRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDAC-APDTKIDLYKIKLQSDITK 262
           L   P    + KG++I GNK T S+++ S++  +G +D   A + ++DLYK+K++ D   
Sbjct: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357

Query: 263 FQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKD--- 319
           F++ ++PN+ Y++D   K     + L +L  K + T   +    LSR        K+   
Sbjct: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTK-FSTLFDIMPNPLSRYIHFSRLHKNSLF 416

Query: 320 LRNPL-------ERWRGLGLYWKE--NDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEY 370
           L + +       ++W+GL LY     N    ++   F+   HEYARY  ++K   ++   
Sbjct: 417 LEDNIFEDEDFEKKWKGLSLYKDAALNRGNPEEHIEFDFLNHEYARYCSIVKAPRLIFTN 476

Query: 371 SHDTPGVVPH 380
            +D PG+VP+
Sbjct: 477 EYDIPGIVPY 486

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score =  959 bits (2478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/1541 (33%), Positives = 839/1541 (54%), Gaps = 77/1541 (4%)

Query: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62
            +EF  + +   + F WVFL +W  ++ +++ + FY  R +GY +T IL ++ WKRY V +
Sbjct: 5    TEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRYKVVI 64

Query: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQSEKAAKLP 111
                       G+V+FKN+++  +DQT SIL G+ TWRYWLL+ R T L++ +       
Sbjct: 65   NIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNINDENSK 124

Query: 112  CRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPSPRATEETS----TEND 167
            CRF++EC G+E FIYN+   +++IL+ L + D+++ +KF       AT++ S     + D
Sbjct: 125  CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKF-------ATDDESIFGRVKTD 177

Query: 168  SAAQKSHLXXXXXXXXXXXXXLNDRTYQLPNSMPSFLRLLPLEYSVQKGALIIGNKKTSS 227
            S+     L             LN  + Q  +++P +L  LP E  +  GA+++GNK T S
Sbjct: 178  SSVMFDPLDESSEQSKVGQTILNSVSNQ--SAVPLYLDFLPAEVILSSGAVVVGNKHTPS 235

Query: 228  VMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANR 287
            V +  + +++G +D   P + +D YK++ + +++  ++S++PN+ + N    K      +
Sbjct: 236  VAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKKHKIDGK 295

Query: 288  LPKLLHKYYETFLRVRKRYLS-RGSKTESTRKDLRNPLERWRGLGLYWKENDPAWDDVFH 346
               L  K  +  L      L+  G+K   T ++    L  W+GL +Y       + D   
Sbjct: 296  PFNLWQKLKDCLLFTISHILAFTGNKKGLTGQE--EFLTSWKGLAMYDVATSDTFSDEIP 353

Query: 347  FELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLD 406
            F+L  HEYA+Y+ ++  + + + YS+DTPGV+      T   + G + G+    P++S+D
Sbjct: 354  FDLQNHEYAKYTTILNADRIKLLYSYDTPGVI------TETLIKGYENGDIPPSPEYSID 407

Query: 407  IQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDS 466
            +Q++ AN +YGPWAH ++    K+FSP VSRD     +   G +R     R  I+IM DS
Sbjct: 408  VQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHANFRCEIVIMEDS 467

Query: 467  IWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLD 526
            +WRIPT+EPSKD  FL +YK T D++R FGW+++ L + + + + + +  +  GF+N   
Sbjct: 468  VWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQASECGFENTFH 527

Query: 527  LHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHIT 586
             + + P I TSVNHD+L +A+ H I A+  YP  WN+   W     S    +FIL+DH  
Sbjct: 528  ANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSDLELFILRDHFN 587

Query: 587  LLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSF 646
            LL D+ +DF +GD  PY+LFRP +Y+F+W+++ YS+YLN NDANIVNNP+DFNENCY+S 
Sbjct: 588  LLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNPLDFNENCYISI 647

Query: 647  HGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFS 706
            HG+  RI  ++P ++I+  S TI Y +YTP F + + TP W+TLHEFM  + VGR+ +FS
Sbjct: 648  HGNSARIGVKLPIETISEESITISYEIYTPKFDIQLKTPPWHTLHEFMAQRFVGRSHEFS 707

Query: 707  LAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEY 766
             +GSYL ++ +D++N+DTI +ECK+   T   YG+++R+++ +K+NYFG+F  F+TTEEY
Sbjct: 708  ASGSYLSYNDVDIDNVDTINLECKTNHATFLAYGFLLRYVMNLKLNYFGEFAQFRTTEEY 767

Query: 767  MEEL---RDAYVEPKANS--EQSANSTETTTAGE-GEDKQNAPKNHTTDPVMAKKLSLKR 820
             EEL    D   +   N+  +Q+    E  + GE G D  +  K          K SLKR
Sbjct: 768  SEELAQRNDVATDIFNNNDDDQTTELVEPNSYGESGFDILHGKK--------IDKASLKR 819

Query: 821  MVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIV 880
             VNEKD+W TF  EDGC +LP++ YD  +CF   FD++  D+RY++YY DL  +++   +
Sbjct: 820  TVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSYYADLAFSMNSTYI 879

Query: 881  RNLSDCDPAHLFSGSEGRCPSRANF-GSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVX 939
            +   D     +F          +N+ G +S+ +IH HRMFGLPP EETY  K D S+G  
Sbjct: 880  KRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEETYLFKIDVSLGYL 939

Query: 940  XXXXXXXXXXXFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVD 999
                       F    +K +F F ++E++++Y++    D++ + F A +I +++N++  +
Sbjct: 940  SFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFADDISIRLNNIDTN 999

Query: 1000 YYIIVEVENVTARGVDFENERYSSRADVDIHSITVQVKEGGKDGSLIGDFSSSLKITKFC 1059
             +I + + NV+ + +DF   +YS RA++DI +    V        ++G  S+S+    F 
Sbjct: 1000 KFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSMDDHNIVLGTISTSISFAIFS 1059

Query: 1060 QLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPI 1119
            +  +F   +  Q  HI  +DAPF RCSFL P   Q SD Y+ L  SI P  SIP + EPI
Sbjct: 1060 RNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKLLYASIPPSSSIPLLPEPI 1119

Query: 1120 TPENVTMILDEFLK--------------GEKNSLQMGNEHFCSKKEEDGYAFNFASGLMS 1165
             P N   I +  L                    LQ+  + F  K  E+ ++ +    L  
Sbjct: 1120 GPNNFDTIFENLLGDIYQDYISEGTFDISNDTKLQLNIDEF-KKHSENSFSKHKTKNLTI 1178

Query: 1166 STENDSNVESESLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFI 1225
               ++ + E  S V +L      I    ++ F     Q  +  +   ID   +++V +F 
Sbjct: 1179 DIVDELH-EVRSFVFELPHINIDIHIDVLEVFADLYRQLTTFTISDTIDGLGVDIVNNFS 1237

Query: 1226 ETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREE------ 1279
            +T          KV  P  +  L  +    +          I ++ +++ +R+E      
Sbjct: 1238 KTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYFVSDINKLDLNLRLRQEYDKESA 1297

Query: 1280 -PSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCSTSIKDLEFWMTSE 1338
                NS  K +V   TAL+  + L+        N    +   +    ++ ++LE +   +
Sbjct: 1298 NSEMNSKNKLSVYYKTALINGKMLS------KENFIYPSESSEFSYKSTFEELEGYAFYD 1351

Query: 1339 DIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKERLQKAQRDFFYRI 1398
            D   +  N      +++ + ++    F+K      +T  + V++ K   +  +R+   RI
Sbjct: 1352 DDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVTISKNFNKSMKRELLIRI 1411

Query: 1399 STASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGA 1458
            + A  +Y I HDPPVITKPA ITRL   HVRE++SW+I+TRLRH+LNYLP          
Sbjct: 1412 AQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLRHVLNYLPQYWYETTSLE 1471

Query: 1459 LKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAF 1499
            L+   F +  +A   FL+IF++WRSWE +DVE+C++Y+K +
Sbjct: 1472 LQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTY 1512

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/1168 (38%), Positives = 686/1168 (58%), Gaps = 38/1168 (3%)

Query: 1790 LTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQL 1849
            + V F +   SSL L  ++  ++LLS    + Y+K S S ++L        + +  ++ L
Sbjct: 1798 INVDFGRILQSSLSL--QDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGNTDNLG-RISL 1854

Query: 1850 ESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWP 1909
            +S+ +K  + +P++ +     D+  A +N+E L+  +L   +     +   E     L P
Sbjct: 1855 DSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRSTMLETKS----STVQNEFPFSRLIP 1910

Query: 1910 REWLWQLDMKYVGLLVPLGTTXXXXXXXXXXXXXXCDEAAEFSF-PLVHGELSVAGISFL 1968
             +    L+++Y+GLL+  GTT               D+ +     P    + S   I FL
Sbjct: 1911 IQL--NLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFSSDYSSESICFL 1968

Query: 1969 INDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEAT 2028
            I D+ + E LSKVL+F+ RIK+ + +  +++SLQIES++    L P SL+R+LS   E  
Sbjct: 1969 IKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVRLLSFVNE-- 2026

Query: 2029 HLSGLQALKDNAGVKSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGY 2088
              S ++++  +   +S+        +  +  S  ILSY+ C+GW+F+    +N GL WGY
Sbjct: 2027 -FSIMKSIYHDIKPRSTSSNSTLSILPISIKSAHILSYNLCIGWLFDLGYNANEGLIWGY 2085

Query: 2089 QRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNG 2148
            +RLFA ++KPYGKLTLLDAYF +A G +S+ +Y   +E    NRS LPSMQI YW E   
Sbjct: 2086 ERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLPSMQINYWLEEEN 2145

Query: 2149 SEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGS 2208
               +LF+R+NGE LDVS L+    I     +SLH F++LK   LDP K        P   
Sbjct: 2146 GTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILDPLKV---TSNDPILG 2202

Query: 2209 AFSKL--PILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKML 2266
             ++ L  P+ SS+  +NC + YAG   KLYS DDI+  T  SF++ SP+  V  +Y    
Sbjct: 2203 EWNYLDNPLASSVRSINCIINYAGSSMKLYSRDDIQHGTC-SFEIRSPAHTVTIDYKYYP 2261

Query: 2267 TGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKD-LNKSSVETPRTSNMQEG 2325
            + K+ H +R L +V+++HNTLFP CVP+++EM L    +LK+  ++ S   P  ++ +  
Sbjct: 2262 SKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNSCSQFSNGAPNLASAKAE 2321

Query: 2326 INYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLS 2385
            INYR LL+  DI+ ++N+ KQ+ISL+CEP AK+QA +GFEKF +K+FTN     EPL LS
Sbjct: 2322 INYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKFDIKIFTNSMVPDEPLCLS 2381

Query: 2386 LDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQ 2445
            +D+HN+ A+SRH+FSRE+S+SL+++ +S VF LTH + IHTYG   I     YFN+KQ++
Sbjct: 2382 VDLHNLMASSRHVFSREISSSLSLQQISMVFSLTHSEYIHTYGSTLISKPLFYFNVKQIE 2441

Query: 2446 DLNVFINIWKLDSKILSQPELDNKFVIGPTNLEK----PLTSKYKKVISNSSFPWNFVVI 2501
            DLN+F+ IW ++ +     +  N  ++ P         P   K ++V  N++F W++++I
Sbjct: 2442 DLNLFLEIWSIEKQ-----KSVNDIILAPVTASSFESVPSMPKLQRVPINATFSWDYLLI 2496

Query: 2502 LSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWXXXXXXXXXXXXXXXXGRLGGTFLLQ 2561
            +S I  EIDLG SLG++ + ++ +W ++ H  DW                GRLGG   ++
Sbjct: 2497 ISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEICMSSSGRLGGYVFIK 2556

Query: 2562 NFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDP 2621
            +  W S+I WP+       PLV L++ L     KL+FDYH+  I++++  ++ LFN++D 
Sbjct: 2557 DIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFISTIQNAAIELFNQQDE 2616

Query: 2622 RGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTK 2681
            RG + +LLSVS+S D+ QVF+T+LA AN+FD+Y+TI RMR D+ ++ L+ L +SN     
Sbjct: 2617 RGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGRTNLDLL-ESNELKKI 2675

Query: 2682 GXXXXXXXXXXXXXXRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSK-- 2739
                           RTELSV  + +++ ++ +TL   EV+  + R     ++ E S   
Sbjct: 2676 SSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLRTRKVIANTKNEASSKT 2735

Query: 2740 ----KLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAIL 2795
                K++T+L  ++ ++ L+LS++K QL E    +I V +Y++ AS + GG IL  P+I 
Sbjct: 2736 TSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKLASIIHGGIILEAPSIF 2795

Query: 2796 IGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNGQSK 2855
            + M TW    +N +ELLYS+SFG  + + WNL  INF+++MW+ H  AM LR    G S 
Sbjct: 2796 VTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHINAMKLRHMQKGNSS 2855

Query: 2856 SFF--EDEHXXXXXXXXXXXXEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPG 2913
                 +DE             +Y Y PLEEP+IE+P+ KDLG+ATPPVEWFG+NR +FPG
Sbjct: 2856 EIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLGDATPPVEWFGLNRSRFPG 2915

Query: 2914 LTHQGVIVPLQKLAHLAESEWARILGRA 2941
            LTHQ V+VPLQKL+ +AE E+ RILG+ 
Sbjct: 2916 LTHQIVVVPLQKLSAVAEKEYVRILGKV 2943

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/1522 (33%), Positives = 800/1522 (52%), Gaps = 134/1522 (8%)

Query: 32   LLSAFYFGRVLGYTITTILEYLAWKRYGVKV-----------GRVFFKNLTVITQDQTYS 80
            + + FY GRVLGY ++     + WK+Y V V           G+V FKN++V +QDQ  S
Sbjct: 3    IFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLIS 62

Query: 81   ILHGSITWRYWLLSSRKTSLESQSEKAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLP 140
            +L G+ITWRYWL+   + S  +   +     CRF ++ +G E+F+YNR   +D I   L 
Sbjct: 63   VLKGTITWRYWLIGRYRRSGTADGARR----CRFALKFEGFEYFVYNRNGVYDRIARELD 118

Query: 141  REDQENVKKFFSDPSPRATEETSTENDSAAQKSHLXXXXXXXXXXXXXLNDRTYQLPNSM 200
             ED  + +   S PS    EE   E                       L D         
Sbjct: 119  GEDT-SAEPTVSVPS---VEEVIAE-----------------------LQDD-------- 143

Query: 201  PSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDI 260
            P   R LP+E+   KGA+++GNK+T SV + ++EKL G +    PD        + ++ I
Sbjct: 144  PLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEAKI 203

Query: 261  TKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKDL 320
            +   ++++PN+ Y+ D P+K   +  R  +L  KY      V +  L    K E  +   
Sbjct: 204  SNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEATLHAKRKKE--QHQT 261

Query: 321  RNPLERWRGLGLYWKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVV-- 378
                + WRGL +Y    D   D+   F++  HEYA+ + V+K + M + YS+  PG    
Sbjct: 262  PKWYDNWRGLSMYDVNLDEELDEEVKFDIEHHEYAKCTTVLKADQMDVTYSYGMPGTARV 321

Query: 379  ---PHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVV 435
                +   P LE    P++       D S+DI V+ AN  YGPWA+ ++    +VFSP V
Sbjct: 322  TDSDNAENPLLE---RPEL-------DHSVDILVYDANCTYGPWANRQVQQCLRVFSPTV 371

Query: 436  SRD---SHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDT 492
             R+     P E         F   ++S+ IM DS+ R+P +E SKD  FL++YK+T D+T
Sbjct: 372  CRNFKLRTPEEIAQQTEPAAF---KLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDET 428

Query: 493  RPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIE 552
            RPFGW+++ +A+ S + + +A  PT  GF+N L  + +   I TSVNHD LL A++HDI 
Sbjct: 429  RPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDIT 488

Query: 553  AQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYE 612
                YP GW  KA+WNF++ S QA +F+L+DH+ L+ D+++DF  G+   Y+ FRPF Y 
Sbjct: 489  VDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYR 548

Query: 613  FNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYN 672
            F W++ GYS YLNVNDANI+NNP+DF ENCYLS HGDD  I+F +P  SI     T+D+N
Sbjct: 549  FRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFN 608

Query: 673  LYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSR 732
            ++TP F L +N P W+T  E +  KE+GR+ +F++ GSY  +S++DV+N+D + I C++ 
Sbjct: 609  IFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETD 668

Query: 733  MTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEEL-RDAYVEPKA----NSEQSANS 787
               + CYG +++ ++ VK+NYFG+ VHF+TTEEY+EEL R     P      NS+ + + 
Sbjct: 669  YIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHD 728

Query: 788  TETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDC 847
            ++   A E  +  +A  +    P   KK +LKR +NE DVWFTFI + GC   P+N+Y  
Sbjct: 729  SD-VVATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKF 787

Query: 848  NACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEG-RCPSRANFG 906
            +AC  F FD+L+  LR++NYY+D   +L  +  +  +D D   LF   E    P  A+  
Sbjct: 788  DACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDA 847

Query: 907  SISDLHIHAHRMFGLPPDEETYFCKWDFSMGVXXXXXXXXXXXXFGDAWSKLAFSFKDYE 966
             +S      H+M G+ P EE+Y C++D  +              F +    LAF FKD E
Sbjct: 848  YLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVE 907

Query: 967  NIMNYKIVPILDMTSIIFHAGEIRVKINDVAV--DYYIIVEVENVTARGVDFENERYSSR 1024
            N + Y+   + D+  I      + VK+ +V    D ++ + +   T    D  NERYS R
Sbjct: 908  NSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLANERYSRR 967

Query: 1025 ADVDIHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHR 1084
            +D+ I  +   +  G  + + +G FS+ + +T F + + F    + Q+ HI  NDAPFHR
Sbjct: 968  SDLSIPELLFGIYRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHR 1027

Query: 1085 CSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNE 1144
            CSF+LP   ++   YR L G I P  S+P   EPI+ +N  +I ++ L GE         
Sbjct: 1028 CSFMLPPEYKKMPIYRSLYGCIPPSSSLPLFPEPISADNFEVIFEKLL-GE--------- 1077

Query: 1145 HFCSKKEEDGYAFNFASGLMSSTENDSNVE--------SESLVVKLIKPQASISACCIK- 1195
                ++     ++      +SSTE+D + +        S SL ++    Q ++S+  ++ 
Sbjct: 1078 --IYQEYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLSSFIVEF 1135

Query: 1196 -PFRSFSDQAYSNF------------VEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSP 1242
             P   + D + + F            +++ IDS EI ++  FI+T  +      V+V  P
Sbjct: 1136 DPIDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEVRVLCP 1195

Query: 1243 TFEMTLSN----FGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVK 1298
               ++ +N    F    +S     +DI  +  S D +++ +P     EK+T+       K
Sbjct: 1196 NISLSATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDP-----EKTTL-----CYK 1245

Query: 1299 VESLALCVSNTSRNGPLENIHE-DQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSD 1357
            ++ +    +N  ++G +    +  QL S SI+ LE +++ + +     N  S    +   
Sbjct: 1246 IDYIR---ANIVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPG 1302

Query: 1358 KTELCCIFLKNTAANIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKP 1417
              +L   FL    +  D +   +S  ++ L  ++R+F   I     +Y+I HDPPVITKP
Sbjct: 1303 TDKLLFEFLNPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKP 1362

Query: 1418 AYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNI 1477
            A ITR  N+H+R  +SW+II RLRHILNYLP          L +  F +P  AG+ FL+I
Sbjct: 1363 ANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSI 1422

Query: 1478 FSKWRSWESSDVEQCYMYRKAF 1499
            FS WRSWE +DV+  +++ K F
Sbjct: 1423 FSDWRSWEPTDVQGSFVHEKVF 1444

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/1204 (34%), Positives = 634/1204 (52%), Gaps = 45/1204 (3%)

Query: 1762 VAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQ 1821
            V F+  V + T ++  LSP  I    +   +Q E   +    L      +++ S      
Sbjct: 1704 VLFQGQVANITLKLQILSPFIILYCAENFELQAESTDSVIFDLNSGESYMEISSAKQKLD 1763

Query: 1822 YLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQ 1881
            Y K + + ++L+        ++   +  +  + K  + D +  I  L QD+  A  +++ 
Sbjct: 1764 YFKYTHTCLKLSGT--SSSARLFEHISCDIGILKLSVFDLKTRITDLLQDIKAALFSMKS 1821

Query: 1882 LKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTXXXXXXXXXXX 1941
            L   +L +     T S     F+  + P      L   Y GLL+  G T           
Sbjct: 1822 LS-DILNISQSSPTASAFGSWFS--ILPDNL--SLQATYAGLLLGFGHTLYILEFNNFEA 1876

Query: 1942 XXXCD--EAAEFSFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMK 1999
                D    A    P    + S+   SFLI D+ + + L+KV++FA    +    +  ++
Sbjct: 1877 KHTRDGLPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQ 1936

Query: 2000 SLQIESTHFRIALCPFSLIRILSLAYEATHLSGL---QALKDNAGVKSSDDAKDFFNISQ 2056
            S+QIESTH +I L P +++R+LSL  E   +      +++   +   ++  A +    S 
Sbjct: 1937 SVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIYTPSSAHNNSTATECLEPSV 1996

Query: 2057 ---TFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIAR 2113
                  S  ILS+DF + W+F+   +S  GL  GY RLF+ +EKPYGKLTLL+AYF  A+
Sbjct: 1997 WRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAK 2056

Query: 2114 GSTSN-DFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIG 2172
               S  DFY       R N S L  MQ+ YWF  +    +LF+RI+G +L V   ++ + 
Sbjct: 2057 ILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAEIVT 2116

Query: 2173 IAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKLP------ILSSISHVNCKV 2226
            +     +S+  F  LK+  +DPF+ ++        S  SK P      + + +  +NC +
Sbjct: 2117 LLEETIQSIQTFNNLKKALVDPFRTKK------QDSDISKEPYNWNNQLATGVRSLNCII 2170

Query: 2227 RYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNT 2286
             YAG   KL+S D   R      +L SPS  V  +Y      ++ H  R L++   +HNT
Sbjct: 2171 NYAGVTLKLHSHD--GRGDASPLELTSPSYKVAIDYKYFPNLEKTHRFRTLITATPTHNT 2228

Query: 2287 LFPTCVPIISEMALDIRQLLKDL---NKSSVETPRTSNMQEGINYRSLLQDVDISFMMNI 2343
             + T   +I ++     +LLK     NKSS  +  +S   EG +  +LL  +D+  ++N+
Sbjct: 2229 FYSTSAFLIHDLCYRFSKLLKTSSTENKSSSASTSSSIKVEGSDNSTLLGSIDLVIILNV 2288

Query: 2344 DKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREV 2403
             KQ+++ SCEPKAKVQA VGFEKF +K+F N+ +  E L L+++I N+   SRHI+SREV
Sbjct: 2289 GKQEVTFSCEPKAKVQATVGFEKFDIKIFNNNINDEESLCLAIEIENLMTNSRHIYSREV 2348

Query: 2404 STSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIW---KLDSKI 2460
              SL +  +S VF +        YG   I +   YFN+KQLQDL +FI+ W   K     
Sbjct: 2349 CASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQWFPQKTPMNT 2408

Query: 2461 LSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSL 2520
             S PE      +   ++ + + SK+ K  S+SSF W + VI++    EI+LG SLGVL++
Sbjct: 2409 GSYPE-----GVLVDDISRSIGSKFYKGSSSSSFTWGYSVIVAGSCAEIELGPSLGVLNV 2463

Query: 2521 TTEKIWAVTDHYSDWXXXXXXXXXXXXXXXXGRLGGTFLLQNFRWMSQIKWPLNEGSFES 2580
            T+E +WA++    DW                GRLGG FL++N     ++KWP  +  F+ 
Sbjct: 2464 TSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQV 2523

Query: 2581 PLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQV 2640
            PLV + +  D    KL+FDYH   I+S+++   SLFN+RD  G + +LLSV++S +S  +
Sbjct: 2524 PLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFESVNI 2583

Query: 2641 FLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGXXXXXXXXXXXXXXRTEL 2700
            FLTALA ANI D+ N+I R++KDN  SYL +   S+ + +                RT+L
Sbjct: 2584 FLTALAAANISDIKNSITRLKKDNELSYLSSFLASD-QPSDEPEEDGGIFDTLSLLRTQL 2642

Query: 2701 SVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYK 2760
            S+ L    +Q+ P++LFD +V+   A      +  +   K+KT L  ++ +V LAL  + 
Sbjct: 2643 SLNLGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLPFN 2702

Query: 2761 SQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGK 2820
            + L E   + + V +YIE +S + GG I S P+I++ MTTW +  +N +ELLYS SFGG 
Sbjct: 2703 NSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGT 2762

Query: 2821 IGVRWNLGSINFLREMWATHARAMALRRSHN---GQSKSFFEDEHXXXXXXXXXXXXEYT 2877
            + +RWNLG I+F+++MW  H  AM LR  +     +S       +            +Y 
Sbjct: 2763 VKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHLGSDYQ 2822

Query: 2878 YIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARI 2937
            Y+PL+EP IE+P+ KDLG+ATPP+EWFGVNR +FPG THQ VIVPLQKLA  AE E+ +I
Sbjct: 2823 YLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYEKI 2882

Query: 2938 LGRA 2941
            LGRA
Sbjct: 2883 LGRA 2886

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/1573 (32%), Positives = 780/1573 (49%), Gaps = 140/1573 (8%)

Query: 2    SSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVK 61
            SS FR + IS  +D S  FL DW+L + + +L+ FY GR+L + +T  L++  W++Y +K
Sbjct: 4    SSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQYKIK 63

Query: 62   V-----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQSEKA--- 107
            +           GR+FFKNLTV++ D T S L GS TWRYWLL +R   ++ +SE     
Sbjct: 64   INLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDGDAS 123

Query: 108  --AKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPSPRATEETSTE 165
              AKLPCRF ++C GLE F+YN+   ++++L    R+   NV K        + ++ +  
Sbjct: 124  ENAKLPCRFLLQCDGLEVFVYNKIDVYESVL----RDHFTNVTK--DGQETESNDDITIN 177

Query: 166  NDSAAQKSHLXXXXXXXXXXXXXLNDRTYQLPNSMPSFLRLLPLEYSVQKGALIIGNKKT 225
             + AA  S L               D        + +  +L P++    + A+++GN+ T
Sbjct: 178  TEKAAANSKLSNSSRYSYSGRSKSTDAP-----KLSAKTKLFPIQLEANRAAIVLGNRNT 232

Query: 226  SSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKA 285
              V V  FE+ KG  D  +  + +D Y+ K+  D+      LR NL Y ND P+K     
Sbjct: 233  RHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTFVVE 292

Query: 286  NRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKDLRNPLERWRGLGLYWKENDPAWDDVF 345
              + K+     +  + + K  L    KT + ++     ++ W+GL LY        ++V 
Sbjct: 293  KTMDKIWQTVKKQCISISKLLLPNQGKTINNQQAY---IDSWKGLDLYHHTKAVQEENVD 349

Query: 346  HFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGA---PPD 402
               L + EYARYS+VMK E + + Y  D PG+VP  +       D  +  N       P 
Sbjct: 350  TTVLHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLNCNQDDDTPA 409

Query: 403  FSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMI 462
            F  DI ++ A ++YGPWAH  +  I ++FSP+VSRD     +   GS R++   ++S+  
Sbjct: 410  FGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENFKLSVDF 469

Query: 463  MSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFD 522
               S+  IPTRE SKD +F+KRYK T D  R FGWL +SL EG E+  N+A+C  +    
Sbjct: 470  RDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCSQADRLP 529

Query: 523  NKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILK 582
            N+L +  + PEI++SVNH++L    T  I+A IGYP GWN +A W F+L S  A +F+L+
Sbjct: 530  NELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTAELFLLR 589

Query: 583  DHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENC 642
            DHI+L+ D+ +DF   D   Y+LFRPF YE  W  T Y ++LNVNDANI+NN +D NENC
Sbjct: 590  DHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFLNVNDANIINNLLDLNENC 649

Query: 643  YLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRA 702
            +LS  GD L  S  +P  SI        + L +PL +L+++ P WNTLHEF+ +   G  
Sbjct: 650  FLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSETTFGEC 709

Query: 703  CDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKT 762
             DFS+ G+Y+    +DV+N DTI+I+ +S  T    +G+V+R+L+ +K+NYFGDF HFKT
Sbjct: 710  PDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGDFNHFKT 769

Query: 763  TEEYMEEL---RDAYVEPKANSEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSLK 819
            TEEY  +L    D   + K   EQ  N  E+ T+   +         T +     K SL 
Sbjct: 770  TEEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSSDGSYQVAD--TINENTIHKSSLL 827

Query: 820  RMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVI 879
            R  NE DVW TF V DGC+I+P+NLYDC   F   F  L+ D+RY NY+MDL A  S + 
Sbjct: 828  RTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDLTAFFSRIY 887

Query: 880  VRNLSDCDPAHLFSGSEGRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVX 939
            + + ++     + +  E       N G + DL++H HRMFG+PP EETY CKWD S+G  
Sbjct: 888  LNHSNEFSFNRVVAIEESHS---ENTGYLDDLNLHGHRMFGVPPVEETYLCKWDISIGSL 944

Query: 940  XXXXXXXXXXXFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIR--VKINDVA 997
                       F +A  K+ F++KD ENI+ Y I    D+TS+    G +   V+ N   
Sbjct: 945  STDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDVTSLTISIGRVSSIVRTNHGG 1004

Query: 998  VDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQVKEGGKDGSLIGDFSSSLKITK 1057
                  + + ++T    D  N RYS R D+ + +I+V   +  K      D  +++++TK
Sbjct: 1005 S---ATLSLNDITINSWDLSNSRYSKRVDLLVAAISVCAIDEKKTVLFTCD--TAVELTK 1059

Query: 1058 FCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPL-AIQRSDNYRKLLGSIVPGVSIPGMV 1116
            F    N   H + Q++ +  ND+PFHRC FLL    +  S  Y  LLGSI P +S+P + 
Sbjct: 1060 FVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHSTLYDDLLGSITPSISLPTLS 1119

Query: 1117 EPITPENVTMILDEFLKGEKNSLQMGNEHFCSKKEEDGYAFNFASGLMSSTENDSNVESE 1176
            EP+T +    I +  L    N +    +   +K   D    +    L+  +   SN  S 
Sbjct: 1120 EPLTFQTFDNIYERLLGSYINLINFDTDIIDTKNLTDDRPDD--KRLLPLSNTVSNDLSG 1177

Query: 1177 SLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKN 1236
             L  +      +++   +  F +     ++      + +   E ++ + E  +       
Sbjct: 1178 QLAEEFESENTTVNISTLSVFVTPKAFTFAENAAHFMLTMSTESIMDYFEMNI------- 1230

Query: 1237 VKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITAL 1296
            V +FS         F S           +++K + V+IS             T  D T L
Sbjct: 1231 VNIFSVGHITNGKFFNS----------SVMLKNVKVNIS-----------DETALDKTQL 1269

Query: 1297 VKVESLALCVSNTS-------------RNGPLENIHEDQLCSTSIKDLEFWMTSEDIRKS 1343
              ++ L L VSN S             ++     I +D   S +   L+F     +I KS
Sbjct: 1270 EALDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQF-----NIFKS 1324

Query: 1344 S------------FNATSIDTWVHSDKTELC-CIFLKNTAANIDTITEVVSVHKERLQKA 1390
            S            F     +T + SD  ++   IF    +A +D   E    +  +L KA
Sbjct: 1325 SKNRLTKVLPIAWFEILMFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLLKLAKA 1384

Query: 1391 ------------------QRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENK 1432
                               ++   R++       I   P +ITKPAYITRL   HVR+  
Sbjct: 1385 FCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHVRDTA 1444

Query: 1433 SWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEI------FLNIFSKWRSWES 1486
            SWKIITRLRH+  +   S ++E      S   + P     I      FL+IF  W++W+ 
Sbjct: 1445 SWKIITRLRHVSKH--TSHVSET----TSQCDDIPEEVRNICKDKSQFLDIFVDWKNWDV 1498

Query: 1487 SDVEQCYMYRKAF 1499
             +VEQ  ++   F
Sbjct: 1499 YEVEQSSLFTLLF 1511

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/1186 (35%), Positives = 642/1186 (54%), Gaps = 61/1186 (5%)

Query: 1774 EISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELT 1833
            + SA  P  I     GL   F+  +  S+ +      LD        + L++S S     
Sbjct: 1773 QTSAFVPFIIRILISGLDFNFKNLSGISIIVNYTELLLDFY--FNQLKLLRISNS----V 1826

Query: 1834 AKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALF 1893
             K+  +   + + + L++ + K  L D R  IE LT  L      L  +KI        F
Sbjct: 1827 TKVDYRSNTLLTDIGLDTDIVKLTLSDNRVYIEELTDSLNGTVSEL--IKI--------F 1876

Query: 1894 GTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTXXXXXXXXXXXXXXCDEAAEFSF 1953
               + D E  A    P  +  +++  Y+GLL  L TT              C   AE + 
Sbjct: 1877 KNKNADNEPAAPKFKPCSF--KMNAIYIGLLTDLKTTNYVLEFNETAFS--CASRAE-AL 1931

Query: 1954 PLVHGE-------LSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIEST 2006
               H         L +  +  L+ + E+   LSK+ +  F +KL  + ++  K+LQIE+ 
Sbjct: 1932 EETHANDNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKL--IEDDIKKTLQIETP 1989

Query: 2007 HFRIALCPFSLIRILSLAYEATHLSGLQALKDNAGVKSSDDAKDFFNISQTFHSIQILSY 2066
            H R+ L P +LI ++    EA     LQ +K      SS +A +     +T  S+ ILS 
Sbjct: 1990 HSRVMLAPSTLIAVIFFIQEAK--VSLQKVKQKGKFNSSSNAIEIPPYFETL-SVNILSN 2046

Query: 2067 DFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDE 2126
              CLGWIF  D   N G+  GY+ LFAA+EKPYGKLT++D Y   A+G  SN+F+   + 
Sbjct: 2047 KLCLGWIFEEDTDEN-GIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFF-ANG 2104

Query: 2127 VDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQE 2186
            V   NRS L SMQI +WF     E +LFVR+N ++LDV  L+ S+ I      S+  FQ+
Sbjct: 2105 VPELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQK 2164

Query: 2187 LKRQYLDPFKPEEPVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKT- 2245
             K   +   K         A +   K+ ILS I  +NC  +Y GG+  LY+ DDI + + 
Sbjct: 2165 -KLAKISNIKKSSISTHNVAENLSDKVSILS-IRSINCIAKYGGGIINLYTPDDIAQDSP 2222

Query: 2246 GPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQL 2305
              S +L SPS++V  +Y      +++H +R+L++V+S+HN LF +CVP++  +  +I++ 
Sbjct: 2223 KSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCVPVLVNLTTEIQKQ 2282

Query: 2306 LKDLNKSSVE-----TPRTSNMQE-GINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQ 2359
            ++  N    +       +T+N Q    +Y++L + +D + ++N+  Q I+L+CEP+AK+Q
Sbjct: 2283 MERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCEPRAKIQ 2342

Query: 2360 ADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLT 2419
            AD+GF  F + +FT+  D  EPLSLSL    I  ++RHIFSRE+S+S  I  +   FMLT
Sbjct: 2343 ADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGINEVYLDFMLT 2402

Query: 2420 HPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIW----KLDSKILSQPELDNKFVIGPT 2475
            H +TI TYG   I  +  Y N+KQLQ++ +F++IW    K   K+ S P    K    P 
Sbjct: 2403 HENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTKKAQKLGSGPHSGQK--CQPQ 2460

Query: 2476 NLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDW 2535
             L +  T K          PW + +I       ID+  SLG ++      W  + H  DW
Sbjct: 2461 ALTEFTTPK---------IPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVDW 2511

Query: 2536 XXXXXXXXXXXXXXXXGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVK 2595
                            GRLGG F ++N  + S I WP+ +  FE+PL+ L   +   + K
Sbjct: 2512 SHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSSK 2571

Query: 2596 LTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYN 2655
            + FDYH  LIA V  L L++ N+RD  G++++LL VS+S  S  +FLTALA AN++D+Y 
Sbjct: 2572 IGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIYA 2631

Query: 2656 TILRMRKDNRKSYLETLGDSNTRDTKGXXXXXXXXXXXXXXRTELSVMLKFVHIQVYPST 2715
            T  RMR +N+KSY++TL +SN   +                RT L+  +    + V+PST
Sbjct: 2632 TFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPLRLRTNLTAEIGSFRLYVFPST 2691

Query: 2716 LFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKE 2775
            LFD EV+  KA   +  + T+  +K KT L  ++ ++ ++L+ +K++L E   +++ V+E
Sbjct: 2692 LFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSVEE 2751

Query: 2776 YIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLRE 2835
            Y   A+ ++G  IL+ P++ +G+TTW  +    +E LYS+SFG K+ ++WNL  INF+RE
Sbjct: 2752 YNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIRE 2811

Query: 2836 MWATHARAMALRRSHN--GQSKSFFEDEHXXXXXXXXXXXXEYTYIPLEEPHIEIPQTKD 2893
            MWATH RA+++RR H     SK FFEDE+            +Y YIPLEEPHIE+P  +D
Sbjct: 2812 MWATHVRALSVRRGHTEPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIEMPLLRD 2871

Query: 2894 LGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARILG 2939
            LG ATPP+EWFGVNRK+FPG+ HQ ++VPLQKL ++AE ++ R LG
Sbjct: 2872 LGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLG 2917

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score =  131 bits (329), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 62/62 (100%), Positives = 62/62 (100%)

Query: 1  MSSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGV 60
          MSSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGV
Sbjct: 1  MSSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGV 60

Query: 61 KV 62
          KV
Sbjct: 61 KV 62

>Smik_6.427 Chr6 complement(692098..694164) [2067 bp, 688 aa] {ON}
            YPL222W (REAL)
          Length = 688

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 56/105 (53%), Gaps = 9/105 (8%)

Query: 2416 FMLTHPDTIHTYGIANIPTIDVYFNIKQL-QDLNVFINIWKLDSKILSQPELDNKFVIGP 2474
            F   H DT + Y  AN P+I +++N++Q  +DL   + +   D ++L + ELD  FV   
Sbjct: 362  FTPNHDDTANRYSFANQPSI-IWWNLQQFAKDLACLLGLKSHDLELLLKGELD--FV--D 416

Query: 2475 TNLEKPLTSKYKKVI--SNSSFPWNFVVILSRIRGEIDLGISLGV 2517
              LEK +  + +K++  S + + + F    +R+  +  LG+ L +
Sbjct: 417  DTLEKTMIKRVQKLVELSANEYKYVFTTRYARLMSQ-RLGVDLDL 460

>Suva_16.81 Chr16 (135391..135831) [441 bp, 146 aa] {ON} YPL225W
            (REAL)
          Length = 146

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 1200 FSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNV-KVFSPTFEMTLS--NFGS 1253
            F D+ Y NF+E+  +  +IE +  F +  LK K+ K   + F   FE T+   NFG+
Sbjct: 47   FDDEIYENFIERFPEYKDIERIKKFTDEELKTKEAKERWRKFFTIFEKTVEDYNFGT 103

>Smik_6.430 Chr6 complement(697895..698335) [441 bp, 146 aa] {ON}
            YPL225W (REAL)
          Length = 146

 Score = 33.9 bits (76), Expect = 2.2,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 1200 FSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNV-KVFSPTFEMTLS--NFGS 1253
            F D+ Y NF+E+  +  ++E V  F E  LK K+ K   + F   FE  +   NFG+
Sbjct: 47   FDDEIYENFIERFPEYKDVERVKKFTEEELKTKEAKERWRKFFTIFEKKIEDYNFGT 103

>TBLA0J01710 Chr10 (377791..379797) [2007 bp, 668 aa] {ON} Anc_7.134
           YIL005W
          Length = 668

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 52/105 (49%), Gaps = 12/105 (11%)

Query: 528 HFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITL 587
            FI   I  S+ +      + HDI  Q    LG+ +  K  F  K HQ ++ ++  +   
Sbjct: 217 EFISSNINISIGY--FDCGQDHDICKQ----LGFTSLVKNTFIRKEHQPKVIMVLPNNKQ 270

Query: 588 LGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIV 632
           + +   DF T DPTPY  F   IY+ N++L     +++V+D +++
Sbjct: 271 IINFNEDF-TLDPTPYKEFAKRIYQ-NYQLP----FISVDDVDLI 309

>YPL225W Chr16 (126006..126446) [441 bp, 146 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the cytoplasm
          Length = 146

 Score = 33.1 bits (74), Expect = 3.9,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 1200 FSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNV-KVFSPTFEMTLS--NFGS 1253
            F D+ Y NF+E+  +  ++E V  F E  LK K+ K   + F   FE  +   NFG+
Sbjct: 47   FDDEIYENFMERFPEYKDVERVKKFTEEELKTKEAKERWRKFFTIFEKKIEDYNFGT 103

>Skud_16.53 Chr16 (99521..99961) [441 bp, 146 aa] {ON} YPL225W (REAL)
          Length = 146

 Score = 32.7 bits (73), Expect = 6.9,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 1200 FSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNV-KVFSPTFEMTLS--NFGS 1253
            F D+ Y NF+E+  +  ++E V  F +  LK K+ K   + F   FE  +   NFG+
Sbjct: 47   FDDEIYENFIERFPEYKDVERVKKFTDGELKTKEAKERWRKFFTIFEKKIEDYNFGT 103

>SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa]
           {ON} similar to uniprot|P53280 Saccharomyces cerevisiae
           YGR134W CAF130 Part of the evolutionarily-conserved
           CCR4- NOT transcriptional regulatory complex involved in
           controlling mRNA initiation elongation and degradation
          Length = 1132

 Score = 33.9 bits (76), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%)

Query: 570 DLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFN 614
           DL+SH A M  L   +  L D+LSD   GD    D+   F YEF+
Sbjct: 556 DLRSHAATMLALGIELETLTDLLSDLQPGDRFDEDVKYMFDYEFD 600

>Kpol_1004.44 s1004 (91177..93090) [1914 bp, 637 aa] {ON}
           (91177..93090) [1914 nt, 638 aa]
          Length = 637

 Score = 33.9 bits (76), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 9/77 (11%)

Query: 677 LFRLNMNTPSWNTLHEFMKDKEVG---RACDFSLAGSYLFHSKLDVENIDTIIIECKS-- 731
           LF + ++   ++    F+ +K V    + CD  L  ++LF SKL++E ++ II  CKS  
Sbjct: 501 LFGIRLSPVEYSLRESFVDNKRVDELIKKCDVLLVNNFLFDSKLNLE-VEKIIQNCKSGC 559

Query: 732 ---RMTTLKCYGYVVRF 745
               + +L+   Y + F
Sbjct: 560 KIISLKSLRPLTYTIDF 576

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 305,000,773
Number of extensions: 13545853
Number of successful extensions: 38291
Number of sequences better than 10.0: 70
Number of HSP's gapped: 38696
Number of HSP's successfully gapped: 92
Length of query: 2941
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 2813
Effective length of database: 38,804,151
Effective search space: 109156076763
Effective search space used: 109156076763
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)