Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.246547.354ON50745323240.0
KLTH0H01166g7.354ON50745322680.0
Kpol_530.277.354ON50845621600.0
SAKL0F11462g7.354ON49843521240.0
KLLA0D12254g7.354ON51345621150.0
Skud_12.2627.354ON50546021020.0
ZYRO0F11792g7.354ON51345121000.0
TPHA0F030107.354ON50945720990.0
Smik_12.2577.354ON50845920970.0
Ecym_47197.354ON51346020930.0
ACL144C7.354ON54946020950.0
YLR197W (NOP56)7.354ON50444720830.0
Suva_10.2937.354ON50544020820.0
CAGL0A04015g7.354ON50845020700.0
KAFR0L015107.354ON50045520660.0
NDAI0A018807.354ON50345620650.0
TDEL0C019407.354ON51043620640.0
NCAS0A141707.354ON51043520570.0
TBLA0E020807.354ON51343920340.0
KNAG0B025907.354ON49946220240.0
KLTH0H15334g8.787ON5114108241e-104
KNAG0J006508.787ON5244138181e-103
KNAG0G031908.787ON5234108161e-102
ZYRO0F12518g8.787ON5194198111e-102
TBLA0B028308.787ON5174108081e-101
Smik_15.4918.787ON5164138011e-100
KAFR0D015808.787ON5014147991e-100
Skud_15.4788.787ON5124138001e-100
YOR310C (NOP58)8.787ON5114137991e-100
Kpol_1010.58.787ON5144557991e-100
Suva_8.3618.787ON5054137971e-100
KAFR0B035408.787ON4994137941e-99
SAKL0B05874g8.787ON5134107908e-99
TPHA0G011608.787ON5144137908e-99
TDEL0B011108.787ON5044107882e-98
TPHA0I006508.787ON5404137902e-98
NDAI0E005508.787ON5234137874e-98
KLLA0F08613g8.787ON5114137821e-97
NCAS0B008708.787ON5154157742e-96
AFR328C8.787ON5134117725e-96
Kwal_34.158948.787ON5124107707e-96
Ecym_14898.787ON5144137691e-95
CAGL0I09790g8.787ON5134137445e-92
TPHA0D039303.429ON4712341928e-15
KNAG0B011403.429ON4922121873e-14
ZYRO0C12386g3.429ON4442291783e-13
NDAI0G012903.429ON4961991785e-13
TDEL0F031103.429ON4342471731e-12
TBLA0C023203.429ON5112801704e-12
KAFR0K015303.429ON5062211679e-12
Kwal_23.39953.429ON4742151679e-12
YGR091W (PRP31)3.429ON4941991652e-11
Skud_7.3903.429ON4952191571e-10
NCAS0E011603.429ON4792831562e-10
Kpol_1018.1383.429ON4932391553e-10
Suva_7.3743.429ON5131991518e-10
ADR032W3.429ON4392031455e-09
Smik_6.1773.429ON4822091446e-09
Ecym_44493.429ON4622101341e-07
KLLA0D14883g3.429ON4672201278e-07
SAKL0F06050g3.429ON4732211222e-06
KLTH0F12034g3.429ON5242831233e-06
CAGL0G03025g3.429ON4792581152e-05
Kwal_26.87518.668ON84834723.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.24654
         (507 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.24654 s56 complement(1090443..1091966) [1524 bp, 507 aa]...   899   0.0  
KLTH0H01166g Chr8 (116579..118102) [1524 bp, 507 aa] {ON} highly...   878   0.0  
Kpol_530.27 s530 (71285..72811) [1527 bp, 508 aa] {ON} (71285..7...   836   0.0  
SAKL0F11462g Chr6 complement(889390..890886) [1497 bp, 498 aa] {...   822   0.0  
KLLA0D12254g Chr4 (1045077..1046618) [1542 bp, 513 aa] {ON} high...   819   0.0  
Skud_12.262 Chr12 (492745..494262) [1518 bp, 505 aa] {ON} YLR197...   814   0.0  
ZYRO0F11792g Chr6 complement(962314..963855) [1542 bp, 513 aa] {...   813   0.0  
TPHA0F03010 Chr6 complement(658541..660070) [1530 bp, 509 aa] {O...   813   0.0  
Smik_12.257 Chr12 (493092..494618) [1527 bp, 508 aa] {ON} YLR197...   812   0.0  
Ecym_4719 Chr4 (1410528..1412069) [1542 bp, 513 aa] {ON} similar...   810   0.0  
ACL144C Chr3 complement(94809..96458) [1650 bp, 549 aa] {ON} Syn...   811   0.0  
YLR197W Chr12 (546097..547611) [1515 bp, 504 aa] {ON}  NOP56Esse...   806   0.0  
Suva_10.293 Chr10 (518873..520390) [1518 bp, 505 aa] {ON} YLR197...   806   0.0  
CAGL0A04015g Chr1 complement(402070..403596) [1527 bp, 508 aa] {...   801   0.0  
KAFR0L01510 Chr12 complement(276894..278396) [1503 bp, 500 aa] {...   800   0.0  
NDAI0A01880 Chr1 (422978..424489) [1512 bp, 503 aa] {ON} Anc_7.354    800   0.0  
TDEL0C01940 Chr3 (340658..342190) [1533 bp, 510 aa] {ON} Anc_7.3...   799   0.0  
NCAS0A14170 Chr1 complement(2783782..2785314) [1533 bp, 510 aa] ...   796   0.0  
TBLA0E02080 Chr5 complement(505617..507158) [1542 bp, 513 aa] {O...   788   0.0  
KNAG0B02590 Chr2 (503498..504997) [1500 bp, 499 aa] {ON} Anc_7.3...   784   0.0  
KLTH0H15334g Chr8 complement(1329504..1331039) [1536 bp, 511 aa]...   322   e-104
KNAG0J00650 Chr10 (110685..112259) [1575 bp, 524 aa] {ON} Anc_8....   319   e-103
KNAG0G03190 Chr7 complement(687362..688933) [1572 bp, 523 aa] {O...   318   e-102
ZYRO0F12518g Chr6 complement(1017206..1018765) [1560 bp, 519 aa]...   317   e-102
TBLA0B02830 Chr2 (653081..654634) [1554 bp, 517 aa] {ON} Anc_8.7...   315   e-101
Smik_15.491 Chr15 complement(846605..848155) [1551 bp, 516 aa] {...   313   e-100
KAFR0D01580 Chr4 complement(313631..315136) [1506 bp, 501 aa] {O...   312   e-100
Skud_15.478 Chr15 complement(836937..837160,837194..838505) [153...   312   e-100
YOR310C Chr15 complement(896825..898360) [1536 bp, 511 aa] {ON} ...   312   e-100
Kpol_1010.5 s1010 (13325..14869) [1545 bp, 514 aa] {ON} (13325.....   312   e-100
Suva_8.361 Chr8 complement(637602..637804,637835..639149) [1518 ...   311   e-100
KAFR0B03540 Chr2 complement(735790..737289) [1500 bp, 499 aa] {O...   310   1e-99
SAKL0B05874g Chr2 complement(499332..500873) [1542 bp, 513 aa] {...   308   8e-99
TPHA0G01160 Chr7 (234712..236256) [1545 bp, 514 aa] {ON} Anc_8.7...   308   8e-99
TDEL0B01110 Chr2 (204471..205985) [1515 bp, 504 aa] {ON} Anc_8.7...   308   2e-98
TPHA0I00650 Chr9 (135050..136672) [1623 bp, 540 aa] {ON} Anc_8.7...   308   2e-98
NDAI0E00550 Chr5 (108986..110557) [1572 bp, 523 aa] {ON} Anc_8.787    307   4e-98
KLLA0F08613g Chr6 complement(801623..803158) [1536 bp, 511 aa] {...   305   1e-97
NCAS0B00870 Chr2 complement(133660..135207) [1548 bp, 515 aa] {O...   302   2e-96
AFR328C Chr6 complement(1032025..1033566) [1542 bp, 513 aa] {ON}...   301   5e-96
Kwal_34.15894 s34 (102368..103906) [1539 bp, 512 aa] {ON} YOR310...   301   7e-96
Ecym_1489 Chr1 complement(1006523..1008067) [1545 bp, 514 aa] {O...   300   1e-95
CAGL0I09790g Chr9 complement(935016..936557) [1542 bp, 513 aa] {...   291   5e-92
TPHA0D03930 Chr4 (823320..824735) [1416 bp, 471 aa] {ON} Anc_3.4...    79   8e-15
KNAG0B01140 Chr2 complement(210529..212007) [1479 bp, 492 aa] {O...    77   3e-14
ZYRO0C12386g Chr3 (978158..979492) [1335 bp, 444 aa] {ON} simila...    73   3e-13
NDAI0G01290 Chr7 complement(284145..285635) [1491 bp, 496 aa] {O...    73   5e-13
TDEL0F03110 Chr6 (568933..570237) [1305 bp, 434 aa] {ON} Anc_3.4...    71   1e-12
TBLA0C02320 Chr3 complement(549057..550592) [1536 bp, 511 aa] {O...    70   4e-12
KAFR0K01530 Chr11 (319205..320725) [1521 bp, 506 aa] {ON} Anc_3....    69   9e-12
Kwal_23.3995 s23 complement(517426..518850) [1425 bp, 474 aa] {O...    69   9e-12
YGR091W Chr7 (666341..667825) [1485 bp, 494 aa] {ON}  PRP31Splic...    68   2e-11
Skud_7.390 Chr7 (650643..652130) [1488 bp, 495 aa] {ON} YGR091W ...    65   1e-10
NCAS0E01160 Chr5 complement(219669..221108) [1440 bp, 479 aa] {O...    65   2e-10
Kpol_1018.138 s1018 complement(368322..369803) [1482 bp, 493 aa]...    64   3e-10
Suva_7.374 Chr7 (641967..643508) [1542 bp, 513 aa] {ON} YGR091W ...    63   8e-10
ADR032W Chr4 (763161..764480) [1320 bp, 439 aa] {ON} Syntenic ho...    60   5e-09
Smik_6.177 Chr6 (289760..291208) [1449 bp, 482 aa] {ON} YGR091W ...    60   6e-09
Ecym_4449 Chr4 complement(919492..920880) [1389 bp, 462 aa] {ON}...    56   1e-07
KLLA0D14883g Chr4 (1254381..1255784) [1404 bp, 467 aa] {ON} weak...    54   8e-07
SAKL0F06050g Chr6 (454404..455825) [1422 bp, 473 aa] {ON} simila...    52   2e-06
KLTH0F12034g Chr6 complement(1015072..1016646) [1575 bp, 524 aa]...    52   3e-06
CAGL0G03025g Chr7 (280230..281669) [1440 bp, 479 aa] {ON} simila...    49   2e-05
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    32   3.6  

>Kwal_56.24654 s56 complement(1090443..1091966) [1524 bp, 507 aa]
           {ON} YLR197W (SIK1) - homology to microtubule binding
           proteins and to X90565_5.cds [contig 161] FULL
          Length = 507

 Score =  899 bits (2324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/453 (97%), Positives = 440/453 (97%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
           QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN
Sbjct: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLH             ERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQQGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
           DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP
Sbjct: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420
           GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT
Sbjct: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420

Query: 421 LKNELAIQEAIELYNKDKPEEPVKESKKRKLEG 453
           LKNELAIQEAIELYNKDKPEEPVKESKKRKLEG
Sbjct: 421 LKNELAIQEAIELYNKDKPEEPVKESKKRKLEG 453

>KLTH0H01166g Chr8 (116579..118102) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12460 Saccharomyces cerevisiae
           YLR197W SIK1 Component of the small (ribosomal) subunit
           (SSU) processosome that contains U3 snoRNA
          Length = 507

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/453 (93%), Positives = 438/453 (96%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
           QALENANDISEGLVS+YLKAVLDMNLPKGS+KKTVTLAISDKNLGPSIKE FPY+DCMSN
Sbjct: 61  QALENANDISEGLVSEYLKAVLDMNLPKGSNKKTVTLAISDKNLGPSIKEVFPYIDCMSN 120

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLH             ERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQQGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVLFIKDKASL+EDSLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIKDKASLTEDSLHDLTAIL 240

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
           D+DAGIAERVIDNARISMGQDLSETDM+NVCVFAERVTSLADYRRQLY+YLCSKMHTVAP
Sbjct: 241 DDDAGIAERVIDNARISMGQDLSETDMENVCVFAERVTSLADYRRQLYDYLCSKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420
           GFIGKA+AKNKGRISRYLANKCSIASRIDNYSDEP+NVFGTVLKKQVEQRLEFYSTG+PT
Sbjct: 361 GFIGKASAKNKGRISRYLANKCSIASRIDNYSDEPSNVFGTVLKKQVEQRLEFYSTGAPT 420

Query: 421 LKNELAIQEAIELYNKDKPEEPVKESKKRKLEG 453
           LKNELAIQEAIELYNKDKPEEPVKESKKRKLE 
Sbjct: 421 LKNELAIQEAIELYNKDKPEEPVKESKKRKLEA 453

>Kpol_530.27 s530 (71285..72811) [1527 bp, 508 aa] {ON}
           (71285..72811) [1527 nt, 509 aa]
          Length = 508

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/456 (89%), Positives = 426/456 (93%), Gaps = 5/456 (1%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRL+EVQ QINEFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
           +ALENANDISEGLVSD LKAVLD+NLPKGS KK+V +AISDKNLGPSIKE FPYVDC+SN
Sbjct: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLH             ERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASL+EDSLHDLSAIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
           DNDAG+AERVIDNARISMGQDLSETDMDNVC+FA+RV SLADYR+QLY+YLC KMHTVAP
Sbjct: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420
           GFI KA+AKNKGRISRYLANKCS+ASRIDNYSDEPT+VFG VLKKQVEQRLEFY+TG+PT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420

Query: 421 LKNELAIQEAIELYNKDKP--EEPV---KESKKRKL 451
           LKNE+AI EA+ELYNKDKP  EEPV   K SKKRKL
Sbjct: 421 LKNEVAIHEAMELYNKDKPATEEPVESSKPSKKRKL 456

>SAKL0F11462g Chr6 complement(889390..890886) [1497 bp, 498 aa] {ON}
           highly similar to uniprot|Q12460 Saccharomyces
           cerevisiae YLR197W SIK1 Component of the small
           (ribosomal) subunit (SSU) processosome that contains U3
           snoRNA
          Length = 498

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/435 (91%), Positives = 415/435 (95%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQ QIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
           QALENANDISEGLVS++LKA+LD+NLPKGS+K TVTLAISDKNLGPSIKE FPYVDC+SN
Sbjct: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLH             ERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASL E+SLHDL++IL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
           ++DAGIAERVIDNARISMGQDLSETDM+NVC+FAERV SLADYRRQLY+YLC KMHTVAP
Sbjct: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420
           GFI KA+AKNKGRISRYLANKCS+ASRIDNYSDEPTNVFG+VLKKQVEQRLEFYSTG+PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420

Query: 421 LKNELAIQEAIELYN 435
           LKNELAIQEAIELYN
Sbjct: 421 LKNELAIQEAIELYN 435

>KLLA0D12254g Chr4 (1045077..1046618) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|Q12460 Saccharomyces cerevisiae
           YLR197W SIK1 Component of the small (ribosomal) subunit
           (SSU) processosome that contains U3 snoRNA
          Length = 513

 Score =  819 bits (2115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/456 (87%), Positives = 425/456 (93%), Gaps = 5/456 (1%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQ QIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
           QALENANDISEGLVS++LKA+LD+NLPKGSSKKTVTLAISDKNLGPSIKE FP+VDC+SN
Sbjct: 61  QALENANDISEGLVSEHLKALLDLNLPKGSSKKTVTLAISDKNLGPSIKEVFPFVDCISN 120

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLH             ERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQPGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVLFIKDKASL+E+SLHDLS IL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIKDKASLNEESLHDLSEIL 240

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
           DNDAGI+ERVIDNARISMGQDLSETDM+NV +FA+RV SL +YR+QLY+YLC KMHTVAP
Sbjct: 241 DNDAGISERVIDNARISMGQDLSETDMENVTIFAKRVVSLVEYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISH+GSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHSGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420
           GFI KA+AKNKGRISRYLANKCS+ASRIDNYSDEP+NVFG VLKKQVEQRLEFY++G+PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGQVLKKQVEQRLEFYASGTPT 420

Query: 421 LKNELAIQEAIELYNKDKP--EEPVKE---SKKRKL 451
           LKNE AI+EAIELYNKDKP  EE V     SKKRKL
Sbjct: 421 LKNESAIKEAIELYNKDKPAHEEEVDTTEVSKKRKL 456

>Skud_12.262 Chr12 (492745..494262) [1518 bp, 505 aa] {ON} YLR197W
           (REAL)
          Length = 505

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/460 (86%), Positives = 426/460 (92%), Gaps = 7/460 (1%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRLKEVQ QIN+FG+FTKLVEL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLVELASFAPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKK-TVTLAISDKNLGPSIKEAFPYVDCMS 119
           +ALENANDISEGLVS+ LKA+LD+NLPK SSKK  +TLAISDKNLGPSIKE FPYVDC+S
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEDFPYVDCIS 120

Query: 120 NELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NELAQDLIRGVRLH             ERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAI 239
           LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASL++DSLHDL+A+
Sbjct: 181 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYAFAKLVLFIKDKASLNDDSLHDLAAL 240

Query: 240 LDNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVA 299
           L+ D+GIA+RVIDNARISMGQD+SETDM+NVCVFA+RV SLADYRRQLY+YLC KMHTVA
Sbjct: 241 LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSP 419
           SGFI KA+AKNKGRISRYLANKCS+ASRIDNYSDEP+NVFG+VLKKQVEQRLEFY+TG+P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGSVLKKQVEQRLEFYNTGTP 420

Query: 420 TLKNELAIQEAIELYNKDKPE---EPVKE---SKKRKLEG 453
           T+KNELAIQEA+ELYNKDKP    E +KE   SKKRKLEG
Sbjct: 421 TMKNELAIQEAMELYNKDKPAADGEEIKEKETSKKRKLEG 460

>ZYRO0F11792g Chr6 complement(962314..963855) [1542 bp, 513 aa] {ON}
           highly similar to uniprot|Q12460 Saccharomyces
           cerevisiae YLR197W SIK1 Component of the small
           (ribosomal) subunit (SSU) processosome that contains U3
           snoRNA
          Length = 513

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/451 (86%), Positives = 420/451 (93%), Gaps = 1/451 (0%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY IFKVKLQQD+IGSRL+EVQ QIN+FGSFTKL+ELVSF+PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
           +ALENANDISEGL+S+ LKAVLD+NLPKGS K++VTL ISDKNLGPSIKE FPYVDC SN
Sbjct: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL+QDLIRGVRLH             ERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDK SLSEDSLHDL+A+L
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEDSLHDLAALL 240

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
           ++DA IAERV+DNARISMGQDLS  DM+NVC+FA+RV +LADYRRQLY+YLC KMHTVAP
Sbjct: 241 NDDAAIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420
           GFI KAAAKNKGRISRYLANKC++ASRIDNYSDEPTN+FGTVLKKQVEQRLEFY+TG PT
Sbjct: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420

Query: 421 LKNELAIQEAIELYNKDKP-EEPVKESKKRK 450
           LKNELAIQEAIELYN++KP EEP +ESKKRK
Sbjct: 421 LKNELAIQEAIELYNENKPEEEPKQESKKRK 451

>TPHA0F03010 Chr6 complement(658541..660070) [1530 bp, 509 aa] {ON}
           Anc_7.354 YLR197W
          Length = 509

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/457 (85%), Positives = 422/457 (92%), Gaps = 5/457 (1%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLL+EEPTGY IFKVKLQQDDIGSRL EVQ QIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLYEEPTGYAIFKVKLQQDDIGSRLGEVQQQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
           +ALENANDISEGLVS+ LKA+LD+NLPKGS KK+V L ISDKNLGPSIKE FPYVDCM+N
Sbjct: 61  EALENANDISEGLVSENLKALLDLNLPKGSEKKSVVLGISDKNLGPSIKEDFPYVDCMAN 120

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDL+RG+RLH             +RAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLLRGIRLHGEKLFKDLQTGDLDRAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASL+++SLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYSFARLVLFIKDKASLNDESLHDLTAIL 240

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
           ++DAGI++RVIDNARISMGQDLSETDMDN+CVFA+RV SL +YRRQLY+YLC KMHTVAP
Sbjct: 241 NDDAGISQRVIDNARISMGQDLSETDMDNICVFAKRVVSLVEYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420
           GFI KAAAKNKGRISRYLANKCS+ASRIDNYSDEPTNVFG+VLKKQVEQRLEFY+TGSPT
Sbjct: 361 GFIAKAAAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYATGSPT 420

Query: 421 LKNELAIQEAIELYNKDKPE-----EPVKESKKRKLE 452
           LKNELAIQEA++LYNKD P+     E  K SKKRKLE
Sbjct: 421 LKNELAIQEAMKLYNKDAPKSEDAAEETKSSKKRKLE 457

>Smik_12.257 Chr12 (493092..494618) [1527 bp, 508 aa] {ON} YLR197W
           (REAL)
          Length = 508

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/459 (86%), Positives = 422/459 (91%), Gaps = 7/459 (1%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRLKEVQ QIN+FG+FTKLVEL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLVELASFAPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSK-KTVTLAISDKNLGPSIKEAFPYVDCMS 119
           +ALENANDISEGLVS+ LKA+LD+NLPK SSK K VTLAISDKNLGPSIKE FPYVDC+S
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKASSKNKNVTLAISDKNLGPSIKEEFPYVDCIS 120

Query: 120 NELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NELAQDLIRGVRLH             ERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAI 239
           LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASL++DSLHDL+A+
Sbjct: 181 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAAL 240

Query: 240 LDNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVA 299
           L+ D+GIA+RVIDNARISMGQD+SETDM+NVCVFA+RV SLADYRRQLY+YLC KMHTVA
Sbjct: 241 LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSP 419
           SGFI KA+AKNKGRISRYLANKCS+ASRIDNYSDEP+NVFG+VLKKQVEQRLEFY+TG P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGSVLKKQVEQRLEFYNTGKP 420

Query: 420 TLKNELAIQEAIELYNKDKPEEPVKE------SKKRKLE 452
           TLKNELAIQEA+ELYNKDKP    KE      SKKRKLE
Sbjct: 421 TLKNELAIQEAMELYNKDKPAADDKETEEKESSKKRKLE 459

>Ecym_4719 Chr4 (1410528..1412069) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ACL144C
          Length = 513

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/460 (85%), Positives = 422/460 (91%), Gaps = 8/460 (1%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQ QIN+FGSFTKLVEL SF PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELASFVPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
           QALEN NDISEGL+S++LKAVLD+NLPKGSSKK V LAISDKNLGPSIKE FPYVDC+++
Sbjct: 61  QALENCNDISEGLLSEHLKAVLDLNLPKGSSKKAVVLAISDKNLGPSIKEEFPYVDCIAS 120

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLH             ERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGSKLLKDLQPGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVL I+DK SL++DSLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLHIRDKTSLTDDSLHDLAAIL 240

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
           D+DAGIAERVI NARISMGQDLSE DMDNVCVFAERV +L DYR+QLY+YLC+KMHTVAP
Sbjct: 241 DDDAGIAERVISNARISMGQDLSEVDMDNVCVFAERVANLVDYRKQLYDYLCAKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420
           GFI KA+AKNKGRISRYLANKCSIASRIDNY+D+PTN FG VLKKQVEQRLEFY+TG+PT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSIASRIDNYADDPTNAFGQVLKKQVEQRLEFYATGTPT 420

Query: 421 LKNELAIQEAIELYNKDKPEEPVKE--------SKKRKLE 452
           LKNE+AIQEAI+L+NK++P+E V+E        SKKRKLE
Sbjct: 421 LKNEVAIQEAIDLFNKNRPQEEVEEHQESPKEKSKKRKLE 460

>ACL144C Chr3 complement(94809..96458) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR197W
           (SIK1)
          Length = 549

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/460 (85%), Positives = 422/460 (91%), Gaps = 8/460 (1%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQ QIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
            ALENANDISEGL+S++LKAVLD+NLPKGS+KK+V LA+SDKNLGPSIKE FPYVDC+SN
Sbjct: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDL+RGVRLH             ERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVLFI+DKASL+++SLHDLSAIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
             DAGIAERVI NARISMGQDLSE DM+NV VFAERV +L +YRRQLYEYLC KMHTVAP
Sbjct: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420
           GFI KA+AKNKGRISRYLANKCS+ASRIDNYSD+PTNVFG VLKKQVEQRLEFY+TGSPT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420

Query: 421 LKNELAIQEAIELYNKDKPEEPVK--------ESKKRKLE 452
           LKNE+AIQEAI L+NKDKP+E  +        +SKKRKL+
Sbjct: 421 LKNEIAIQEAIALFNKDKPQEASEAAEGATKSKSKKRKLD 460

>YLR197W Chr12 (546097..547611) [1515 bp, 504 aa] {ON}
           NOP56Essential evolutionarily-conserved nucleolar
           protein component of the box C/D snoRNP complexes that
           direct 2'-O-methylation of pre-rRNA during its
           maturation; overexpression causes spindle orientation
           defects
          Length = 504

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/447 (86%), Positives = 418/447 (93%), Gaps = 1/447 (0%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRLKEVQ QIN+FG+FTKL+ELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKK-TVTLAISDKNLGPSIKEAFPYVDCMS 119
           +ALENANDISEGLVS+ LKA+LD+NLPK SSKK  +TLAISDKNLGPSIKE FPYVDC+S
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEEFPYVDCIS 120

Query: 120 NELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NELAQDLIRGVRLH             ERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAI 239
           LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASL++DSLHDL+A+
Sbjct: 181 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAAL 240

Query: 240 LDNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVA 299
           L+ D+GIA+RVIDNARISMGQD+SETDM+NVCVFA+RV SLADYRRQLY+YLC KMHTVA
Sbjct: 241 LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSP 419
           SGFI KA+AKNKGRISRYLANKCS+ASRIDNYS+EP+NVFG+VLKKQVEQRLEFY+TG P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSEEPSNVFGSVLKKQVEQRLEFYNTGKP 420

Query: 420 TLKNELAIQEAIELYNKDKPEEPVKES 446
           TLKNELAIQEA+ELYNKDKP   V+E+
Sbjct: 421 TLKNELAIQEAMELYNKDKPAAEVEET 447

>Suva_10.293 Chr10 (518873..520390) [1518 bp, 505 aa] {ON} YLR197W
           (REAL)
          Length = 505

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/440 (87%), Positives = 414/440 (94%), Gaps = 1/440 (0%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRLKEVQ QIN+FG+FTKL+EL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKK-TVTLAISDKNLGPSIKEAFPYVDCMS 119
           +ALENANDISEGLVS+ LKA+LD+NLPK SSKK  +TLAISDKNLGPSIKE FPYVDC+S
Sbjct: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120

Query: 120 NELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NELAQDLIRGVRLH             ERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAI 239
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASL+EDSLHDL+A+
Sbjct: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240

Query: 240 LDNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVA 299
           L++D+GIA+RVIDNARISMGQDLSETDM+NVC+FA+RV SLADYRRQLY+YLC KMHTVA
Sbjct: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSP 419
           SGFI KA+AKNKGRISRYLANKCS+ASRIDNYSDEP+NVFGTVLKKQVEQRLEFY+TG P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420

Query: 420 TLKNELAIQEAIELYNKDKP 439
           TLKNELAIQEA+ELYNKDKP
Sbjct: 421 TLKNELAIQEAMELYNKDKP 440

>CAGL0A04015g Chr1 complement(402070..403596) [1527 bp, 508 aa] {ON}
           similar to uniprot|Q12460 Saccharomyces cerevisiae
           YLR197w SIK1 involved in pre-rRNA processing
          Length = 508

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/450 (85%), Positives = 417/450 (92%), Gaps = 2/450 (0%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAAQAL 63
           IEYLLFEEPTGY +FKVKL QD+IGS+LKEVQ QIN+FG FTKLVELVSFAPFKGAA+AL
Sbjct: 3   IEYLLFEEPTGYAVFKVKLNQDNIGSKLKEVQEQINDFGGFTKLVELVSFAPFKGAAEAL 62

Query: 64  ENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSNELA 123
           ENANDISEGLVS+ LK VL++NLPKGS+K TVTLAISDKNLGPSIKEAFPYVDC++NELA
Sbjct: 63  ENANDISEGLVSESLKNVLELNLPKGSAKSTVTLAISDKNLGPSIKEAFPYVDCIANELA 122

Query: 124 QDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
           QDLIRGVRLH             ERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL
Sbjct: 123 QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 182

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDND 243
           DKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASL+E+SLHDL+A+++ D
Sbjct: 183 DKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNEESLHDLAAVVNED 242

Query: 244 AGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAPNLS 303
           AGIAER+IDNARISMGQDLSETDM+NVCVFA+RV SL DYR+QLY+YLC KMHTVAPNLS
Sbjct: 243 AGIAERIIDNARISMGQDLSETDMENVCVFAQRVVSLVDYRKQLYDYLCEKMHTVAPNLS 302

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
            LIGEVIGARLISHAGSLT+LSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI
Sbjct: 303 GLIGEVIGARLISHAGSLTSLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 362

Query: 364 GKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPTLKN 423
            KA+AKNKGRISRYLANKCS+ASRIDNYSDEPTNVFG+VLKKQVEQRLEFY+TG PTLKN
Sbjct: 363 AKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYATGKPTLKN 422

Query: 424 ELAIQEAIELYNKDKP--EEPVKESKKRKL 451
           ELAI EA+EL+NKDKP  EEP  +SKKRKL
Sbjct: 423 ELAIHEAMELFNKDKPVSEEPKADSKKRKL 452

>KAFR0L01510 Chr12 complement(276894..278396) [1503 bp, 500 aa] {ON}
           Anc_7.354 YLR197W
          Length = 500

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/455 (85%), Positives = 412/455 (90%), Gaps = 3/455 (0%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDI SRL EVQ QINEFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIASRLAEVQQQINEFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
            ALENANDISEGL+SD LK++L++NLPK S  KTVTL ISDKNLGPSIKE FPYVDC+SN
Sbjct: 61  DALENANDISEGLLSDSLKSILELNLPKASKSKTVTLGISDKNLGPSIKEQFPYVDCISN 120

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDL+RGVR H             ERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL+
Sbjct: 121 ELAQDLLRGVRQHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALV 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASL+++SLH+L+  L
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDESLHELAGHL 240

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
           + DAGIA+RVIDNARISMGQDLSE DM NVCVFAERV SL DYRR LY+YLC KMHTVAP
Sbjct: 241 NEDAGIAQRVIDNARISMGQDLSEIDMQNVCVFAERVVSLVDYRRGLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420
           GFI KA+AKNKGRISRYLANKCSIASRIDNYSDEP+NVFG+VLKKQVEQRLEFY+ G PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSIASRIDNYSDEPSNVFGSVLKKQVEQRLEFYNIGKPT 420

Query: 421 LKNELAIQEAIELYNKDKPEEPVKE---SKKRKLE 452
           LKNELAIQEA+ELYNKDKPEE  KE   SKKRKLE
Sbjct: 421 LKNELAIQEAMELYNKDKPEEEQKEEISSKKRKLE 455

>NDAI0A01880 Chr1 (422978..424489) [1512 bp, 503 aa] {ON} Anc_7.354
          Length = 503

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/456 (86%), Positives = 422/456 (92%), Gaps = 4/456 (0%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY IFKVKLQQDDIGSRLKEVQ QIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAIFKVKLQQDDIGSRLKEVQEQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
           +ALENAND+SEGLVS+ LKA+LD+NLPKGS  KTVTLAISDKNLGPSIKE FPYVDC++N
Sbjct: 61  EALENANDVSEGLVSESLKAILDLNLPKGSKGKTVTLAISDKNLGPSIKEEFPYVDCLAN 120

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLH             ERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASL+++SLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAAIL 240

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
            +DAGIA+RVIDNARISMGQD+SETDM+NV +FA+RV SL +YR+QL++YLC KMHTVAP
Sbjct: 241 GDDAGIAQRVIDNARISMGQDISETDMENVSIFAQRVVSLVEYRKQLFDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420
           GFI KA+AKNKGRISRYLANKCS+ASRIDNYSDEPTNVFG+VLKKQVEQRLEFY+TG PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYNTGKPT 420

Query: 421 LKNELAIQEAIELYNKDKPEEPVK----ESKKRKLE 452
           LKNELAIQEA++LYNK+KPE   K     SKKRKLE
Sbjct: 421 LKNELAIQEAMDLYNKEKPETEEKEDKVSSKKRKLE 456

>TDEL0C01940 Chr3 (340658..342190) [1533 bp, 510 aa] {ON} Anc_7.354
           YLR197W
          Length = 510

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/436 (88%), Positives = 409/436 (93%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           MAPI+YLLFEEPTGY IFKVKLQQD+IGSRL EVQ QIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIQYLLFEEPTGYAIFKVKLQQDNIGSRLGEVQEQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
           +ALENANDISEGLVS+ LKA+LD+NLPKGS K+TVTL ISD+NLGPSIKE FPYVD +SN
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKGSKKETVTLGISDRNLGPSIKEEFPYVDSVSN 120

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLH             ERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLF+KDKASL+++SLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFVKDKASLNDESLHDLAAIL 240

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
           ++DA IA+RVIDNARISMGQDLSETDM+NVCVFAERV SLADYRRQLYEYLC KMHTVAP
Sbjct: 241 NDDAAIAQRVIDNARISMGQDLSETDMENVCVFAERVASLADYRRQLYEYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420
           GFI KAA KNKGRISRYLANKCS+ASRIDNYSDEPTNVFGTVL+KQVEQRLEFYSTG PT
Sbjct: 361 GFIAKAATKNKGRISRYLANKCSMASRIDNYSDEPTNVFGTVLRKQVEQRLEFYSTGQPT 420

Query: 421 LKNELAIQEAIELYNK 436
           LKNELAI+EA++LYN+
Sbjct: 421 LKNELAIKEAMDLYNE 436

>NCAS0A14170 Chr1 complement(2783782..2785314) [1533 bp, 510 aa]
           {ON} Anc_7.354
          Length = 510

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/435 (88%), Positives = 409/435 (94%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY IFKVKLQQDDIGSRLKEVQ QIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAIFKVKLQQDDIGSRLKEVQEQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
           +ALENANDISEGLVS+ LKAVLD+NLPK S  KT+TLAISDKNLGPSIKE FPYVDC++N
Sbjct: 61  EALENANDISEGLVSESLKAVLDLNLPKASKSKTITLAISDKNLGPSIKEDFPYVDCIAN 120

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLH             ERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASL+++SLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAAIL 240

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
           ++DAGIAERVIDNARISMGQD+SETDM+NV VFA+RV SL +YR+QLY+YLC KMHTVAP
Sbjct: 241 NDDAGIAERVIDNARISMGQDISETDMENVGVFAQRVVSLVEYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420
           GFI KA+AKNKGRISRYLANKCS+ASRIDNYSDEPT+VFG VLKKQVEQRLEFYSTG+PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYSTGTPT 420

Query: 421 LKNELAIQEAIELYN 435
           LKNELAI+EA++LYN
Sbjct: 421 LKNELAIKEAMDLYN 435

>TBLA0E02080 Chr5 complement(505617..507158) [1542 bp, 513 aa] {ON}
           Anc_7.354 YLR197W
          Length = 513

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/439 (85%), Positives = 408/439 (92%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           M+ I+YLLFEEPTGY +F+VKLQQD+IGS+L EVQ QIN+F SFTKLVELVSFAPFKGAA
Sbjct: 1   MSAIQYLLFEEPTGYAVFQVKLQQDNIGSKLAEVQKQINDFASFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
           +ALENANDISEGLVS+ LK++L++NLPKGS KKTV L ISDKNLGPSIKE FPYVDC+SN
Sbjct: 61  EALENANDISEGLVSENLKSLLELNLPKGSEKKTVILGISDKNLGPSIKEEFPYVDCISN 120

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL QDL+RG+R H             ERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELVQDLLRGIRQHGEKLFKGLQQGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASL+E+SLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEESLHDLTAIL 240

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
           ++DAGIAERVIDNARISMGQDLSETDM+NVCVFA+RV S+ADYR+QLY+YLC KMHTVAP
Sbjct: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCVFAKRVVSIADYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420
           GFI KA+AKNKGRISRYLANKCS+ASRIDNYSDEP++VFG V+KKQVEQRLEFYSTG PT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSSVFGAVMKKQVEQRLEFYSTGKPT 420

Query: 421 LKNELAIQEAIELYNKDKP 439
           LKNE+AI EA+ELYNKDKP
Sbjct: 421 LKNEVAIHEAMELYNKDKP 439

>KNAG0B02590 Chr2 (503498..504997) [1500 bp, 499 aa] {ON} Anc_7.354
           YLR197W
          Length = 499

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/462 (82%), Positives = 413/462 (89%), Gaps = 10/462 (2%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           MA IEYLLFEEPTGY +FKVKLQQDDIGSRL EVQ QIN+FGSFTK+VELVSFAPFKGAA
Sbjct: 1   MAAIEYLLFEEPTGYAVFKVKLQQDDIGSRLAEVQEQINDFGSFTKMVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
           +ALENAN+ISEGLVS+ LK+VLD+NLPK S KK++ L ISDKNLGPSIKE FPYVD +SN
Sbjct: 61  EALENANEISEGLVSESLKSVLDLNLPKPSKKKSIALGISDKNLGPSIKETFPYVDSVSN 120

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL QD++RG+RLH             +RA LGLGHAYSRAKVKFSVQKNDNHIIQAIAL+
Sbjct: 121 ELVQDMLRGIRLHGEKLFKGLQSGDLDRAHLGLGHAYSRAKVKFSVQKNDNHIIQAIALV 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASL+++SLHDL+A+L
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAALL 240

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
           ++DAGIA+RVIDNARISMGQDLSETDM+NV VFA+RV SL +YRRQLY+YLC KMHTVAP
Sbjct: 241 NDDAGIAQRVIDNARISMGQDLSETDMENVGVFAQRVVSLVEYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420
           GFI KAAAKNKGRISRYLANKCSIASRIDNYSDEP+NVFGTVLKKQVEQRLEFY+TG PT
Sbjct: 361 GFIAKAAAKNKGRISRYLANKCSIASRIDNYSDEPSNVFGTVLKKQVEQRLEFYATGKPT 420

Query: 421 LKNELAIQEAIELYNKDKP----------EEPVKESKKRKLE 452
           LKNELAI EA+ELY  + P          EE   +SKKRKLE
Sbjct: 421 LKNELAIHEAMELYKSENPDAEKKEDADVEEKPAKSKKRKLE 462

>KLTH0H15334g Chr8 complement(1329504..1331039) [1536 bp, 511 aa]
           {ON} highly similar to uniprot|Q12499 Saccharomyces
           cerevisiae YOR310C NOP58 Protein involved in pre-rRNA
           processing 18S rRNA synthesis and snoRNA synthesis
           component of the small subunit processome complex which
           is required for processing of pre-18S rRNA
          Length = 511

 Score =  322 bits (824), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 176/410 (42%), Positives = 255/410 (62%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAAQAL 63
           + Y+L E   GY + K   ++    S L +    +N      K  ++ +F+ F  AA+AL
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSSLIQ---DLNTSDKVLKQFKVAAFSKFGSAAEAL 57

Query: 64  ENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSNELA 123
           E AN I EG VS  L+ +LD    +  + K  TL +S+  L  +I +     + +S+ + 
Sbjct: 58  EEANSIVEGKVSSQLQKLLD----ESKADKKATLVVSETKLANAINKLGLNFNVVSDAVT 113

Query: 124 QDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ H              +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIFRAVKEHLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDND 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++ +E    DLS IL  +
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAET---DLSEILPEE 230

Query: 244 AGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAPNLS 303
             I ERV   A ISMG +++ TD++N+   A ++T  A YR QL  YL ++M  +APNL+
Sbjct: 231 --IEERVKAAAEISMGTEITPTDLENIKALATQITEFAAYREQLSNYLSARMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 GKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
           G+A  KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDVGLEARSKVESRL 398

>KNAG0J00650 Chr10 (110685..112259) [1575 bp, 524 aa] {ON} Anc_8.787
           YOR310C
          Length = 524

 Score =  319 bits (818), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 175/413 (42%), Positives = 258/413 (62%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          +L +    I +  S  K+++   + +F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKAS------DKKLYKSATLIQDLDSSEKVLKEFKIAAFSKFNSAA 54

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
            ALE AN + EG VS  L+ +LD ++ K    K  TL +S+  L  SI +     + +S+
Sbjct: 55  NALEEANSVIEGKVSPQLQKLLD-DIKKD---KKATLVVSETKLANSINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ H              +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEHLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++   E    D+S IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSKAHE---IDMSEIL 227

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
             +  I ERV   A +SMG ++++TD+DN+   A+++   A YR QL  YL ++M  +AP
Sbjct: 228 PEE--IEERVKAAAEVSMGTEITQTDLDNIKALADQIVDFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+HAGSLT+L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHAGSLTSLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
             +G+A  KNKG+I+R LA K +++ R D ++++  +    G  ++ +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDAFAEDRDDSGDVGLDVRAKVENRL 398

>KNAG0G03190 Chr7 complement(687362..688933) [1572 bp, 523 aa] {ON}
           Anc_8.787 YOR310C
          Length = 523

 Score =  318 bits (816), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 175/410 (42%), Positives = 256/410 (62%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAAQAL 63
           + Y+L E   GY + K   ++      L E    +N      K  ++ +F+ F  AA AL
Sbjct: 1   MSYVLTETSAGYALLKASDKKIYKSPSLIE---DLNTSEKLLKEFKIAAFSKFNSAANAL 57

Query: 64  ENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSNELA 123
           E AN + EG VS  L+ +L+ ++ K    K  TL +S+  L  SI +     + +S+ + 
Sbjct: 58  EEANSVIEGKVSPQLEKLLE-DIKKD---KKATLVVSETKLANSINKLGLNFNVVSDAVT 113

Query: 124 QDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ H              +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEHLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDND 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++   E    D+S IL  +
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSKAHET---DMSEILPEE 230

Query: 244 AGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAPNLS 303
             I ERV   A +SMG ++++TD+DN+   A+++   A YR QL  YL ++M  +APNL+
Sbjct: 231 --IEERVKAAAEVSMGTEITQTDLDNIKALADQIVDFAAYREQLSNYLSARMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+HAGSLT+L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHAGSLTSLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 GKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
           G+A  KNKG+I+R LA K +++ R D +S++  +    G  ++ +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDAFSEDRDDSGDVGLDVRVKVENRL 398

>ZYRO0F12518g Chr6 complement(1017206..1018765) [1560 bp, 519 aa]
           {ON} similar to uniprot|Q12499 Saccharomyces cerevisiae
           YOR310C NOP58 Protein involved in pre-rRNA processing
           18S rRNA synthesis and snoRNA synthesis component of the
           small subunit processome complex which is required for
           processing of pre-18S rRNA
          Length = 519

 Score =  317 bits (811), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/419 (42%), Positives = 257/419 (61%), Gaps = 32/419 (7%)

Query: 4   IEYLLFEEPTGYGIFKV---------KLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFA 54
           + Y+L E   GY + K          KL QD     L   +  ++EF       ++ +F+
Sbjct: 1   MSYVLTETSAGYALLKASDKKIHKSPKLIQD-----LDSSEKVLDEF-------KIAAFS 48

Query: 55  PFKGAAQALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPY 114
            F  AA ALE AN I+EG V+  L+++LD    +    K  TL +S+  L  SI +    
Sbjct: 49  KFNSAANALEEANSITEGKVTPQLQSLLD----EVKKDKKSTLIVSETKLANSINKLGLN 104

Query: 115 VDCMSNELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHII 174
            + +S+ +  D+ R V+ +              +  LGL H+  R K+KFS  K D  II
Sbjct: 105 FNVVSDAVTLDIYRAVKEYLPELLPGLTDNDLNKMSLGLAHSIGRHKLKFSADKVDVMII 164

Query: 175 QAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLH 234
           QAIALLD LDK+INT++MR KEWYGWHFPELAK+V D   +A+++L +  ++  +E    
Sbjct: 165 QAIALLDDLDKEINTYSMRCKEWYGWHFPELAKIVTDLVAYARIILTMGVRSKAAE---T 221

Query: 235 DLSAILDNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSK 294
           D+SAIL  +  I ERV   A +SMG ++++TD+DN+   A+++   A YR QL  YL ++
Sbjct: 222 DMSAILPEE--IEERVKAAAEVSMGTEITKTDLDNIGALAQQIVDFATYREQLSNYLTAR 279

Query: 295 MHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKY 354
           M  +APNL++L+GE++GARLISHAGSL +L+K  AST+QILGAEKALFRALKTK +TPKY
Sbjct: 280 MKAIAPNLTQLVGELVGARLISHAGSLVSLAKSPASTIQILGAEKALFRALKTKHDTPKY 339

Query: 355 GLIYHSGFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
           GL+YH+  +G+A  KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 340 GLLYHASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDVGLESRSKVENRL 398

>TBLA0B02830 Chr2 (653081..654634) [1554 bp, 517 aa] {ON} Anc_8.787
           YOR310C
          Length = 517

 Score =  315 bits (808), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 173/410 (42%), Positives = 253/410 (61%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAAQAL 63
           + Y+L E P GY + K   ++    S L +    ++      K  ++ +F+ F  AA AL
Sbjct: 1   MSYVLTETPAGYALLKASDKKIYKSSSLLQ---DLDTTDKVLKEFKIAAFSKFNSAANAL 57

Query: 64  ENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSNELA 123
           E +  I EG VS  L+ +LD    +    K  TL +S+  L  +I +    ++ +S+ + 
Sbjct: 58  EESTAIIEGKVSPQLEKLLD----EIKKDKKTTLIVSETKLANAINKLGLNLNIVSDAVT 113

Query: 124 QDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +              +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEYLPDLLPGLSDSDLNKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDND 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  +A+L+L +  ++  SE    D+S IL  +
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARLILTMGIRSKASE---TDMSEILPEE 230

Query: 244 AGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAPNLS 303
             I ERV   A +SMG +++ TD+DN+   AE++   A YR QL  YL S+M  +APNL+
Sbjct: 231 --IEERVKTAAEVSMGTEITPTDLDNIKALAEQIVEFASYREQLSNYLSSRMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 GKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
           G+A  KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDAGDVGLEARTKVENRL 398

>Smik_15.491 Chr15 complement(846605..848155) [1551 bp, 516 aa] {ON}
           YOR310C (REAL)
          Length = 516

 Score =  313 bits (801), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 172/413 (41%), Positives = 255/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +  + I +  S  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
            ALE AN I EG VS  L+ +L+    +    K  TL +S+  L  +I +     + +S+
Sbjct: 55  NALEEANSIIEGKVSSQLEKLLE----EIKKDKKSTLIVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +              +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  SE    DLS IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASET---DLSEIL 227

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
             +  I ERV   A +SMG ++++TD+DN+   AE++   A YR QL  YL ++M  +AP
Sbjct: 228 PEE--IEERVKTAAEVSMGTEITQTDLDNINALAEQIVEFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
             +G+A  KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>KAFR0D01580 Chr4 complement(313631..315136) [1506 bp, 501 aa] {ON}
           Anc_8.787 YOR310C
          Length = 501

 Score =  312 bits (799), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 170/414 (41%), Positives = 253/414 (61%), Gaps = 22/414 (5%)

Query: 4   IEYLLFEEPTGYGIFKVK----LQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGA 59
           + Y+L E   GY + K       +   + S L   +  + EF       ++ +F+ F  A
Sbjct: 1   MSYVLTETSAGYALLKASDKKIYKSTTLLSDLDSSEKVLKEF-------KIAAFSKFSSA 53

Query: 60  AQALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMS 119
           A ALE AN I EG VS  L+ +L+    +    K  TL +S+  L  +I +     + +S
Sbjct: 54  ANALEEANSIIEGKVSSQLEKILE----QIKKDKKSTLIVSETKLANAINKLGLNFNVVS 109

Query: 120 NELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           + +  D+ R V+ H              +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEHLPELLPGLNDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAI 239
           LD LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  +E    D+S I
Sbjct: 170 LDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAAET---DMSEI 226

Query: 240 LDNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVA 299
           L  +  + ERV   A +SMG +++++D+DN+   AE++   A YR QL  YL ++M  +A
Sbjct: 227 LPEE--VEERVKTAAEVSMGTEITQSDLDNIKSLAEQIVEFAAYREQLSNYLSNRMKAIA 284

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH
Sbjct: 285 PNLTQLVGELVGARLIAHSGSLVSLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYH 344

Query: 360 SGFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
           +  +G+A  KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 345 ASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLECRAKVENRL 398

>Skud_15.478 Chr15 complement(836937..837160,837194..838505) [1536
           bp, 512 aa] {ON} YOR310C (REAL)
          Length = 512

 Score =  312 bits (800), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 172/413 (41%), Positives = 255/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +  + I +  S  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
            ALE AN I EG VS  L+ +L+    +    K  TL +S+  L  +I +     + +S+
Sbjct: 55  NALEEANSIIEGKVSSQLEKLLE----EIKKDKKSTLIVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +              +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  SE    DLS IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASE---TDLSEIL 227

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
             +  I ERV   A +SMG ++++TD+DN+   AE++   A YR QL  YL ++M  +AP
Sbjct: 228 PEE--IEERVKTAAEVSMGTEITQTDLDNINALAEQIVDFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
             +G+A  KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>YOR310C Chr15 complement(896825..898360) [1536 bp, 511 aa] {ON}
           NOP58Protein involved in pre-rRNA processing, 18S rRNA
           synthesis, and snoRNA synthesis; component of the small
           subunit processome complex, which is required for
           processing of pre-18S rRNA
          Length = 511

 Score =  312 bits (799), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 171/413 (41%), Positives = 255/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +  + I +  S  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
            ALE AN I EG VS  L+ +L+    +    K  TL +S+  L  +I +     + +S+
Sbjct: 55  NALEEANSIIEGKVSSQLEKLLE----EIKKDKKSTLIVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R ++ +              +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAIKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  SE    DLS IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASET---DLSEIL 227

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
             +  I ERV   A +SMG ++++TD+DN+   AE++   A YR QL  YL ++M  +AP
Sbjct: 228 PEE--IEERVKTAAEVSMGTEITQTDLDNINALAEQIVEFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
             +G+A  KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>Kpol_1010.5 s1010 (13325..14869) [1545 bp, 514 aa] {ON}
           (13325..14869) [1545 nt, 515 aa]
          Length = 514

 Score =  312 bits (799), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/455 (39%), Positives = 270/455 (59%), Gaps = 28/455 (6%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +  + I +  S  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
            ALE AN I EG VS  L+ +L+    +    K  TL +S+  L  +I +     + +S+
Sbjct: 55  NALEEANSIIEGKVSPQLQKLLE----EAKKDKKSTLVVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +              +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPDLLPGLNDTDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  ++    DLS IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILAMGVRSKCAD---TDLSEIL 227

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
             +  + ERV   A +SMG +++ETD+DN+   A+++   A YR QL  YL S+M  +AP
Sbjct: 228 PEE--VEERVKTAAEVSMGTEITETDLDNIKALADQIVDFAAYREQLSNYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRLEFYS--- 415
             +G+A  KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL       
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVENRLSQLEGRD 405

Query: 416 -TGSPTLKNE---LAIQEAIELYNKDKPEEPVKES 446
              +P +  E   + I EA   YN D     V+ES
Sbjct: 406 LRTTPKVVREAKKVEITEA-RAYNADADTAAVEES 439

>Suva_8.361 Chr8 complement(637602..637804,637835..639149) [1518 bp,
           505 aa] {ON} YOR310C (REAL)
          Length = 505

 Score =  311 bits (797), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 171/413 (41%), Positives = 255/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +  + I +  S  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
            ALE AN I +G VS  L+ +L+    +    K  TL +S+  L  +I +     + +S+
Sbjct: 55  NALEEANSIIDGKVSSQLEKLLE----EIKKDKKSTLIVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +              +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  SE    DLS IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASE---TDLSEIL 227

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
             +  I ERV   A +SMG ++++TD+DN+   AE++   A YR QL  YL ++M  +AP
Sbjct: 228 PEE--IEERVKTAAEVSMGTEITQTDLDNINALAEQIVDFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
             +G+A  KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>KAFR0B03540 Chr2 complement(735790..737289) [1500 bp, 499 aa] {ON}
           Anc_8.787 YOR310C
          Length = 499

 Score =  310 bits (794), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 168/413 (40%), Positives = 254/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLV---ELVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +    + +  S  K++   ++ +F+ F  AA
Sbjct: 1   MSYILTETSAGYALLKAS------DKKIYKSSTLLQDLDSSEKVLRQFKIAAFSKFSSAA 54

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
            ALE AN I EG VS  L+ +LD    +    K  TL +S+  L  +I +    +  +S+
Sbjct: 55  NALEEANSIVEGKVSTQLEKLLD----EIKKDKKSTLVVSETKLANAINKLGLNLSVVSD 110

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +              +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLDDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++  +E    D+S IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAAE---TDMSEIL 227

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
             +  + ERV   A +SMG +++++D+DN+   AE++   A YR QL  YL ++M  +AP
Sbjct: 228 PEE--VEERVKTAAEVSMGTEITQSDLDNIKSLAEQIVEFAAYREQLSNYLSNRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLVSLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
             +G+A  KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLECRAKVENRL 398

>SAKL0B05874g Chr2 complement(499332..500873) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12499 Saccharomyces cerevisiae
           YOR310C NOP58 Protein involved in pre-rRNA processing
           18S rRNA synthesis and snoRNA synthesis component of the
           small subunit processome complex which is required for
           processing of pre-18S rRNA
          Length = 513

 Score =  308 bits (790), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 169/410 (41%), Positives = 253/410 (61%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAAQAL 63
           + Y+L E   GY + K   ++    S L +    +N      K  ++ +F+ F  AA AL
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSTLIK---DLNSSEKVLKEFKIAAFSKFSSAADAL 57

Query: 64  ENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSNELA 123
           E AN I EG VS  L+ +L     +  + K  TL +S+  L  +I +     + +S+ + 
Sbjct: 58  EEANSIIEGKVSTQLENLL----KEAKADKKATLVVSETKLANAINKLNLNFNVISDAVT 113

Query: 124 QDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +              +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEYLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDND 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  +++ ++    D+S IL  +
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSNAAD---TDMSEILPEE 230

Query: 244 AGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAPNLS 303
             I ERV   + +SMG ++++ D+DN+   A+++   A YR QL  YL S+M  +APNL+
Sbjct: 231 --IEERVKSASEVSMGTEITQVDLDNIKCLADQIVDFAAYREQLSNYLSSRMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHAGSLISLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 GKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
           G+A  KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDVGLESRAKVENRL 398

>TPHA0G01160 Chr7 (234712..236256) [1545 bp, 514 aa] {ON} Anc_8.787
           YOR310C
          Length = 514

 Score =  308 bits (790), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 170/413 (41%), Positives = 256/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +  + I +  +  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSTSLIQDLDTSDKVLKEFKIAAFSKFSSAA 54

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
            ALE +N I EG VS  L+ +L+ ++ K    K  TL +S+  L  SI +     + +S+
Sbjct: 55  NALEESNAIIEGKVSSQLQKLLE-DIKKD---KKSTLVVSETKLANSINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +              +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLTDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           D LDK++NT+AMRVKEWYGWHFPELAK+V D+  +A+++L +  ++  SE    D+S IL
Sbjct: 171 DDLDKELNTYAMRVKEWYGWHFPELAKIVVDSVAYARIILTMGIRSKASE---TDMSEIL 227

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
             +  I ERV   A +SMG +++  D+DN+   A+++   A YR QL  YL ++M  +AP
Sbjct: 228 PEE--IEERVKTAAEVSMGTEITPVDLDNIKALADQIVEFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
             +G+A  KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVENRL 398

>TDEL0B01110 Chr2 (204471..205985) [1515 bp, 504 aa] {ON} Anc_8.787
           YOR310C
          Length = 504

 Score =  308 bits (788), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 172/410 (41%), Positives = 256/410 (62%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAAQAL 63
           + Y+L E   GY + K   ++  I    K +Q  ++      K  ++ +F+ F  AA AL
Sbjct: 1   MAYVLTETSAGYALLKASDKK--IYKSTKLIQ-DLDSSDKVLKEFKIAAFSKFNSAANAL 57

Query: 64  ENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSNELA 123
           E A+ I EG VS  L+ +L+ ++ K    K  TL +S+  L  +I +     + +S+ + 
Sbjct: 58  EEASAIIEGKVSPQLQNLLE-DIKKD---KKSTLIVSETKLANAINKLGLNFNVISDAVT 113

Query: 124 QDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +              +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEYLPDLLPGLTDGDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDND 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L I  ++  SE    D+S+IL  +
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILSIGVRSKASE---TDMSSILPEE 230

Query: 244 AGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAPNLS 303
             I ERV   A +SMG ++++ D+DN+   AE++   A YR QL  YL ++M  +APNL+
Sbjct: 231 --IEERVKTAAEVSMGTEITQVDLDNIKCLAEQIVDFASYREQLSNYLSARMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 GKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
           G+A  KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLDSRAKVENRL 398

>TPHA0I00650 Chr9 (135050..136672) [1623 bp, 540 aa] {ON} Anc_8.787
           YOR310C
          Length = 540

 Score =  308 bits (790), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 171/413 (41%), Positives = 255/413 (61%), Gaps = 14/413 (3%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60
           +  + Y+L E   GY + K   ++    S L +    ++      K  ++ +F+ F  AA
Sbjct: 30  LCKMAYVLTETSAGYALLKASDKKIYKSSTLIQ---DLDTSDKVLKEFKIAAFSKFSSAA 86

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
            ALE +N I EG VS  L+ +L+ ++ K    K  TL +S+  L  SI +     + +S+
Sbjct: 87  NALEESNAIIEGKVSSQLQKLLE-DIKKD---KKSTLVVSETKLANSINKLGLNFNVVSD 142

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +              +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 143 AVTLDIYRAVKEYLPELLPGLTDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 202

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           D LDK++NT+AMRVKEWYGWHFPELAK+V D+  +A+++L +  ++  SE    D+S IL
Sbjct: 203 DDLDKELNTYAMRVKEWYGWHFPELAKIVVDSVAYARIILTMGIRSKASET---DMSEIL 259

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
             +  I ERV   A +SMG +++  D+DN+   A+++   A YR QL  YL ++M  +AP
Sbjct: 260 PEE--IEERVKTAAEVSMGTEITPVDLDNIKALADQIVEFAAYREQLSNYLSARMKAIAP 317

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 318 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 377

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
             +G+A  KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 378 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVESRL 430

>NDAI0E00550 Chr5 (108986..110557) [1572 bp, 523 aa] {ON} Anc_8.787
          Length = 523

 Score =  307 bits (787), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 169/413 (40%), Positives = 254/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +  + I +  +  K+++   + +F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKAS------DKKIYKSSSLIQDLDTSDKVLKEFKIAAFSKFSSAA 54

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
            ALE +N I EG VS  L+ +L+    +    K  TL +S+  L  SI +     + +S+
Sbjct: 55  NALEESNSIIEGKVSPQLEKLLE----EIKKDKKSTLIVSETKLANSINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +              +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLNDSDLNKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+L+L +  ++  SE    D+S IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARLILTMGVRSKASE---TDMSEIL 227

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
             +  I ERV   A +SMG ++++ D+DN+   A+++   A YR QL  YL ++M  +AP
Sbjct: 228 PEE--IEERVKTAAEVSMGTEITQIDLDNIKCLADQIVEFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
             +G+A  KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVENRL 398

>KLLA0F08613g Chr6 complement(801623..803158) [1536 bp, 511 aa] {ON}
           similar to uniprot|Q12499 Saccharomyces cerevisiae
           YOR310C NOP58 Protein involved in pre-rRNA processing
           18S rRNA synthesis and snoRNA synthesis component of the
           small subunit processome complex which is required for
           processing of pre-18S rRNA
          Length = 511

 Score =  305 bits (782), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 167/413 (40%), Positives = 254/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLV---ELVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +  + I +  S  K++   ++ +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSSSLIQDLNSSDKVLNQFKIAAFSKFSSAA 54

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
            ALE AN + +G VS  L+ +L+    +  + K  TL +S+  L  +I +     + +S+
Sbjct: 55  NALEEANSVIDGKVSSQLEKLLE----ECKTDKKATLVVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +              +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLNDQDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  + + +E    D+S IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRVNAAET---DMSEIL 227

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
             +  I ERV   A +SMG +++  D+ N+   AE++   A YR QL  YL S+M  +AP
Sbjct: 228 PEE--IEERVKTAAEVSMGTEITPVDLINIKCLAEQIVEFAAYREQLSNYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
             +G+A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQASGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVESRL 398

>NCAS0B00870 Chr2 complement(133660..135207) [1548 bp, 515 aa] {ON}
           Anc_8.787
          Length = 515

 Score =  302 bits (774), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 168/415 (40%), Positives = 255/415 (61%), Gaps = 24/415 (5%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +  + I +  +  K+++   + +F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKAS------DKKIYKSSSLIQDLDTSDKVLKEFKIAAFSKFNSAA 54

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
            ALE AN I EG VS  L+ +L+    +    K  TL +S+  L  +I +     + +S+
Sbjct: 55  NALEEANSIIEGKVSPQLEKLLE----EIKKDKKSTLIVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +              +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLNDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLF--IKDKASLSEDSLHDLSA 238
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L   I+ KA+ +     D+S 
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAADT-----DMSE 225

Query: 239 ILDNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTV 298
           IL  +  I ERV   A +SMG ++++ D++N+   A+++   A YR QL  YL ++M  +
Sbjct: 226 ILPEE--IEERVKTAAEVSMGTEITQLDLENIKCLADQIVEFAAYREQLSNYLSARMKAI 283

Query: 299 APNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIY 358
           APNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+Y
Sbjct: 284 APNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLY 343

Query: 359 HSGFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
           H+  +G+A  KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 344 HASLVGQATGKNKGKIARVLAAKAAVSIRYDALAEDRDDAGDIGLESRAKVENRL 398

>AFR328C Chr6 complement(1032025..1033566) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR310C
           (NOP58)
          Length = 513

 Score =  301 bits (772), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 172/411 (41%), Positives = 255/411 (62%), Gaps = 16/411 (3%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRL-KEVQAQINEFGSFTKLVELVSFAPFKGAAQA 62
           + Y+L E   GY + K   ++    S L +++++  N    F    ++ +F+ F  AA A
Sbjct: 1   MAYVLTETAAGYALLKASDKKIYKSSSLVQDLKSSENVLKQF----KVAAFSKFASAANA 56

Query: 63  LENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSNEL 122
           LE AN + EG VS  L+ +L     +  S K  TL +S+  L  +I +     + + + +
Sbjct: 57  LEEANSVIEGKVSSQLEKLL----AEAKSDKKSTLVVSETKLANAINKLGLNFNVVCDAV 112

Query: 123 AQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQ 182
             D+ R V+ +              +  LGL H+  R K+KFS  K D  IIQAIALLD 
Sbjct: 113 TLDIYRAVKEYLPELLPGMTDGDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDD 172

Query: 183 LDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDN 242
           LDK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++ +E    D+S IL  
Sbjct: 173 LDKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAET---DMSEILPE 229

Query: 243 DAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAPNL 302
           +  I ERV   A +SMG ++++ D+DN+   AE++   A YR QL  YL S+M  +APNL
Sbjct: 230 E--IEERVKSAAEVSMGTEITQVDLDNIKSLAEQIVEFAAYREQLSNYLSSRMKAIAPNL 287

Query: 303 SELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGF 362
           ++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  
Sbjct: 288 TQLVGELVGARLIAHAGSLVSLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHASL 347

Query: 363 IGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
           +G+A  KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 348 VGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVESRL 398

>Kwal_34.15894 s34 (102368..103906) [1539 bp, 512 aa] {ON} YOR310C
           (NOP58) - 57 kDa nucleolar protein [contig 272] FULL
          Length = 512

 Score =  301 bits (770), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 174/410 (42%), Positives = 254/410 (61%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAAQAL 63
           + Y+L E   GY + K   ++    S L +    +N      K  ++ +F+ F  AA+AL
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSSLIQ---DLNSSDKVLKQFKIAAFSKFGSAAEAL 57

Query: 64  ENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSNELA 123
           E AN I EG VS+ L+ +L     +  + K  TL +S+  L  +I +     + +S+ + 
Sbjct: 58  EEANAIVEGKVSNQLQKLL----SESKADKKATLVVSETKLANAINKLGLNFNVVSDAVT 113

Query: 124 QDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +              +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIFRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDND 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++ +E    DLS IL  +
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAET---DLSEILPEE 230

Query: 244 AGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAPNLS 303
             I ERV   A ISMG +++  D+DN+   A ++T  A YR QL  YL ++M  +APNL+
Sbjct: 231 --IEERVKSAAEISMGTEITSVDLDNIKSLATQITEFAAYREQLSNYLSARMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 GKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
           G+A  KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRSKVESRL 398

>Ecym_1489 Chr1 complement(1006523..1008067) [1545 bp, 514 aa] {ON}
           similar to Ashbya gossypii AFR328C
          Length = 514

 Score =  300 bits (769), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 172/413 (41%), Positives = 253/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGS---FTKLVELVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +    IN+  S     K  ++ +F+ F  AA
Sbjct: 1   MAYVLTETAAGYALLKAS------DKKIYKSATLINDLKSSESVLKQFKIAAFSKFSSAA 54

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
            ALE AN + EG VS  L+ +LD    +  + K  TL +S+  LG +I +     + + +
Sbjct: 55  NALEEANAVIEGKVSSQLQKLLD----EAKTDKKATLVVSETKLGNAINKLGLNFNVVCD 110

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +              +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLSGDDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++ ++    DLS +L
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAD---TDLSEVL 227

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
             +  + ERV   A +SMG +++  D+DN+   AE++   A YR QL  YL S+M  +AP
Sbjct: 228 PEE--VEERVKAAAEVSMGTEITPIDLDNIKCLAEQIVEFAAYREQLSSYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL+ L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTNLVGELVGARLIAHAGSLISLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSD--EPTNVFGTVLKKQVEQRL 411
             +G+A  KNKG+I+R LA K +++ R D  ++  + +  FG   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGEFGLESRAKVENRL 398

>CAGL0I09790g Chr9 complement(935016..936557) [1542 bp, 513 aa] {ON}
           highly similar to uniprot|Q12499 Saccharomyces
           cerevisiae YOR310c
          Length = 513

 Score =  291 bits (744), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 169/413 (40%), Positives = 256/413 (61%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +  + I +  S  K+++   + +F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKAS------DKKIYKSSSLIMDLDSSEKVLKEFKIAAFSKFNSAA 54

Query: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120
            ALE A+ I EG VS  L+ +LD    +   +K  TL +S+  L  +I +     + +S+
Sbjct: 55  NALEEASAIIEGKVSPQLEKLLD----EIKKEKKATLIVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHXXXXXXXXXXXXXERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +              +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPDLLPGMSDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240
           D LDK++NT++MR KEWYGWHFPELAK+V D+  +A+L+L +  ++  +E    D+S IL
Sbjct: 171 DDLDKEVNTYSMRCKEWYGWHFPELAKIVTDSVAYARLILTMGVRSKAAET---DMSEIL 227

Query: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300
             +  I ERV   A +SMG ++++ D+ N+   A+++   A YR QL  YL S+M  +AP
Sbjct: 228 PEE--IEERVKAAAEVSMGTEITDVDLINIRALADQIVEFAAYREQLSNYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNV--FGTVLKKQVEQRL 411
             +G+A+ +NKG+I+R LA K ++A R D  +++  +    G  ++ +VE RL
Sbjct: 346 SLVGQASGRNKGKIARVLAAKAAVALRYDALAEDRDDSGDIGLEVRAKVENRL 398

>TPHA0D03930 Chr4 (823320..824735) [1416 bp, 471 aa] {ON} Anc_3.429
           YGR091W
          Length = 471

 Score = 78.6 bits (192), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 117/234 (50%), Gaps = 17/234 (7%)

Query: 170 DNHIIQAIALLDQLDKDI-----NTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKD 224
           +N I++  ++L++  K I     N FA  +K  Y   FPEL  L+ +   F +++  +++
Sbjct: 90  ENGIVEVASILNKYSKIIQEESSNVFAY-IKILYKPRFPELETLLTNPIDFIEVLKLLEE 148

Query: 225 KASLSEDSLHD-LSAILDNDAGIAER----VIDNARISMGQDL--SETDMDNVCVFAERV 277
             +++E S  D ++ +L+N++ I+      VI + +         +E     +    E +
Sbjct: 149 --NITEISNDDYIATLLENESNISSEKRLVVIMSIKTCFNSSFIFTEDARGKLSSVLELL 206

Query: 278 TSLADYRRQLYEYLCSKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGA 337
             L + + +  +YL SK+ T+APNLS LIG  I + LISH GS+  LSK  +  +  +G 
Sbjct: 207 NILMNSKTEAVQYLSSKIGTIAPNLSTLIGTSIASLLISHTGSILELSKVPSCNLASIGK 266

Query: 338 EKALFRA--LKTKGNTPKYGLIYHSGFIGKAAAKNKGRISRYLANKCSIASRID 389
           +K    A  + +     + G IY+S  I         ++ R L  K S+A+R+D
Sbjct: 267 KKYSSSAQHITSVSGVRQEGYIYNSELIQNMPISTHKQLLRMLCAKVSLAARVD 320

>KNAG0B01140 Chr2 complement(210529..212007) [1479 bp, 492 aa] {ON}
           Anc_3.429 YGR091W
          Length = 492

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 109/212 (51%), Gaps = 10/212 (4%)

Query: 185 KDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDNDA 244
           +DI      +   Y   F EL  L+P+   +A +V  ++   ++ + + ++L+ I +++ 
Sbjct: 132 RDIENLHTFMIMQYRKKFLELDSLLPNPVNYADVVFVLE---TMQDRNSNELATIFESEL 188

Query: 245 GIAER----VIDNARISMGQDLSETDMDNVCVFAER--VTSLADYRRQLYEYLCSKMHTV 298
            + +     +  + + S+ QD++   +  + +F  R  +  L+D+R ++ + + SK+H +
Sbjct: 189 LLKKEQTLVLTLSIKTSLRQDVTLEKLIQIRLFRARAMIRQLSDHRERIVKLVESKIHII 248

Query: 299 APNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLI 357
           APNL+ L+G    + L+ HAGS+  LS   +  +  +G ++ L   L T      + G I
Sbjct: 249 APNLTALVGAETCSYLVGHAGSVVALSLIPSCNLSSIGKKRHLSHELHTNISGVRQEGAI 308

Query: 358 YHSGFIGKAAAKNKGRISRYLANKCSIASRID 389
           YH   + +    ++ ++ R +  K S+A+R+D
Sbjct: 309 YHCALVREQPVTHRKQMLRMVCAKVSLAARVD 340

>ZYRO0C12386g Chr3 (978158..979492) [1335 bp, 444 aa] {ON} similar
           to uniprot|P49704 Saccharomyces cerevisiae YGR091W PRP31
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 444

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 102/229 (44%), Gaps = 19/229 (8%)

Query: 169 NDNHIIQAIALLDQL----DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKD 224
           ND  + Q + +L+ L      +I      +K  YG  F EL  LVP   +FA ++  I+ 
Sbjct: 73  NDEDLAQTLTILNSLTYIAQNEITVLHNLLKLIYGVKFGELESLVPQPQQFADVIRIIET 132

Query: 225 KASLSEDSLHDLSAILDNDAGIAERVIDNARISMGQDLS---ETDMDNVCVFAERVTSLA 281
                           + DA +++  +    +SM          D D V    + + +++
Sbjct: 133 N-----------EGNFETDAQLSKEQVLVLNMSMKSSFQAHVNVDKDKVLQLRDLLMTVS 181

Query: 282 DYRRQLYEYLCSKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKAL 341
             R ++  ++ SK   VAPNL  LIG  + + L+SH+G +  LS+  +  +  +G  K L
Sbjct: 182 RIRNEINSFILSKASLVAPNLCLLIGPEVTSLLLSHSGGVLELSQVPSCNLASIGKNKHL 241

Query: 342 FRALKTK-GNTPKYGLIYHSGFIGKAAAKNKGRISRYLANKCSIASRID 389
              L T      + G IY S  + +   + + ++ R +  K ++A+R+D
Sbjct: 242 SHELHTNLTGVRQEGYIYRSSLVQEQPLEFRKQMLRMVCAKVALAARVD 290

>NDAI0G01290 Chr7 complement(284145..285635) [1491 bp, 496 aa] {ON}
           Anc_3.429 YGR091W
          Length = 496

 Score = 73.2 bits (178), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 91/199 (45%), Gaps = 10/199 (5%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDNDAGIAERVIDNARIS 257
           Y   F EL  +     ++A++V   +    LS   L++L    +N+A + +  I    IS
Sbjct: 131 YSKKFNELDTITSSQLQYARIVKIFESHQDLSSGELNNL---FENEAKLTKEQIIVLNIS 187

Query: 258 MGQD------LSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAPNLSELIGEVIG 311
           M         L       +    + +T+L+  +  +  Y+ S +  +APNL  LIG  I 
Sbjct: 188 MKSSFDISFKLDHQKQKEILKSTDMITTLSALQELITHYITSNISHIAPNLCALIGSQIA 247

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLIYHSGFIGKAAAKN 370
           A LISHAGS+ +LS+  +  +  +G  K     L T      + G IY    I    ++N
Sbjct: 248 ALLISHAGSILDLSQIPSCNLASIGKSKHQSHELHTSLSGVRQEGYIYDCDLIQDQPSEN 307

Query: 371 KGRISRYLANKCSIASRID 389
             ++ R +  K S+A+R+D
Sbjct: 308 HKQMLRMVCAKASLAARVD 326

>TDEL0F03110 Chr6 (568933..570237) [1305 bp, 434 aa] {ON} Anc_3.429
           YGR091W
          Length = 434

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 112/247 (45%), Gaps = 17/247 (6%)

Query: 175 QAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLH 234
           Q  AL   L  +I       K  Y   F EL  LVPD  K+ +++  I++    S     
Sbjct: 73  QLNALSSILQGEIRLLHDYTKILYRQRFAELESLVPDPVKYVEVISIIEEDEQAS----- 127

Query: 235 DLSAILDNDAGIAER----VIDNARISMGQDLSETDMDNVCVFAERVTSLA--DYRRQLY 288
             S   + DA +++     ++ + + S+ Q+   TD +   +   R   LA    R ++ 
Sbjct: 128 --SERFERDAKLSKEQILVLMMSMKTSIRQERQITDGERAVLLRARSYMLAIVSVRDKVN 185

Query: 289 EYLCSKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK 348
            Y+  ++  +APNL  LIG  I + L+SH G +  LS+  +  +  +G  K L   L T 
Sbjct: 186 GYVVQRVSHIAPNLCALIGPEITSLLLSHFGGILELSQAPSCNLASIGKNKHLTHELHTS 245

Query: 349 -GNTPKYGLIYHSGFIGKAAAKNKGRISRYLANKCSIASRID---NYSDEPTNVFGTVLK 404
                + G IY S  +     +   ++ R +  K S+A+R+D   N S E  ++ G   +
Sbjct: 246 LTGVRQEGYIYRSQLVQDQPPQYHKQMLRMVCAKISLAARVDAGINSSQESDSLLGDKWR 305

Query: 405 KQVEQRL 411
           +++ +++
Sbjct: 306 REIMEKV 312

>TBLA0C02320 Chr3 complement(549057..550592) [1536 bp, 511 aa] {ON}
           Anc_3.429 YGR091W
          Length = 511

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 64/280 (22%), Positives = 132/280 (47%), Gaps = 20/280 (7%)

Query: 183 LDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDN 242
           +++DI      VK  Y   FPEL  L+ +  +F  ++  ++   + +++    L   L+ 
Sbjct: 133 INEDIKLLHSYVKANYQKRFPELESLITNPIQFIDVIRLLESLNNPNKNEESQLEIRLEK 192

Query: 243 DAGIAER----VIDNARISMGQD--LSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMH 296
           +  + +     +I + + S  ++   S T  +N+   +  ++ L  ++ ++  ++  K+ 
Sbjct: 193 ETTLQKEQILVIIMSVKTSFNKEYQFSNTLRNNLIKASNLISQLWQFKEEINSFVTKKIS 252

Query: 297 TVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYG 355
            +APNL  LIG  I + L++++G L NL    +  +  +G  K L   L +      + G
Sbjct: 253 DIAPNLCALIGPYITSLLVAYSGGLANLCSVPSCNLASIGKNKHLSHELHSNLSGVRQNG 312

Query: 356 LIYHSGFIGKAAAKNKGRISRYLANKCSIASRID---NYSDEPTNVFGTVLKKQVEQRLE 412
            +Y+S  I    A    ++ R L  K ++ASR+D   + +++ T+  G   K ++ +++ 
Sbjct: 313 YLYNSELIQSQPANLHKQLLRILCAKVALASRVDAGQSGNNKKTDELGNTWKLEILEKIN 372

Query: 413 FYSTGSPTLKN--ELAIQEAIELYNKDKPEEPVKESKKRK 450
             +  SP++ N   L I E       DKP++     K RK
Sbjct: 373 KLNE-SPSITNVKPLPIPE-------DKPKKKRSGRKFRK 404

>KAFR0K01530 Chr11 (319205..320725) [1521 bp, 506 aa] {ON} Anc_3.429
           YGR091W
          Length = 506

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 105/221 (47%), Gaps = 14/221 (6%)

Query: 180 LDQLDKDINTFAMRVKEW----YGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHD 235
           L+Q+  ++ T    + E+    Y   F EL  L+    +++ ++  ++     +E SL  
Sbjct: 110 LNQISLNLRTETANLHEYLKLSYSARFSELESLIATATQYSNVIYVLETSEKDTEGSL-- 167

Query: 236 LSAILDNDAGIAERVIDNARISMGQDLSETD------MDNVCVFAERVTSLADYRRQLYE 289
               L+  A +++  I    +SM    +E+          +    E + +L + R  +  
Sbjct: 168 -VTSLEQVAQLSKEQILVLMMSMKTSFNESTPLPLEIKQRLLRAREMIITLDELRHTIAS 226

Query: 290 YLCSKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKG 349
           Y+ SK++ +APNL  L+G  I A L+SHAG +  LS+     +  +G +K L   L T  
Sbjct: 227 YISSKVYHIAPNLCALLGSEITALLVSHAGDILQLSQVPNCNLASIGKKKHLSHELHTTA 286

Query: 350 N-TPKYGLIYHSGFIGKAAAKNKGRISRYLANKCSIASRID 389
           +   + G IY+S  + +    ++ ++ R L  K ++A+R+D
Sbjct: 287 SGVRQEGYIYNSELVQETPVGSRKQMLRMLCAKVALAARVD 327

>Kwal_23.3995 s23 complement(517426..518850) [1425 bp, 474 aa] {ON}
           YGR091W (PRP31) - pre-mRNA splicing protein [contig 255]
           FULL
          Length = 474

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 96/215 (44%), Gaps = 2/215 (0%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDNDAGIAERVIDNARIS 257
           Y   FPEL  L+     +AQ+V  + + + ++E +L  L  I+  +  +   +  +    
Sbjct: 111 YERRFPELQSLMTSPKGYAQVVKHL-ETSDINEGNLRGLEDIISKEHFLVLSMAMHTGFK 169

Query: 258 MGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAPNLSELIGEVIGARLISH 317
               L+  D   V   A+ +  L D R ++  Y+ S +  VAPNL  L+G  I A LI+ 
Sbjct: 170 QDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAV 229

Query: 318 AGSLTNLSKQAASTVQILGAEKALFRALKTKGN-TPKYGLIYHSGFIGKAAAKNKGRISR 376
           AG L+ LS+  +  +  +G  K       T  +   + G IY S  +       + +  R
Sbjct: 230 AGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQALR 289

Query: 377 YLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRL 411
            +  K S+ +R D     P+   G   K+QV ++L
Sbjct: 290 MVCAKVSLCARADRSKSCPSGTLGAKWKEQVLEKL 324

>YGR091W Chr7 (666341..667825) [1485 bp, 494 aa] {ON}  PRP31Splicing
           factor, component of the U4/U6-U5 snRNP complex
          Length = 494

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 95/199 (47%), Gaps = 8/199 (4%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDNDAGIAERVIDNARIS 257
           Y   FPEL+ L+P   ++++ V+ I +  + S++   +L   L+N A +    I    +S
Sbjct: 120 YSRRFPELSSLIPSPLQYSK-VISILENENYSKNESDELFFHLENKAKLTREQILVLTMS 178

Query: 258 MGQDLSETDMDNVCVFAERVTS------LADYRRQLYEYLCSKMHTVAPNLSELIGEVIG 311
           M       +  ++    + + +      L   +  + +Y+ SK+  +APN+  L+G  I 
Sbjct: 179 MKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEIA 238

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFIGKAAAKN 370
           A+LI+HAG +   S+  +  +  +G  K L   L T +    + G ++ S  I K     
Sbjct: 239 AQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVSV 298

Query: 371 KGRISRYLANKCSIASRID 389
             ++ R L  K S+A+R+D
Sbjct: 299 HKQMLRMLCAKVSLAARVD 317

>Skud_7.390 Chr7 (650643..652130) [1488 bp, 495 aa] {ON} YGR091W
           (REAL)
          Length = 495

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 103/219 (47%), Gaps = 8/219 (3%)

Query: 178 ALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLS 237
           A++  +  DI +    +   YG  FPEL+ L+P + ++++ V  I +    S++    LS
Sbjct: 101 AIIPLIKSDIKSLHNFLILLYGKRFPELSSLIPSSLQYSK-VASILESEHWSKNESDKLS 159

Query: 238 AILDNDAGIAERVIDNARISMGQDLSET---DMDNVCVFAERVTSLADY---RRQLYEYL 291
            +L+N+A + +  +    +SM    +     D+      +E    L +    +  +  Y+
Sbjct: 160 PLLENEANLTKEQVLVLTMSMKTSFNNKEPLDIGTRKQISEATAMLKNLWVLQEDVGRYV 219

Query: 292 CSKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGN 350
            SK+  +APN+  L+G  + A+L+++AG +   S+  +  +  +G  K L   L T    
Sbjct: 220 ASKISVIAPNMCLLVGPEVAAQLLAYAGGVLEFSRIPSCNIASIGKNKHLSHELHTLASG 279

Query: 351 TPKYGLIYHSGFIGKAAAKNKGRISRYLANKCSIASRID 389
             + G I+ +  I         ++ R +  K ++A+R+D
Sbjct: 280 VRQEGYIFSTDLIQNFPLAIHKQMLRMICAKVTLAARVD 318

>NCAS0E01160 Chr5 complement(219669..221108) [1440 bp, 479 aa] {ON}
           Anc_3.429 YGR091W
          Length = 479

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 127/283 (44%), Gaps = 22/283 (7%)

Query: 179 LLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSA 238
           L  Q+ ++I+      K  Y   F EL  +    Y++A++   I+     S+D    L  
Sbjct: 118 LSHQIRREIDILYQYSKNIYSTRFTELDTIAATPYQYAKVTSLIE---GTSDDKAGQLPI 174

Query: 239 ILDNDAGIAERVIDNARISMGQDLS-----ETDMDNVCVFA-ERVTSLADYRRQLYEYLC 292
            ++ +A +++  +   R+SM          E  + ++ + A   +  L D +  + +Y+ 
Sbjct: 175 NIEIEAKLSKEQVLVLRMSMQTSFLKNKPLEKKVKHLLLEACSMIIQLTDLQNVILQYIS 234

Query: 293 SKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNT 351
           S +  +APNL  L+G  + + LI+H G +  L++  +  +  +G  + L   L T     
Sbjct: 235 SNVSDIAPNLCVLVGPEVASLLIAHTGGILQLAEIPSCNLASIGKNRHLSHELHTTLSGV 294

Query: 352 PKYGLIYHSGFIGKAAAKNKGRISRYLANKCSIASRID--NYSDEPTNVFGTVLKKQVEQ 409
            + G IY S  +     +N  ++ R +  K ++A+R+D         ++ G   ++++E 
Sbjct: 295 RQEGYIYSSELVQNQPIQNHKQMLRMVCAKVALAARVDAGQRGAAKNDLLGQRWREELET 354

Query: 410 RLEFYSTGSPTLKN--ELAIQEAIELYNKDKPEEPVKESKKRK 450
           +++   T SP + N   L I E       DKP++     K RK
Sbjct: 355 KIQ-KVTESPNISNVKPLPIPE-------DKPKKKRAGRKFRK 389

>Kpol_1018.138 s1018 complement(368322..369803) [1482 bp, 493 aa]
           {ON} complement(368322..369803) [1482 nt, 494 aa]
          Length = 493

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 110/239 (46%), Gaps = 17/239 (7%)

Query: 183 LDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDL-SAILD 241
           + ++I+ F    K  Y + F EL  L P   +FA+ +  I+   ++ + S HDL S+ L+
Sbjct: 124 IQEEISCFYEYSKHIYKFKFFELETLAPTAVQFAKTIQLIE---TMDDFSQHDLLSSKLE 180

Query: 242 NDAGIAERVIDNARISMGQDLS-----ETDM-DNVCVFAERVTSLADYRRQLYEYLCSKM 295
            +  + +  +    I+M   L+     E  M  ++  F + +      ++++  ++ S +
Sbjct: 181 TEILLTKEQVLVLIIAMKTSLNKEYSFEGSMKTSLKQFTDIIIQHDLLKKEITTFIESNI 240

Query: 296 HTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKY 354
            T+APNL  L+G  I + LI HAG +  LS+  +  +  +G  K      +T      + 
Sbjct: 241 ITIAPNLCALVGSEITSLLIGHAGGILELSQIPSCNLASVGKNKYFSHERQTNLSGVRQE 300

Query: 355 GLIYHSGFIGKAAAKNKGRISRYLANKCSIASRID------NYSDEPTNVFGTVLKKQV 407
           G IY+S  I         ++ R L  K S+A+R+D        S EP    G   ++++
Sbjct: 301 GYIYNSELIQSQPVDYHKQLLRMLCAKISLAARVDTSVKISTSSTEPAAFLGQKWREEI 359

>Suva_7.374 Chr7 (641967..643508) [1542 bp, 513 aa] {ON} YGR091W
           (REAL)
          Length = 513

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 99/199 (49%), Gaps = 8/199 (4%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDNDAGIAERVIDNARIS 257
           Y   FPEL+ L+P   +++++V  ++++ + S +    LS  L+N A + +  +    +S
Sbjct: 139 YKERFPELSSLIPSPLQYSKVVTILENE-NWSGNESDKLSIHLENKANLTKEQLLVLTMS 197

Query: 258 MGQDLSET-----DMDNVCVFA-ERVTSLADYRRQLYEYLCSKMHTVAPNLSELIGEVIG 311
           +    +       D   +   A   + +L + ++ + +Y+ SK+  +APN+  L+G  + 
Sbjct: 198 LKTSFNNQKPLVGDTKKLVFEAGSMLNNLWELQKDVGQYITSKISLIAPNMCFLVGSEVT 257

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFIGKAAAKN 370
           A+L++HAG +   S+  +  +  +G  K L   L T +    + G ++++  I       
Sbjct: 258 AQLLAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFNTELIQDFPIAI 317

Query: 371 KGRISRYLANKCSIASRID 389
             ++ R L  K ++A+R+D
Sbjct: 318 HRQMLRILCAKVTLAARVD 336

>ADR032W Chr4 (763161..764480) [1320 bp, 439 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR091W (PRP31)
          Length = 439

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 92/203 (45%), Gaps = 26/203 (12%)

Query: 202 FPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDNDAGIAERVIDNARISMGQD 261
           FPELA+LVP    + +++  ++  A L E    + + ++      A R  D AR      
Sbjct: 93  FPELAELVPSQRTYVRVLRALETGAPLDELLTREQAMLVAMTRPQAPRA-DPAR------ 145

Query: 262 LSETDMDNVCVFAERVTSLADYRRQLYE-------YLCSKMHTVAPNLSELIGEVIGARL 314
                      +   +   AD   QL+        ++  + H +AP ++ L+G V+ A L
Sbjct: 146 -----------WPRELAPHADRHEQLHTAVDAIDAHIVRQAHRLAPTVTALVGPVVAAAL 194

Query: 315 ISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKY-GLIYHSGFIGKAAAKNKGR 373
           +SHAGS+  L++  A  +  +GA +    A +T  +  +  G ++ +  + +     + +
Sbjct: 195 LSHAGSVRELAQVPACNLAAIGAPRHAAHARRTDASGVRLRGHVWDTPLVQEQPPALQRQ 254

Query: 374 ISRYLANKCSIASRIDNYSDEPT 396
             R L  + ++A+R+D  + +P 
Sbjct: 255 ALRMLCARLALAARVDASAPDPA 277

>Smik_6.177 Chr6 (289760..291208) [1449 bp, 482 aa] {ON} YGR091W
           (REAL)
          Length = 482

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 98/209 (46%), Gaps = 11/209 (5%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDNDAGIAERVIDNARIS 257
           Y   FPEL+ L+P   +++++++ ++ +    +  +  L   L+N A +++  +    +S
Sbjct: 120 YKERFPELSTLIPSPLQYSKVIILLEGE-DWQKSEIDKLFPQLENIAHLSKEQVLVLTMS 178

Query: 258 MGQDLSETDMDNVCVFAERVTS------LADYRRQLYEYLCSKMHTVAPNLSELIGEVIG 311
           M       +  N     + + +      L   +  L +Y+ SK+  +APN+  L+G  + 
Sbjct: 179 MRTSFKSKEPLNFQTRTQILETNTILENLWQIQADLEQYIASKISLIAPNMCFLVGSEVT 238

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFIGKAAAKN 370
           A+L+++AG +   S+  +  +  +G  K L   L T +    + G ++ +  I       
Sbjct: 239 AQLLAYAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFTTDLIQSFPVAI 298

Query: 371 KGRISRYLANKCSIASRID---NYSDEPT 396
             ++ R L  K ++A+R+D    Y D+ T
Sbjct: 299 HKQMLRMLCAKVTLAARVDAGQRYDDKNT 327

>Ecym_4449 Chr4 complement(919492..920880) [1389 bp, 462 aa] {ON}
           similar to Ashbya gossypii ADR032W
          Length = 462

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 93/210 (44%), Gaps = 18/210 (8%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDNDAGIAERVIDNARIS 257
           Y   FPEL  +V +  K+  +V  ++ +  + E     L  +L+ +  +         ++
Sbjct: 101 YNKRFPELPNVVSEQEKYVSVVKELEARPDVPE-----LGKLLNKEQMLL------VSMT 149

Query: 258 MGQDLSETDMDNVCVFAERVTS---LADYRRQLYEYLCSKMHTVAPNLSELIGEVIGARL 314
           M     +    +  V AE +     L   +  +  Y+  KMHT+APN+  L+G+ + A L
Sbjct: 150 MQTGFHKEYKVDSPVIAELIDQYEVLHALKSDITTYISKKMHTIAPNVCALVGQEVAAAL 209

Query: 315 ISHAGSLTNLSKQAASTVQILGAEKAL--FRALKTKGNTPKYGLIYHSGFIGKAAAKNKG 372
           +++ G +  LS+  +  +  +G  K L   + L T G   K G I+    +       + 
Sbjct: 210 LTYTGGMKELSEIPSCNLASIGKTKHLSHVQQLDTSGVRQK-GYIFDCELVQSQPEALQK 268

Query: 373 RISRYLANKCSIASRIDNYSDEPTNVFGTV 402
           +  R +  K ++ASR+D Y     N  G++
Sbjct: 269 QALRMICAKLALASRVD-YLHHQENTHGSL 297

>KLLA0D14883g Chr4 (1254381..1255784) [1404 bp, 467 aa] {ON} weakly
           similar to uniprot|P49704 Saccharomyces cerevisiae
           YGR091W PRP31 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 467

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 99/220 (45%), Gaps = 12/220 (5%)

Query: 172 HIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLV-LFIKDKASLSE 230
           ++I+   L+   D +++     + + Y   FP L  +VP+  ++  +V +  +D  ++  
Sbjct: 88  NVIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQQDIPNVQL 147

Query: 231 DSLHDLSAILDNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEY 290
           D +      L     +     + ARI         D D +         L + R  +  Y
Sbjct: 148 DQVLSKEETLVVSMSLKTDFKEGARI---------DKDLLSKAIHWFDILYNLRDNVSHY 198

Query: 291 LCSKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALF-RALKTKG 349
           + +++  VAPNL  L+G    A+L++H GS+  LS   +  +  +G +K L  ++L   G
Sbjct: 199 VETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTLHGKSLDISG 258

Query: 350 NTPKYGLIYHSGFIGKAAAKNKGRISRYLANKCSIASRID 389
              K G ++++  +     + + +  R ++ K ++A+R D
Sbjct: 259 VRQK-GYLFYTDVVQTQPPEFQKQALRMVSAKVALAARAD 297

>SAKL0F06050g Chr6 (454404..455825) [1422 bp, 473 aa] {ON} similar
           to uniprot|P49704 Saccharomyces cerevisiae YGR091W PRP31
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 473

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 102/221 (46%), Gaps = 9/221 (4%)

Query: 194 VKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAILDNDAGIAERVIDN 253
           +K  Y   F EL  LV     +++L+ F++   S + D L  L  IL  +  +   V  +
Sbjct: 113 IKSLYSKKFSELDSLVNPPRSYSKLIKFLE--TSDARD-LSTLEGILSKEQILI--VSMS 167

Query: 254 ARISMGQDLS-ETDMDNVCVFA-ERVTSLADYRRQLYEYLCSKMHTVAPNLSELIGEVIG 311
            +    +DL+  +D     + A + +  L D + ++  ++ S++  +APN+  ++G  + 
Sbjct: 168 MKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQVA 227

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLIYHSGFIGKAAAKN 370
           ++++S AG L  LS+  +  +  +G ++ +   + T      + G +Y    I       
Sbjct: 228 SKILSAAGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQPPHV 287

Query: 371 KGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRL 411
             +  R +  K S+A+R+D  S+   N  G     ++ ++L
Sbjct: 288 HKQALRMVCAKVSLAARVD-ISNNKDNSLGVKWANEISEKL 327

>KLTH0F12034g Chr6 complement(1015072..1016646) [1575 bp, 524 aa]
           {ON} weakly similar to uniprot|P49704 Saccharomyces
           cerevisiae YGR091W PRP31 Splicing factor component of
           the U4/U6-U5 snRNP complex
          Length = 524

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 115/283 (40%), Gaps = 35/283 (12%)

Query: 173 IIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDS 232
           I Q ++LL +L          +   Y   FPEL  L+     +A++V  ++ K    +  
Sbjct: 139 IQQEVSLLRKL----------IASIYDQKFPELESLIASANSYAKVVRLLETKGG-GKLE 187

Query: 233 LHDLSAILDNDAGIAERVIDNARISMGQDLSETD----MDNVCVFAERVTSLADYRRQLY 288
           L +L   +  +  +   +  +       +L+  D    MD++ V  E    L D +  + 
Sbjct: 188 LQELQDTISREQLLVLSMAMHTGFRQETNLAPKDSELLMDSINVLLE----LCDLQDSIA 243

Query: 289 EYLCSKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALK-T 347
           +Y+ S +  VAPNL  L+G    A LI+ AG L  LS+  +  +  +G  K +   L   
Sbjct: 244 QYVASLISQVAPNLCALVGPATSAALIAAAGGLLELSEMPSCNLASIGNSKRISSELDFH 303

Query: 348 KGNTPKYGLIYHSGFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQV 407
           +    + G IYHS  +       + +  R +  K S+  R+D   + P    G   ++ V
Sbjct: 304 ESGVRQRGHIYHSSLVSGQPVTIQKQALRMVCAKVSLCVRVDVSKNSPGGELGLKWRQDV 363

Query: 408 EQRLEFYSTGSPTLKNELAIQEAIELYNKDKPEEPVKESKKRK 450
            +RL       P L N  A+              PV E K +K
Sbjct: 364 LKRLRGL-LDPPNLSNTKAL--------------PVPEDKPKK 391

>CAGL0G03025g Chr7 (280230..281669) [1440 bp, 479 aa] {ON} similar
           to uniprot|P49704 Saccharomyces cerevisiae YGR091w PRP31
           pre-mRNA splicing protein
          Length = 479

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/258 (19%), Positives = 113/258 (43%), Gaps = 16/258 (6%)

Query: 164 FSVQKNDNHIIQAIALLDQLDKDINTFA-MRVKEWYGWHFPELAKLVPDNYKFAQLVLFI 222
            ++  N+  II+ +  + Q  K I+      + E Y   F EL  ++   +++AQ +  +
Sbjct: 100 IAISSNEPEIIKTLNEIQQYCKVISEKCYFELTEIYEDKFSELKSILRLPHQYAQCISLL 159

Query: 223 KDKASLSEDSLHDLSAILDNDAGIAERVIDNARISMGQD------LSETDMDNVCVFAER 276
           +    L +  L       +     +  +I    +S+  D      L++T+  ++      
Sbjct: 160 EQGLELEQVVLR-----FEELCSTSRELIMVLNMSLRADYKGNYKLTDTNKKSLHKLTSI 214

Query: 277 VTSLADYRRQLYEYLCSKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILG 336
           +    D  R +   + +++  +APNL  L+G    + L+SH G L  LSK  +  +  +G
Sbjct: 215 IFEAHDIIRFVSVEIANRIGEIAPNLCALLGTNTASLLVSHTGGLLQLSKIPSCNIANIG 274

Query: 337 AEKALFRALKTKGNTPKYGLIYHSGFIGKAAAKNKGRISRYLANKCSIASRIDN--YSDE 394
            +      +    N    G I+ +  +     +N  ++ R L++K S+A+R+D    + +
Sbjct: 275 KKNTKDHNILNFSNPG--GYIFQNELVQNQPIENHKQMMRMLSSKVSLAARVDAGLKTGD 332

Query: 395 PTNVFGTVLKKQVEQRLE 412
             N  G   + ++E++++
Sbjct: 333 KNNKLGKQWRVEIEEKIK 350

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 285 RQLYEYLCSKMHTVAPNLSELIGEVIGARLISHA 318
           ++LYEYL +K H      SEL  +++GA   +H+
Sbjct: 113 KELYEYLLAKKHIPLEECSELFSQIVGAVYYAHS 146

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,370,375
Number of extensions: 1803578
Number of successful extensions: 5965
Number of sequences better than 10.0: 74
Number of HSP's gapped: 6089
Number of HSP's successfully gapped: 74
Length of query: 507
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 393
Effective length of database: 40,409,475
Effective search space: 15880923675
Effective search space used: 15880923675
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)