Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.246487.352ON1131135644e-76
KLTH0H01210g7.352ON1131104715e-62
SAKL0F11418g7.352ON1151073735e-47
KLLA0D12298g7.352ON1151033571e-44
TPHA0F029907.352ON1071003543e-44
Kpol_530.297.352ON1071053501e-43
TBLA0E004407.352ON1151083413e-42
KAFR0L014907.352ON1071003388e-42
CAGL0A03971g7.352ON1061023371e-41
KNAG0B026107.352ON119973381e-41
Suva_10.2957.352ON1141053362e-41
TDEL0C019607.352ON1071043335e-41
YLR200W (YKE2)7.352ON1141003328e-41
Skud_12.2647.352ON1141053292e-40
ZYRO0F11748g7.352ON1091003232e-39
NDAI0E044607.352ON1061013232e-39
ACL146C7.352ON1071023232e-39
Smik_12.2597.352ON1141053223e-39
Ecym_47217.352ON1071023213e-39
NCAS0E028607.352ON1051003204e-39
TPHA0I027701.290ON129120651.6
SAKL0E06864gna 1ON57372642.0
Kwal_23.51038.81ON83194623.5
TDEL0F045108.326ON74342623.8
YOR132W (VPS17)5.466ON551107614.9
Kpol_1044.137.101ON110383615.3
KLLA0F19085g8.259ON137251607.0
KNAG0M02650singletonON57447607.7
Skud_15.2965.466ON545107598.9
TBLA0H033008.415ON108125599.2
AFR637W1.110ON129648599.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.24648
         (113 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa] ...   221   4e-76
KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar...   186   5e-62
SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {O...   148   5e-47
KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} simil...   142   1e-44
TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON...   140   3e-44
Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON} (74361..74...   139   1e-43
TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352 ...   135   3e-42
KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {O...   134   8e-42
CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {O...   134   1e-41
KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.35...   134   1e-41
Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...   134   2e-41
TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.35...   132   5e-41
YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subuni...   132   8e-41
Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W...   131   2e-40
ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {O...   129   2e-39
NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7....   129   2e-39
ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON} Synt...   129   2e-39
Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W...   128   3e-39
Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar ...   128   3e-39
NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.35...   127   4e-39
TPHA0I02770 Chr9 (610421..614296) [3876 bp, 1291 aa] {ON} Anc_1....    30   1.6  
SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} simila...    29   2.0  
Kwal_23.5103 s23 (1011740..1014235) [2496 bp, 831 aa] {ON} YPL00...    28   3.5  
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    28   3.8  
YOR132W Chr15 (573175..574830) [1656 bp, 551 aa] {ON}  VPS17Subu...    28   4.9  
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    28   5.3  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...    28   7.0  
KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {...    28   7.7  
Skud_15.296 Chr15 (529599..531236) [1638 bp, 545 aa] {ON} YOR132...    27   8.9  
TBLA0H03300 Chr8 (805828..809073) [3246 bp, 1081 aa] {ON} Anc_8....    27   9.2  
AFR637W Chr6 (1599134..1603024) [3891 bp, 1296 aa] {ON} Syntenic...    27   9.8  

>Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa]
           {ON} YLR200W (YKE2) - Polypeptide 6 of a Yeast
           Non-native Actin Binding Complex, homolog of a component
           of the bovine NABC complex [contig 161] FULL
          Length = 113

 Score =  221 bits (564), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 113/113 (100%), Positives = 113/113 (100%)

Query: 1   MSSSAQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVL 60
           MSSSAQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVL
Sbjct: 1   MSSSAQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVL 60

Query: 61  LPVEQFEAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEASKR 113
           LPVEQFEAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEASKR
Sbjct: 61  LPVEQFEAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEASKR 113

>KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar to
           uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 113

 Score =  186 bits (471), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 93/110 (84%), Positives = 99/110 (90%)

Query: 1   MSSSAQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVL 60
           MSSSAQ+LTMNY T+Q ELEELV ARQ+LETQLQENKIVQDEFD L+EETQVYKLTG VL
Sbjct: 1   MSSSAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVL 60

Query: 61  LPVEQFEAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEA 110
           LPVEQFEAKSNVSKRLEFI  EI RCE+NIK KQ LLEKLRAELLQ Q+A
Sbjct: 61  LPVEQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQA 110

>SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200W YKE2 Yeast nuclear gene
          Length = 115

 Score =  148 bits (373), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 91/107 (85%)

Query: 4   SAQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPV 63
           +AQ+L+M YTT Q ELE+LV ARQ+LETQLQENKIVQDEFD+L++E+QVYKLTG VLLPV
Sbjct: 5   NAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPV 64

Query: 64  EQFEAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEA 110
           EQ EAK NV KRL+FI  EI RCE+NIK KQ+ LE+LR EL++ + A
Sbjct: 65  EQEEAKGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELVRLRTA 111

>KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} similar
           to uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 115

 Score =  142 bits (357), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 73/103 (70%), Positives = 82/103 (79%)

Query: 4   SAQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPV 63
           SA+E T  YT  Q ELEEL+ ARQ+LETQLQENKIV DEF SLK++  VYKLTG VLLPV
Sbjct: 2   SAEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPV 61

Query: 64  EQFEAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQ 106
           EQFEAK NV KRLEFI  EIKRCE NIK+KQ  LE  R+EL++
Sbjct: 62  EQFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMK 104

>TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  140 bits (354), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 82/100 (82%)

Query: 12  YTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQFEAKSN 71
           Y + Q ELEEL+ ARQ+LETQLQENKIV DEF+ L E+T +YKLTG V+LP+EQFEAKSN
Sbjct: 8   YQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQFEAKSN 67

Query: 72  VSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEAS 111
           V KRLEFI  EIKRCE+NIK KQ  L+KLR EL++ + A+
Sbjct: 68  VEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGAN 107

>Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON}
           (74361..74684) [324 nt, 108 aa]
          Length = 107

 Score =  139 bits (350), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 69/105 (65%), Positives = 85/105 (80%)

Query: 7   ELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQF 66
           +L   Y   Q ELEE++ AR++LETQLQENKIV +EF+ LKE+TQVYKLTG VLLPVEQF
Sbjct: 3   DLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQF 62

Query: 67  EAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEAS 111
           EA+SNV KRLEFI  EIK+CEDNIK+KQ+ L KLR EL++ +  +
Sbjct: 63  EARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGGA 107

>TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352
           YLR200W
          Length = 115

 Score =  135 bits (341), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 68/108 (62%), Positives = 82/108 (75%)

Query: 4   SAQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPV 63
           S+ EL   Y T Q ELE  +  RQ+LETQLQENKIV DEF+ LKEET+V+KLTG VLLP+
Sbjct: 2   SSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPI 61

Query: 64  EQFEAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEAS 111
           EQ EA+SN+ KRLEFI TEI RCE NIK KQ+ +EK+R+EL+    A 
Sbjct: 62  EQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELMATAPAP 109

>KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  134 bits (338), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 79/100 (79%)

Query: 7   ELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQF 66
           EL   Y   Q ELEEL+ ARQ+LETQLQENKIV DEF SLKEETQVYKLTG VLLP+EQ 
Sbjct: 3   ELAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNVLLPIEQD 62

Query: 67  EAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQ 106
           EA+ NV KRLEFI  EI RCE NIK+KQ+ +E +R EL++
Sbjct: 63  EARGNVDKRLEFIEKEITRCEGNIKSKQTEIENIRNELVK 102

>CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200w YKE2 Gim complex component
          Length = 106

 Score =  134 bits (337), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 81/102 (79%)

Query: 7   ELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQF 66
           EL   Y + Q ELEELVTARQ+LETQLQENKIV +EF +LKE+T VYKLTG VLLPVE  
Sbjct: 4   ELGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNVLLPVEHD 63

Query: 67  EAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQ 108
           +AK+NV KRLEFI  EIKRCEDNI++KQ  LE +R +L+  Q
Sbjct: 64  DAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLISQQ 105

>KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.352
           YLR200W
          Length = 119

 Score =  134 bits (338), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 81/97 (83%)

Query: 12  YTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQFEAKSN 71
           Y  AQ  LEEL+ ARQ+LETQLQENKIV +EFD+LKE+++VYKLTG VLLPV+Q EA++N
Sbjct: 8   YQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVDQDEARTN 67

Query: 72  VSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQ 108
           V KRLEFIN EI RCE+NIK KQ  LE LR+EL++ Q
Sbjct: 68  VDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQ 104

>Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  134 bits (336), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 69/105 (65%), Positives = 80/105 (76%)

Query: 7   ELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQF 66
           EL   Y   Q ELEE + ARQ+LETQLQENKIV +EFD LKE+T VYKLTG VLLPVEQ 
Sbjct: 3   ELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQS 62

Query: 67  EAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEAS 111
           EA+ NV KRLEFI TEIKRCE NI+ KQ  LE++R EL++   A+
Sbjct: 63  EARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAA 107

>TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.352
           YLR200W
          Length = 107

 Score =  132 bits (333), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 81/104 (77%)

Query: 7   ELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQF 66
           +L   Y   Q ELE LV ARQ+LETQLQENKIV +EF  LKE+TQVYKLTG VLLPVEQ 
Sbjct: 3   DLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVEQS 62

Query: 67  EAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEA 110
           EA SNV+KRLEFI TEI RCE+N+K KQ   EKLRAEL++ + A
Sbjct: 63  EANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGA 106

>YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subunit
           of the heterohexameric Gim/prefoldin protein complex
           involved in the folding of alpha-tubulin, beta-tubulin,
           and actin
          Length = 114

 Score =  132 bits (332), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 80/100 (80%)

Query: 7   ELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQF 66
           EL   Y   Q ELEE + ARQ+LETQLQENKIV +EFD L+E+T VYKLTG VLLPVEQ 
Sbjct: 3   ELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQS 62

Query: 67  EAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQ 106
           EA++NV KRLEFI TEI RCE NI++KQ  LEK+R+EL++
Sbjct: 63  EARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIK 102

>Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  131 bits (329), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 67/105 (63%), Positives = 79/105 (75%)

Query: 7   ELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQF 66
           EL   Y   Q ELEE + ARQ+LETQLQENKIV +EFD + ++T VYKLTG VLLPVEQ 
Sbjct: 3   ELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQS 62

Query: 67  EAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEAS 111
           EA+ NV KRLEFI TEIKRCE NI+ KQ  LEK+R EL++   A+
Sbjct: 63  EARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNAT 107

>ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {ON}
           highly similar to uniprot|P52553 Saccharomyces
           cerevisiae YLR200W YKE2 Yeast nuclear gene
          Length = 109

 Score =  129 bits (323), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%)

Query: 7   ELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQF 66
           EL   Y   Q ELE  + ARQ+LETQLQENKIV DEF+ LK +++VYKLTG VLLPVEQ 
Sbjct: 3   ELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVEQD 62

Query: 67  EAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQ 106
           +A++NVSKRLEFI TEI RCE+NIK KQ   E+++AEL++
Sbjct: 63  DARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIK 102

>NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7.352
           YLR200W
          Length = 106

 Score =  129 bits (323), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 78/101 (77%)

Query: 5   AQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVE 64
           A  L   Y   Q ELE+L+ ARQ+LETQLQENKIV +EF+ L  E+QVYKLTG VLLPV+
Sbjct: 2   ASNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVD 61

Query: 65  QFEAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELL 105
           Q EA SNV KRLEFI TEI RCE+NIKNKQ  L+ +R+E+L
Sbjct: 62  QEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEIL 102

>ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR200W
           (YKE2)
          Length = 107

 Score =  129 bits (323), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 78/102 (76%)

Query: 4   SAQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPV 63
           SA+++   YT  Q ELEELV  RQ+LETQLQENKIV +E  +L+ ETQVYKLTG VLLPV
Sbjct: 2   SAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPV 61

Query: 64  EQFEAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELL 105
           EQ EA+ NVSKRLEFI  EI+RCE NIK KQ  +E  RA L+
Sbjct: 62  EQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALV 103

>Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  128 bits (322), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 66/105 (62%), Positives = 78/105 (74%)

Query: 7   ELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQF 66
           EL   Y   Q ELEE + ARQ+LETQLQENKIV +EFD L+E T VYKLTG VLLPV+Q 
Sbjct: 3   ELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQS 62

Query: 67  EAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEAS 111
           EA+ NV KRLEFI  EI RCE NIK+KQ  LEK+R +L++   A+
Sbjct: 63  EARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNAA 107

>Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar to
           Ashbya gossypii ACL146C
          Length = 107

 Score =  128 bits (321), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 77/102 (75%)

Query: 4   SAQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPV 63
           S +++   YT  Q ELE+L+  RQ+LETQLQENKIV +E  SLKE+ QVYKLTG VLLPV
Sbjct: 2   SVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPV 61

Query: 64  EQFEAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELL 105
           E  EA SNVSKRLEFI  EI RCE NIKNKQ  LE+ R EL+
Sbjct: 62  EHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELI 103

>NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.352
           YLR200W
          Length = 105

 Score =  127 bits (320), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%)

Query: 7   ELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQF 66
           +L   Y + Q ELE  + ARQ+LETQLQENKIV DEF+ L +ET+VYKLTG VLLPVEQ 
Sbjct: 3   DLPAQYQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNVLLPVEQD 62

Query: 67  EAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQ 106
           EA+SNV KRLEFI +EI +CE NIK KQ  LEK+RAE+++
Sbjct: 63  EARSNVEKRLEFIQSEITKCEKNIKQKQEELEKVRAEIIK 102

>TPHA0I02770 Chr9 (610421..614296) [3876 bp, 1291 aa] {ON} Anc_1.290
           YJL080C
          Length = 1291

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 15/20 (75%)

Query: 71  NVSKRLEFINTEIKRCEDNI 90
           NV + +EFINTEIKR  D I
Sbjct: 772 NVKRAVEFINTEIKRWSDII 791

>SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} similar
           to uniprot|Q9HFF8 Saccharomyces carlsbergensis FSY1
           Fructose symporter
          Length = 573

 Score = 29.3 bits (64), Expect = 2.0,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 5/72 (6%)

Query: 36  NKIVQDEF-DSLKEETQVYKLTGKVLLPVEQFEAKSNV--SKRLEFIN--TEIKRCEDNI 90
           + + QDE    +K E  VY+    V   +E     +N+  +KR       +EI+   D+ 
Sbjct: 18  SSLFQDEIKQEIKHEEDVYEDPTAVKFDIESETGGANLMLNKRFNLDQEISEIEALADSF 77

Query: 91  KNKQSLLEKLRA 102
           K +++ +EKLRA
Sbjct: 78  KKERTFIEKLRA 89

>Kwal_23.5103 s23 (1011740..1014235) [2496 bp, 831 aa] {ON} YPL008W
           (CHL1) - kinetochore protein in the DEAH box family
           [contig 7] FULL
          Length = 831

 Score = 28.5 bits (62), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 47/94 (50%), Gaps = 16/94 (17%)

Query: 19  LEELVTARQRLETQLQENKIVQDEFDSLK-------EETQVYKLTGKVLLPVEQFEAKSN 71
           L  L T    L   L++N     EFDS++       +   +YKL        E +  K+ 
Sbjct: 424 LRRLSTLIDILSAFLEKNYKNGREFDSIEIFDGTNADTLNIYKL--------ETYMKKTK 475

Query: 72  VSKRLE-FINTEIKRCEDNIKNKQSLLEKLRAEL 104
           ++ +++ +I ++++  +DNI +KQ +L K+ A L
Sbjct: 476 IAYKIDSYIQSQLEVADDNIPHKQPILFKVAAFL 509

>TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {ON}
           Anc_8.326 YLR131C
          Length = 743

 Score = 28.5 bits (62), Expect = 3.8,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 5/42 (11%)

Query: 16  QQELEELVTARQ-----RLETQLQENKIVQDEFDSLKEETQV 52
           QQE   L   RQ     RLE QLQENK+ Q+    + +E ++
Sbjct: 168 QQEQLRLALERQHEVNKRLEQQLQENKLQQERLQRVLDEQEM 209

>YOR132W Chr15 (573175..574830) [1656 bp, 551 aa] {ON}  VPS17Subunit
           of the membrane-associated retromer complex essential
           for endosome-to-Golgi retrograde protein transport;
           peripheral membrane protein that assembles onto the
           membrane with Vps5p to promote vesicle formation
          Length = 551

 Score = 28.1 bits (61), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 50/107 (46%), Gaps = 10/107 (9%)

Query: 12  YTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQFEA--- 68
           Y  +Q   E+L+   +  +  +QE      +F +L E  ++Y+  GK+L  V   ++   
Sbjct: 269 YVVSQSLQEKLLRVSRNRKMMVQEENAFGQDFVNLDEHNKLYRRYGKILTAVGDIDSIIA 328

Query: 69  ---KSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEASK 112
               + +   LE+I  +    ++ + N+  ++      L+QAQ+ SK
Sbjct: 329 TMDMATLYDGLEWIVRDAYAVKEALTNRHFIMRN----LVQAQQNSK 371

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
           complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 28.1 bits (61), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 49/83 (59%), Gaps = 8/83 (9%)

Query: 12  YTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLP--VEQFEAK 69
           ++  ++ELE++V +   L+ +L+     +D ++  KEET+ Y    K ++   +E+ + K
Sbjct: 811 FSNKEKELEDVVAS---LKNELRTKNNTED-YERWKEETRSYTEERKKIIEKYIEKCKDK 866

Query: 70  SNVSKRLEFINTEIKRCEDNIKN 92
            N++  ++FI+ EI R E  +KN
Sbjct: 867 DNLT--VDFIDREISRLESTLKN 887

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON}
           similar to uniprot|Q12267 Saccharomyces cerevisiae
           YLR086W SMC4 subunit of the condensin complex which
           reorganizes chromosomes during cell division
          Length = 1372

 Score = 27.7 bits (60), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 1   MSSSAQELTMNYTTAQQELEE---LVTARQRLETQLQENKIVQDEFDSLKE 48
           +S  A+EL+MN    Q  L+E   L   RQ L+  +  +K  QD+ D LK+
Sbjct: 880 LSQLARELSMNEKNQQPLLDEEKKLDILRQHLQQTIDASKFSQDKIDDLKD 930

>KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa]
          {ON} 
          Length = 574

 Score = 27.7 bits (60), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 5/47 (10%)

Query: 31 TQLQENKIVQDEFDSLKEETQ-----VYKLTGKVLLPVEQFEAKSNV 72
          T L+ NK V  E+   K +T        +LTG +  PVE  + +SN+
Sbjct: 2  TDLEVNKTVDGEYGYKKYDTHEGILFCIELTGTLFEPVESLQGRSNL 48

>Skud_15.296 Chr15 (529599..531236) [1638 bp, 545 aa] {ON} YOR132W
           (REAL)
          Length = 545

 Score = 27.3 bits (59), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 23/107 (21%), Positives = 49/107 (45%), Gaps = 10/107 (9%)

Query: 12  YTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQFEA--- 68
           Y  +Q   E+L+   +     +QE      +F +L +  ++YK  GK+L  V   ++   
Sbjct: 263 YVVSQNLQEKLLKVSRNRRMMVQEENAFGQDFVNLDDHNKLYKRYGKILTAVGDIDSIIA 322

Query: 69  ---KSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEASK 112
               + +   LE++  +    ++ + N+  ++      L+QAQ+ SK
Sbjct: 323 TMDMATLYDGLEWVIRDTYVVKEALTNRHFIMRN----LIQAQQNSK 365

>TBLA0H03300 Chr8 (805828..809073) [3246 bp, 1081 aa] {ON} Anc_8.415
           YDR206W
          Length = 1081

 Score = 27.3 bits (59), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 9/25 (36%), Positives = 19/25 (76%)

Query: 33  LQENKIVQDEFDSLKEETQVYKLTG 57
             +N I++++FD + + TQVY+++G
Sbjct: 311 FDKNSIIREKFDEILKSTQVYEISG 335

>AFR637W Chr6 (1599134..1603024) [3891 bp, 1296 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL250W (RAD50)
          Length = 1296

 Score = 27.3 bits (59), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 39  VQDEFDSLKEETQVYKLTGKVLLPVEQFEAK-SNVSKRLEFINTEIKR 85
           V+ E+  L +E ++Y  + + +  VE+ + K +N+++RL  +  E+ R
Sbjct: 794 VEGEYGRLSDEVKIYGGSSEGVYTVEELQRKQTNINERLRVLRKEVGR 841

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.122    0.301 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,148,501
Number of extensions: 396385
Number of successful extensions: 3172
Number of sequences better than 10.0: 356
Number of HSP's gapped: 3152
Number of HSP's successfully gapped: 394
Length of query: 113
Length of database: 53,481,399
Length adjustment: 83
Effective length of query: 30
Effective length of database: 43,964,121
Effective search space: 1318923630
Effective search space used: 1318923630
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 59 (27.3 bits)