Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.246447.351ON25825813030.0
KLTH0H01232g7.351ON25725810411e-144
SAKL0F11396g7.351ON2542587551e-101
KLLA0D12320g7.351ON2502467437e-99
ZYRO0F11726g7.351ON2512467314e-97
TDEL0C019707.351ON2602597231e-95
Kpol_530.307.351ON2602477003e-92
YLR201C (COQ9)7.351ON2602616752e-88
Suva_10.2967.351ON2602466673e-87
KNAG0B026207.351ON2652496501e-84
ACL147W7.351ON2462486463e-84
Skud_12.2657.351ON2602476396e-83
TPHA0F029807.351ON2642576266e-81
Ecym_47227.351ON2532486204e-80
CAGL0A03949g7.351ON2682466153e-79
NCAS0E028707.351ON2612676083e-78
TBLA0E004507.351ON2792585991e-76
Smik_12.2607.351ON2602615935e-76
NDAI0E044707.351ON2642585711e-72
KAFR0L014807.351ON2642525667e-72
Ecym_71517.403ON53632702.3
KLTH0G12892g8.295ON492893684.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.24644
         (258 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   506   0.0  
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   405   e-144
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   295   e-101
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   290   7e-99
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   286   4e-97
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   283   1e-95
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   274   3e-92
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   264   2e-88
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   261   3e-87
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   254   1e-84
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   253   3e-84
Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   250   6e-83
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   245   6e-81
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   243   4e-80
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   241   3e-79
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   238   3e-78
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   235   1e-76
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   233   5e-76
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   224   1e-72
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   222   7e-72
Ecym_7151 Chr7 complement(311699..313309) [1611 bp, 536 aa] {ON}...    32   2.3  
KLTH0G12892g Chr7 (1095023..1109809) [14787 bp, 4928 aa] {ON} si...    31   4.3  

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  506 bits (1303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/258 (95%), Positives = 247/258 (95%)

Query: 1   MLARSFRTLGRRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERAL 60
           MLARSFRTLGRRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERAL
Sbjct: 1   MLARSFRTLGRRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERAL 60

Query: 61  VASLNDLGLGSQVLSSIGAXXXXXXXXXXXAVLELVKFHLVTKRYALTKDLDIARCASPA 120
           VASLNDLGLGSQVLSSIGA           AVLELVKFHLVTKRYALTKDLDIARCASPA
Sbjct: 61  VASLNDLGLGSQVLSSIGAPNSPPLLNSSPAVLELVKFHLVTKRYALTKDLDIARCASPA 120

Query: 121 EPPALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPD 180
           EPPALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPD
Sbjct: 121 EPPALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPD 180

Query: 181 ANDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYM 240
           ANDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYM
Sbjct: 181 ANDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYM 240

Query: 241 WYTLLMSVNLAKSQITRS 258
           WYTLLMSVNLAKSQITRS
Sbjct: 241 WYTLLMSVNLAKSQITRS 258

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  405 bits (1041), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 198/258 (76%), Positives = 218/258 (84%), Gaps = 1/258 (0%)

Query: 1   MLARSFRTLGRRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERAL 60
           MLA S R L RR Y P+ LE+QL    APL YG  S QFKVL+HAL  HVPSYGFNERAL
Sbjct: 1   MLALS-RILARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERAL 59

Query: 61  VASLNDLGLGSQVLSSIGAXXXXXXXXXXXAVLELVKFHLVTKRYALTKDLDIARCASPA 120
           VASLNDL LG  +LS IGA           AVLEL+KFHLVTKRYALTK+LD AR +SPA
Sbjct: 60  VASLNDLDLGPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPA 119

Query: 121 EPPALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPD 180
           EPPALETLFH+RLELN PIA H+TQLL+ L++PGEFL+Q+ALPELHRLSDDM+YFSKEPD
Sbjct: 120 EPPALETLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPD 179

Query: 181 ANDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYM 240
           ANDFAWYSKR A+SCAFVSSELFMAQD+S NYADTFEFAA+KLHNV+KLGQYY NTEEYM
Sbjct: 180 ANDFAWYSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYM 239

Query: 241 WYTLLMSVNLAKSQITRS 258
           WYTLLMSVNLAKSQ+TRS
Sbjct: 240 WYTLLMSVNLAKSQLTRS 257

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  295 bits (755), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 182/258 (70%), Gaps = 4/258 (1%)

Query: 1   MLARSFRTLGRRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERAL 60
           M  ++F  + RR Y PN LE+  +  L PL Y   S Q+K+L +AL   VP YGFNERAL
Sbjct: 1   MFKQAFSKIARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERAL 60

Query: 61  VASLNDLGLGSQVLSSIGAXXXXXXXXXXXAVLELVKFHLVTKRYALTKDLDIARCASPA 120
            +S +DLG  S  LS +GA           AVLEL+KFHLV+KRY+LT  +         
Sbjct: 61  TSSCSDLGYSSSFLSVLGASNSPSFFNSSPAVLELLKFHLVSKRYSLTDGV----ADGTL 116

Query: 121 EPPALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPD 180
           E P+LE LF KRLE+N PIA H++QLL+ LA+PG FL + A+PELHRLSDDM+YFS EPD
Sbjct: 117 ESPSLENLFLKRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPD 176

Query: 181 ANDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYM 240
            NDFAWYSKR AIS A+VSSELFMAQDKS +Y DT +FA +KL N+ +LG+ Y N EEY 
Sbjct: 177 HNDFAWYSKRLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYA 236

Query: 241 WYTLLMSVNLAKSQITRS 258
           WYTLL S++LAKSQ+TRS
Sbjct: 237 WYTLLSSISLAKSQMTRS 254

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  290 bits (743), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 144/246 (58%), Positives = 181/246 (73%), Gaps = 3/246 (1%)

Query: 12  RFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLGS 71
           R Y PN LE+ L   + PL YGT S+QFKVL +AL  HVP YGFNERA+V SLN+LG+GS
Sbjct: 7   RLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNELGMGS 66

Query: 72  QVLSSIGAXXXXXXXXXXXAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETLFHK 131
             LS +G+           +VLELVKFHLV+KR  L  DL +    S    P L+TLF +
Sbjct: 67  SYLSVLGSSNSPSFFNVSPSVLELVKFHLVSKRNQLITDLPLD---SDKPLPDLKTLFLQ 123

Query: 132 RLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKRA 191
           RL+LN  +A H++QLL+I+++PGEFL  +AL ELH+L+DDMI++S E D NDFAWYSKR 
Sbjct: 124 RLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKRI 183

Query: 192 AISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNLA 251
           A+S A+VSSELFMAQDKS N+ +T EFA  KL+ V++LG  Y NTEEY+W+TLL S+NLA
Sbjct: 184 ALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINLA 243

Query: 252 KSQITR 257
           KSQITR
Sbjct: 244 KSQITR 249

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  286 bits (731), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 144/246 (58%), Positives = 177/246 (71%), Gaps = 6/246 (2%)

Query: 12  RFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLGS 71
           R Y P+  E+  +++L PL YG  S Q+ VL HALK  VP  GFNERA+V SLN L   S
Sbjct: 11  RRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNYPS 70

Query: 72  QVLSSIGAXXXXXXXXXXXAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETLFHK 131
            +LS IGA           AV+ELVKFHLV KR  L++DL      S  E P+LE LF K
Sbjct: 71  TMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDL------SSEEKPSLEDLFIK 124

Query: 132 RLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKRA 191
           RLELN+PIA H++QLL+ +++PG F + +ALPELHRLSDD+IY+S E D +DFAWYSKR 
Sbjct: 125 RLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKRL 184

Query: 192 AISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNLA 251
            ISCA+VSSELFMAQDKS NY +TF+FA DKL    +LG+YY NTEE++WYTLL S+NLA
Sbjct: 185 GISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSINLA 244

Query: 252 KSQITR 257
           KSQ+ R
Sbjct: 245 KSQMAR 250

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  283 bits (723), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 139/259 (53%), Positives = 181/259 (69%), Gaps = 11/259 (4%)

Query: 1   MLARSFRTLGRRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERAL 60
           + AR +R  G  +  P            PL YG  S Q+KVL H L   VP YGFNERA+
Sbjct: 12  IFARGYRPAGFEYINP-------INSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAI 64

Query: 61  VASLNDLGLGSQVLSSIGAXXXXXXXXXXXAVLELVKFHLVTKRYALTKDLDIARCASPA 120
           V SLN+LG  S +LS IG+           A++EL+KFHLV KR  LT+++ +    +P 
Sbjct: 65  VNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLE---TPV 121

Query: 121 EP-PALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEP 179
           +  P+LE L  KRLE+N+P+A+H++QLL+ L++PG FL+  ++PELHRLSDDMIYFS E 
Sbjct: 122 DQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEK 181

Query: 180 DANDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEY 239
           D NDFAWYSKR A+SCA+VSSELFMAQD+SP+Y +TFEFA +KLH V+ LG+YY NTEE+
Sbjct: 182 DHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEF 241

Query: 240 MWYTLLMSVNLAKSQITRS 258
            WYTLL ++NL KSQ+ R 
Sbjct: 242 AWYTLLSTINLVKSQLARG 260

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  274 bits (700), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 171/247 (69%), Gaps = 2/247 (0%)

Query: 12  RFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLGS 71
           RFY PNP EY     L PL YG  S Q+K+L H+L   VP +GFNERA+V S+N LG  S
Sbjct: 16  RFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYPS 75

Query: 72  QVLSSIGAXXXXXXXXXXXAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETLFHK 131
            +LS IG+           A++EL+KF+LV KRY L++D+ +       E P+LE L  K
Sbjct: 76  SILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTPVE--ELPSLEDLLIK 133

Query: 132 RLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKRA 191
           RL++++PI  H++QL+A L++PG FL  ++LPELHRL+DDMIYFS E D  DFAWY+KR 
Sbjct: 134 RLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKRM 193

Query: 192 AISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNLA 251
            +S A++SS+LFMAQD+SP Y DTFEFA DKL  + KLG YY N EEY WY L+ S+N+A
Sbjct: 194 GVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINMA 253

Query: 252 KSQITRS 258
           KS+  R 
Sbjct: 254 KSKAARG 260

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  264 bits (675), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 132/261 (50%), Positives = 178/261 (68%), Gaps = 4/261 (1%)

Query: 1   MLARSFRTLGRRF---YQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNE 57
           ML R+    G +F   Y  NP+E+     + PL YG +S Q+KVL  AL+  VP +GF+E
Sbjct: 1   MLCRNTARTGCKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSE 60

Query: 58  RALVASLNDLGLGSQVLSSIGAXXXXXXXXXXXAVLELVKFHLVTKRYALTKDLDIARCA 117
           R++V SLN+LG  S ++SSIGA           AV+EL+KF LV KRY LT+ ++     
Sbjct: 61  RSIVESLNELGYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGIN-PDVT 119

Query: 118 SPAEPPALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSK 177
              + P+LE L  KRLE++ PI  H+++L++ LA+P  FL ++A+PELHRLSDDMIYFS 
Sbjct: 120 PQYKLPSLEHLLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSN 179

Query: 178 EPDANDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTE 237
           E D +D AWY+KR A+S  ++ S+LFMAQDKS NY +TF FA DKLH V +LG+YY NTE
Sbjct: 180 EKDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTE 239

Query: 238 EYMWYTLLMSVNLAKSQITRS 258
           E+ WYTL+ +VNL KSQ+ R 
Sbjct: 240 EFAWYTLMSTVNLIKSQLVRG 260

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  261 bits (667), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 127/246 (51%), Positives = 171/246 (69%), Gaps = 1/246 (0%)

Query: 12  RFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLGS 71
           R Y  NP+E+     + PLAYG QS Q+KVL  AL+ +VP +GF ER++V SLN LG  S
Sbjct: 15  RLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYPS 74

Query: 72  QVLSSIGAXXXXXXXXXXXAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETLFHK 131
            ++SSIGA           AV+EL+KF LV KRY LT+ ++        + P+LE L  K
Sbjct: 75  SMISSIGASNSPSFVHSSTAVMELLKFQLVDKRYRLTEGIN-PDVTPHYKLPSLEHLLLK 133

Query: 132 RLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKRA 191
           RLE++ P+ + +T L++ LA+P  FL ++A+PELHRLSDDMIYFS E D +D AWY+KR 
Sbjct: 134 RLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRL 193

Query: 192 AISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNLA 251
           A+S  ++ S+LFMAQDKS ++ +TF FA DKLH V +LG+YY NTEE+ WYTL+ +VNL 
Sbjct: 194 AVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLV 253

Query: 252 KSQITR 257
           KSQ+ R
Sbjct: 254 KSQLAR 259

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  254 bits (650), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 166/249 (66%)

Query: 9   LGRRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLG 68
           L  R Y PNP+EY  +T +APL Y   S Q ++L H L+N VP +GF ERAL+ S+  +G
Sbjct: 16  LSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLKSIQAVG 75

Query: 69  LGSQVLSSIGAXXXXXXXXXXXAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETL 128
             S ++S +GA           AV+ELVKF+LV KR+ALT+ L  A   SPA  P+LE L
Sbjct: 76  YDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAAAGLGSPAALPSLEHL 135

Query: 129 FHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYS 188
             KRL++++P+++ +  L   LA+P +F++  A+PEL RLSDDMIYFS E D  D AWYS
Sbjct: 136 LVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDTAWYS 195

Query: 189 KRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSV 248
           KR  +S A+ +S+LFMAQD S N  DT EFA DKLH +  LG+YY N EEY WY+++ +V
Sbjct: 196 KRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSIMTTV 255

Query: 249 NLAKSQITR 257
           N AK+  +R
Sbjct: 256 NRAKAGFSR 264

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  253 bits (646), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 129/248 (52%), Positives = 166/248 (66%), Gaps = 7/248 (2%)

Query: 11  RRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLG 70
           RR Y PN LE+ +  +L PLAY   S Q+KVL  AL+ HVP  GFNERA+V +  DLG G
Sbjct: 6   RRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYG 65

Query: 71  SQVLSSIGAXXXXXXXXXXXAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETLFH 130
           S VLS++ A           AVLELVKFHLVTKR AL         A+     ++E LF 
Sbjct: 66  SAVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVALAD-------AAAQGNVSMEQLFL 118

Query: 131 KRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKR 190
           +R+E + P+A  +TQLL+IL++PGEFL+ +A+PEL RLSDD+IY+S E D  D AWYSKR
Sbjct: 119 QRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKR 178

Query: 191 AAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNL 250
           AA++ A+VS+ LFMA+D+SP   +T  FA  +L  V  LG  Y N EE+ WY LLM++NL
Sbjct: 179 AAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNL 238

Query: 251 AKSQITRS 258
            KSQ+TR 
Sbjct: 239 VKSQLTRG 246

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  250 bits (639), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 125/247 (50%), Positives = 167/247 (67%), Gaps = 1/247 (0%)

Query: 12  RFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLGS 71
           R Y  NP+E+     + PL YG QS Q+KVL  AL  +VP +GF+ER++V SLN LG  S
Sbjct: 15  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPS 74

Query: 72  QVLSSIGAXXXXXXXXXXXAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETLFHK 131
            ++SSIGA           AV+ELVKF LV KRY LT+ ++     S  + P+LE L  K
Sbjct: 75  SMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGIN-PDVTSRYKLPSLEHLLLK 133

Query: 132 RLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKRA 191
           RLE++  I   +  L++ LA+P   L ++A+PELHRLSDDMIYFS E D +D AWY+KR 
Sbjct: 134 RLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRL 193

Query: 192 AISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNLA 251
           A+S  ++ S+LFMAQDKS ++ +TF FA +KLH V +LG+YY NTEE+ WYTL+ +VNL 
Sbjct: 194 AVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLV 253

Query: 252 KSQITRS 258
           KSQ+ R 
Sbjct: 254 KSQLARG 260

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  245 bits (626), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 175/257 (68%), Gaps = 5/257 (1%)

Query: 6   FRTLG--RRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVAS 63
           FR  G   RF+ P   EY L  KL+P  Y   S QFK+L HA+ N V  +GF+ERA++ +
Sbjct: 9   FRKSGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEA 68

Query: 64  LNDLGLGSQ--VLSSIGAXXXXXXXXXXXAVLELVKFHLVTKRYALTKDLDIARCASPAE 121
           + +L + +Q  +LS+IG+           +V+EL+KF+LV KRY + + LD        E
Sbjct: 69  MKELKIENQSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMIEGLD-PLTMQQEE 127

Query: 122 PPALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDA 181
            P+LE+L  KRLE++IPI +H++  ++ L +PG FLL SALPELHRL+DDMIYFS E D 
Sbjct: 128 LPSLESLLLKRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDH 187

Query: 182 NDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMW 241
           +DFAWYSKR  +S A++SS+LFMAQD S NY +T +FA DKL  V +LG YY NTEEY W
Sbjct: 188 HDFAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAW 247

Query: 242 YTLLMSVNLAKSQITRS 258
           Y LL SVN+ KS+++R+
Sbjct: 248 YVLLNSVNMVKSRMSRA 264

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  243 bits (620), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 120/248 (48%), Positives = 164/248 (66%), Gaps = 8/248 (3%)

Query: 11  RRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLG 70
           RRFY  N  EY +   L PL YG  S Q+KVL+ AL+ +VP  GF + A+V + N+LG  
Sbjct: 14  RRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGYN 73

Query: 71  SQVLSSIGAXXXXXXXXXXXAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETLFH 130
           S VL++IGA           +V ELVKFHLVTKRY L +D +  +         LE LF 
Sbjct: 74  SAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQEDQEGTK--------TLEELFL 125

Query: 131 KRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKR 190
           KRLE N  +  H+ ++L+ILA+PG+FL+ + LPEL +L+DDMIY+S E D ND AWYSKR
Sbjct: 126 KRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKR 185

Query: 191 AAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNL 250
            A+S A++S+ELFMA+D SPN+  T EFA  +++ + ++G  Y N EE+ W+ LL +VNL
Sbjct: 186 LAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNL 245

Query: 251 AKSQITRS 258
           A+SQ+ R 
Sbjct: 246 ARSQLVRG 253

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  241 bits (615), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 164/246 (66%), Gaps = 2/246 (0%)

Query: 12  RFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLGS 71
           R Y P   EY       PL Y  +S +FK+L H ++N VP +GF E+A+V SLN + + S
Sbjct: 24  RRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMPS 83

Query: 72  QVLSSIGAXXXXXXXXXXXAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETLFHK 131
            +L++IGA           AV+EL+KF LV KR+ + +   I   A  ++ P+LE+L  K
Sbjct: 84  GMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEG--ITEIAEASKLPSLESLLLK 141

Query: 132 RLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKRA 191
           RL++++PIA H+TQ+ A L +P  F+   +LPEL RL+DDMIY+S E D +DFAWY+KRA
Sbjct: 142 RLKMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRA 201

Query: 192 AISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNLA 251
           A++  +++S+ FMAQDKS N+ +T EFA DKLH V  LG YY N EE+ W+TL+ +VNL 
Sbjct: 202 ALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLT 261

Query: 252 KSQITR 257
           KSQ+ R
Sbjct: 262 KSQMAR 267

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  238 bits (608), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 130/267 (48%), Positives = 169/267 (63%), Gaps = 15/267 (5%)

Query: 1   MLARSFRTLG---RRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNE 57
           ML RS    G    R Y P+  EY     L+PL Y  +S+Q+K+L +AL   VP +GF E
Sbjct: 1   MLNRSILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKE 60

Query: 58  RALVASLNDLGLGSQVLSSIGAXXXXXXXXXXX-AVLELVKFHLVTKRYALTKDLDIARC 116
           +A+  SLN+LG  S +LS IGA            AV+EL+KF LV+KRY LT++L    C
Sbjct: 61  KAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENL----C 116

Query: 117 ASPAEPP-----ALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDD 171
             P   P     +LE+L  KRLE++  I + +  L A LA P  FL   ALPELHRLSDD
Sbjct: 117 --PDTTPKNELPSLESLLLKRLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDD 174

Query: 172 MIYFSKEPDANDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQ 231
           MIYFS E D +D AWY+KR  +SCA+VSS+L+MAQD S ++ DT  FA DKLH + KLG+
Sbjct: 175 MIYFSNEKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGE 234

Query: 232 YYTNTEEYMWYTLLMSVNLAKSQITRS 258
           YY NTEEY WY  ++S NL ++++ RS
Sbjct: 235 YYNNTEEYAWYMFMVSTNLVRARLARS 261

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  235 bits (599), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 112/258 (43%), Positives = 171/258 (66%), Gaps = 4/258 (1%)

Query: 1   MLARSFRTLGRRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERAL 60
           +L++  +  G R Y     + + +  L PL YG  S Q+++L+ A++N VP++GF ERA+
Sbjct: 26  LLSKHIKNNGIRTYYSVSNDVKKSDHLEPLLYGKDSAQYRILEDAVQNSVPTFGFTERAI 85

Query: 61  VASLNDLGLGSQVLSSIGAXXXXXXXXXXXAVLELVKFHLVTKRYALTKDLDIARCASPA 120
           + S+N LG  S ++S +G+           AVLEL+KF+LV+KR  L++ +D        
Sbjct: 86  INSINKLGYNSSMISVLGSSNTHNILHSSPAVLELLKFNLVSKRLKLSEGID----PETK 141

Query: 121 EPPALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPD 180
           + P+LE L  KRL+++  I   + +++  L++PG FL ++++PEL RLSDDMIYFS E D
Sbjct: 142 DLPSLEYLLLKRLQMDKAIQSRLNEMITKLSIPGTFLAETSIPELFRLSDDMIYFSNEKD 201

Query: 181 ANDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYM 240
            +D AWYSKR A+S  +++S++FMAQD S +   T EFA DKL+ V  LG+YY NTEE++
Sbjct: 202 HHDMAWYSKRLAVSTTYIASQIFMAQDTSVDCYKTLEFAQDKLNKVMNLGEYYNNTEEFL 261

Query: 241 WYTLLMSVNLAKSQITRS 258
           W+TL+ SVN+ KSQ+ RS
Sbjct: 262 WFTLMTSVNIVKSQLARS 279

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  233 bits (593), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 129/261 (49%), Positives = 178/261 (68%), Gaps = 4/261 (1%)

Query: 1   MLARSFRTLGR---RFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNE 57
           ML R+    G    R Y PNP+E+  +  + PL YG +S Q+KVL  AL+ +VP +GF+E
Sbjct: 1   MLCRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSE 60

Query: 58  RALVASLNDLGLGSQVLSSIGAXXXXXXXXXXXAVLELVKFHLVTKRYALTKDLDIARCA 117
           R++V SLN+LG  S ++SSI A           AV+EL+KF LV KRY LT+ ++     
Sbjct: 61  RSIVESLNELGYPSSMISSISASNSPSFFHSSTAVMELIKFQLVDKRYRLTEAIN-PDVT 119

Query: 118 SPAEPPALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSK 177
              + P+LE L  +RLE++ PI   +++L++ LA+P  FL ++A+PELHRLSDDMIYFS 
Sbjct: 120 PQYKLPSLEHLLLRRLEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSN 179

Query: 178 EPDANDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTE 237
           E D +D AWY+KR A+S  ++ S+LFMAQDKS NY DTF+FA  KL+ V +LG+YY NTE
Sbjct: 180 EKDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTE 239

Query: 238 EYMWYTLLMSVNLAKSQITRS 258
           E+ WYTL+ +VNL KSQ+ R 
Sbjct: 240 EFAWYTLMSTVNLVKSQLVRG 260

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  224 bits (571), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 109/258 (42%), Positives = 163/258 (63%), Gaps = 1/258 (0%)

Query: 1   MLARSFRTLGRRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERAL 60
           +L+++ +    R +  N LEY     L+PL Y   S+Q+K+L +AL   VP  GF + A+
Sbjct: 6   ILSKNVKLSINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAI 65

Query: 61  VASLNDLGLGSQVLSSIGAXXXXXXXXXXX-AVLELVKFHLVTKRYALTKDLDIARCASP 119
            +SLN+L L S + S +G+            AV+EL+KF LV+KRY LT+++      + 
Sbjct: 66  TSSLNELDLSSSLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPYIETAK 125

Query: 120 AEPPALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEP 179
            + P+LETL  +RL+++ P+   ++ L   L +P   L   ALPEL  LSDD+IYFS E 
Sbjct: 126 DKLPSLETLLIERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIYFSNEK 185

Query: 180 DANDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEY 239
           D +D AWY+KR  +SCA+VSS+L+M ++   N+  T +FA DKLH +  LG+YY NTEEY
Sbjct: 186 DHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEY 245

Query: 240 MWYTLLMSVNLAKSQITR 257
            WYTL++S+NL K+++ R
Sbjct: 246 AWYTLMVSMNLVKARLAR 263

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  222 bits (566), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 166/252 (65%), Gaps = 7/252 (2%)

Query: 6   FRTLGRRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLN 65
           F+ L RR Y P   EY   T ++PL Y   SIQ K+L H+LK +VP+ GFNE++++ S+N
Sbjct: 19  FKCL-RRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSIN 77

Query: 66  DLGLGSQVLSSIGAXXXXXXXXXXXAVLELVKFHLVTKRYALTKDLDIARCASPAEPPAL 125
           DLG  S ++S IGA           AVLEL+K++LV+KR      +++ +  +      L
Sbjct: 78  DLGYSSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKR------IELTKDTNDNTTTTL 131

Query: 126 ETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFA 185
           + L  KRLE++IPI+  +  L A LA PG+F+   +LPEL +L+DDMI+FS E D +D A
Sbjct: 132 KELLLKRLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMA 191

Query: 186 WYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLL 245
           WYSKR A+S A+V+S++FM QD S N+  T +FA+DK+  V  LG+YY N EEY W+TL+
Sbjct: 192 WYSKRLAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLM 251

Query: 246 MSVNLAKSQITR 257
            S+NL KSQ +R
Sbjct: 252 NSINLVKSQFSR 263

>Ecym_7151 Chr7 complement(311699..313309) [1611 bp, 536 aa] {ON}
           similar to Ashbya gossypii AGL303W
          Length = 536

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 13  FYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDH 44
           FY   PL YQ+T    P A G Q I ++ LD+
Sbjct: 105 FYGDQPLGYQITQHYKPFAKGGQLIMYRDLDN 136

>KLTH0G12892g Chr7 (1095023..1109809) [14787 bp, 4928 aa] {ON} similar
            to uniprot|Q12019 Saccharomyces cerevisiae YLR106C MDN1
            Huge dynein-related AAA-type ATPase (midasin) forms
            extended pre-60S particle with the Rix1 complex
            (Rix1p-Ipi1p-Ipi3p) may mediate ATP-dependent remodeling
            of 60S subunits and subsequent export from nucleoplasm to
            cytoplasm
          Length = 4928

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 41/93 (44%), Gaps = 17/93 (18%)

Query: 118  SPAEPPALETLFHKRLE---------LNIPIAQHMTQLLAILAMPGEFLLQSALPELHRL 168
            SP+ PP  + L+ K             +  I +H+ Q + IL       +  AL +   L
Sbjct: 2753 SPSYPPIFDILWQKENGTFRSHVFSVFDNSILEHLVQKINILKHISNSQISQALEDASVL 2812

Query: 169  SDDMIYF------SKEPDAND--FAWYSKRAAI 193
            S D++ F      SKE    D  FAWY+K A++
Sbjct: 2813 SRDLVTFSTSVLSSKELYFKDLLFAWYAKIASL 2845

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.133    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,099,346
Number of extensions: 896665
Number of successful extensions: 1931
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1949
Number of HSP's successfully gapped: 22
Length of query: 258
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 151
Effective length of database: 41,212,137
Effective search space: 6223032687
Effective search space used: 6223032687
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)