Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.246427.350ON38138120110.0
KLTH0H01254g7.350ON38138119100.0
SAKL0F11374g7.350ON38338317660.0
NCAS0A141607.350ON45138017260.0
KLLA0D12342g7.350ON38437817100.0
TDEL0C019807.350ON38538017000.0
Kpol_530.317.350ON38037616860.0
CAGL0L01111g7.350ON38138116830.0
YDL168W (SFA1)7.350ON38637416700.0
Smik_4.707.350ON38637616660.0
Ecym_47237.350ON38137916610.0
Skud_4.897.350ON38537416610.0
Suva_4.787.350ON38537816580.0
TBLA0E00390singletonON38338016560.0
ZYRO0F11704g7.350ON38237716450.0
TPHA0F029707.350ON38137516250.0
ACL148C7.350ON38137816170.0
KAFR0B008807.350ON38137815690.0
NDAI0A018907.350ON42238014790.0
KNAG0C037907.350ON38238414220.0
SAKL0A00880gsingletonON38837711721e-160
KLLA0D19929gsingletonON3863472875e-28
SAKL0B00814g8.16ON3543852802e-27
KLLA0B00451gsingletonON3863782822e-27
SAKL0C10164g3.118ON3513832723e-26
Suva_4.3943.118ON3513912644e-25
NCAS0I023503.118ON3513872644e-25
CAGL0J01441g2.480ON3723452611e-24
Ecym_53313.118ON3483482582e-24
AER032W3.118ON3513022582e-24
KLTH0G15686g3.118ON3513872583e-24
SAKL0F06270gna 1ON3513832574e-24
KLLA0F21010g3.118ON3503882558e-24
KLTH0D00616g7.3ON3823982568e-24
YBR145W (ADH5)3.118ON3513752549e-24
KLLA0B09064gna 2ON3743782541e-23
KNAG0K020003.118ON3503852522e-23
SAKL0B08184gna 2ON3733742513e-23
KLTH0D05588g2.480ON3893732515e-23
TBLA0I011402.480ON3772642505e-23
KLTH0G18986g8.16ON3543642486e-23
KAFR0G014203.118ON3513872471e-22
Skud_2.2723.118ON3513842461e-22
CAGL0I07843g3.118ON3523902461e-22
CAGL0D00198g7.3ON3833272471e-22
Ecym_73912.480ON3753852452e-22
YLR070C (XYL2)8.16ON3563842442e-22
NCAS0I01720singletonON3513772424e-22
YOL086C (ADH1)3.118ON3483052424e-22
Smik_15.713.118ON3483902424e-22
Skud_15.683.118ON3483052416e-22
Kwal_55.19574singletonON3563622417e-22
Smik_13.520na 3ON3483022407e-22
KLLA0F13530g2.480ON3753802417e-22
Smik_2.2843.118ON3513812408e-22
NDAI0A069303.118ON3513802372e-21
Suva_15.813.118ON3483802372e-21
KLLA0F18260gsingletonON3482642372e-21
Kwal_26.77992.480ON3873802382e-21
Suva_13.494na 3ON3483022372e-21
Kpol_1058.118.16ON3533432372e-21
TPHA0G032102.480ON3773802373e-21
Skud_13.477na 3ON3483022363e-21
Skud_13.2402.480ON3752642363e-21
KLTH0E05588gna 1ON3483832344e-21
TPHA0M007303.118ON3503932345e-21
AAR084WsingletonON3853022346e-21
TBLA0E03430singletonON3513832337e-21
NDAI0H021602.480ON3812642331e-20
KAFR0A007902.480ON3773772321e-20
YAL060W (BDH1)7.3ON3822412321e-20
YMR303C (ADH2)na 3ON3483022311e-20
SAKL0E02838g2.480ON3772642311e-20
ABL033C2.480ON3733822312e-20
ZYRO0B05940g3.118ON3793022312e-20
TBLA0E034403.118ON3513832292e-20
ZYRO0G03388g2.480ON3703802276e-20
Smik_48.1singletonON3573822266e-20
TDEL0D050503.118ON3512642257e-20
Suva_13.2612.480ON3752642251e-19
Suva_12.260singletonON3573672241e-19
Kwal_56.231983.118ON3512842231e-19
Skud_1.37.3ON3822802232e-19
YMR083W (ADH3)2.480ON3752642232e-19
TDEL0A025602.480ON3733782232e-19
Skud_20.2singletonON3573672222e-19
Skud_4.2singletonON3573672222e-19
KLLA0F00506g7.3ON3852302213e-19
Smik_1.67.3ON3822782213e-19
NCAS0A077802.480ON3732572205e-19
Kwal_26.67397.3ON3823152205e-19
YJR159W (SOR1)na 4ON3573612195e-19
Smik_13.2662.480ON3752642196e-19
TBLA0A042907.3ON3952792198e-19
Kpol_431.82.480ON3802492171e-18
Kwal_26.6684singletonON3563962171e-18
YDL246C (SOR2)singletonON3573612161e-18
Kpol_1036.193.118ON3532842152e-18
KNAG0K01040singletonON3913052153e-18
KAFR0L02010singletonON3512642133e-18
ZYRO0C12562gna 1ON3483022134e-18
Suva_1.77.3ON3822802126e-18
KAFR0L02000singletonON3612972116e-18
Suva_10.1548.16ON3563642109e-18
KLTH0A00418gsingletonON3562462091e-17
TDEL0C003908.16ON3532922091e-17
NDAI0H020507.3ON3852962101e-17
ZYRO0G03410gsingletonON3733702082e-17
ABR229C8.16ON3532842072e-17
Kpol_1049.187.2ON3862812082e-17
TDEL0H044607.3ON3822782073e-17
SAKL0D14894g7.2ON3853072063e-17
KNAG0E025902.480ON3742642055e-17
ZYRO0F02552g8.16ON3513542037e-17
Kwal_55.20564singletonON2162351951e-16
SAKL0D14872g7.3ON3833082002e-16
NCAS0J003008.16ON3572641983e-16
TDEL0F03190na 1ON3512701983e-16
KAFR0I001607.2ON3853471984e-16
YAL061W (BDH2)7.2ON4172791951e-15
NCAS0A076707.2ON4392801932e-15
Skud_1.27.2ON4172791904e-15
Suva_1.67.2ON4172691889e-15
Smik_1.57.2ON4172791889e-15
KNAG0I00120singletonON3812721816e-14
NCAS0A076607.3ON3862821791e-13
KLLA0D05511g8.16ON3543581771e-13
YBR046C (ZTA1)3.253ON3343241726e-13
TPHA0H03100singletonON3922811729e-13
KAFR0I001707.3ON3813081683e-12
Kwal_56.229853.253ON3462621664e-12
KLLA0F00528g7.2ON3813181656e-12
NDAI0H02950singletonON3633431612e-11
Smik_2.1703.253ON3343231559e-11
KNAG0E042007.2ON3853171569e-11
KNAG0D00110singletonON3623401541e-10
KAFR0C005803.253ON3343351532e-10
NCAS0C03020singletonON3623581522e-10
TDEL0D037203.253ON3352601522e-10
NDAI0H020607.2ON3992771513e-10
KLLA0A10549g3.253ON3531581407e-09
KLTH0C07854g3.253ON3583471381e-08
NDAI0G04880singletonON3613441381e-08
Suva_4.2793.253ON3342621372e-08
NDAI0A063203.253ON3492561335e-08
Kwal_47.17532na 5ON3733021336e-08
SAKL0D03872g3.253ON3482721336e-08
NDAI0A08470singletonON3633501311e-07
Skud_2.1623.253ON3342571301e-07
ZYRO0A03366g3.253ON3493271264e-07
NCAS0D01220na 6ON3623481265e-07
KLTH0E07964gna 5ON3742551212e-06
CAGL0H06853gsingletonON3603501203e-06
KAFR0A08730singletonON3603411203e-06
SAKL0H22088gna 5ON3763121193e-06
SAKL0D14938gsingletonON3782861168e-06
KLTH0B04972gna 7ON3603491169e-06
CAGL0M14047gna 8ON3593651159e-06
YMR318C (ADH6)na 8ON3603471132e-05
Ecym_1093singletonON3833191132e-05
Suva_13.513na 8ON3603511113e-05
ABL090W3.253ON3342721087e-05
TPHA0J00170singletonON3613481088e-05
Smik_13.535na 8ON3603471088e-05
KLLA0F00638gna 9ON3822651062e-04
Skud_13.494na 8ON3603431052e-04
SAKL0H00374gsingletonON4283721052e-04
NCAS0I017303.253ON3492631042e-04
NDAI0H02940na 6ON3613161042e-04
KNAG0K02680singletonON359284950.003
KNAG0B06990singletonON358346920.007
CAGL0H09944g3.253ON333310910.008
TPHA0A00140singletonON362365900.013
KLLA0E19889gna 7ON366108900.014
SAKL0C00264gsingletonON359349890.016
Skud_3.175singletonON361350880.019
Skud_86.1singletonON8959800.027
Kpol_1057.24na 10ON360347850.047
Smik_3.203singletonON12087790.066
Kpol_526.18singletonON361158840.072
YCR105W (ADH7)na 10ON36183830.081
Kpol_257.4singletonON360344830.096
KAFR0H03770singletonON365222820.11
Suva_6.13singletonON6859730.16
Smik_26.3singletonON12580770.17
Kpol_529.30na 8ON360356790.24
KAFR0C01550singletonON359353780.34
TBLA0A06640singletonON361308780.38
Kwal_26.9050singletonON36494770.54
Suva_7.5singletonON212107750.56
TPHA0F02090singletonON360143760.57
TDEL0A00140singletonON405263760.58
KLLA0B02673g4.282ON441143760.65
TDEL0F02300na 5ON37990750.82
ZYRO0G00330gsingletonON1288113760.86
ZYRO0G10318gna 5ON37692750.91
KLTH0C10538gsingletonON273156741.1
YNL134C2.133ON376305722.2
AFR625C1.139ON36888703.0
KLLA0C18975gna 11ON1286113713.0
YLR460Cna 12ON37694694.1
TDEL0D00250singletonON1284113687.6
KLTH0B10032gsingletonON1278108678.7
KLTH0E00484gna 13ON1278108678.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.24642
         (381 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]...   779   0.0  
KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly...   740   0.0  
SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {...   684   0.0  
NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa] ...   669   0.0  
KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} high...   663   0.0  
TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.3...   659   0.0  
Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON} (77132..7...   654   0.0  
CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highl...   652   0.0  
YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}  SFA1Bifunc...   647   0.0  
Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W (...   646   0.0  
Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar...   644   0.0  
Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W (...   644   0.0  
Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W (...   643   0.0  
TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON}      642   0.0  
ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {...   638   0.0  
TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {O...   630   0.0  
ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON} Syn...   627   0.0  
KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {O...   608   0.0  
NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350    574   0.0  
KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {O...   552   0.0  
SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON...   456   e-160
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...   115   5e-28
SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar ...   112   2e-27
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...   113   2e-27
SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {...   109   3e-26
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...   106   4e-25
NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118    106   4e-25
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...   105   1e-24
Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar t...   103   2e-24
AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic ho...   103   2e-24
KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]...   103   3e-24
SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} simila...   103   4e-24
KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON} unip...   102   8e-24
KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar ...   103   8e-24
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...   102   9e-24
KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {...   102   1e-23
KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3....   101   2e-23
SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON} unipro...   101   3e-23
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...   101   5e-23
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...   100   5e-23
KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]...   100   6e-23
KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {O...   100   1e-22
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...    99   1e-22
CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {...    99   1e-22
CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar ...   100   1e-22
Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar t...    99   2e-22
YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON} ...    99   2e-22
NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON}               98   4e-22
YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON} ...    98   4e-22
Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {O...    98   4e-22
Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {O...    97   6e-22
Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON...    97   7e-22
Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {...    97   7e-22
KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON} unip...    97   7e-22
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    97   8e-22
NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON} Anc_3...    96   2e-21
Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {O...    96   2e-21
KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]...    96   2e-21
Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {O...    96   2e-21
Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {...    96   2e-21
Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON} (41165....    96   2e-21
TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {O...    96   3e-21
Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {...    96   3e-21
Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083...    96   3e-21
KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {...    95   4e-21
TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {...    95   5e-21
AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-synteni...    95   6e-21
TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON}               94   7e-21
NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480     94   1e-20
KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {O...    94   1e-20
YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}  BDH1NAD-depe...    94   1e-20
YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON} ...    94   1e-20
SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON} unipro...    94   1e-20
ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON} S...    94   2e-20
ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly...    94   2e-20
TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.1...    93   2e-20
ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {...    92   6e-20
Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR15...    92   6e-20
TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.1...    91   7e-20
Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083...    91   1e-19
Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159...    91   1e-19
Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086...    91   1e-19
Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)     91   2e-19
YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}  ADH3Mitoc...    91   2e-19
TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {O...    91   2e-19
Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)     90   2e-19
Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR1...    90   2e-19
KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON...    90   3e-19
Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)     90   3e-19
NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON} Anc_2...    89   5e-19
Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W (...    89   5e-19
YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbi...    89   5e-19
Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083...    89   6e-19
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    89   8e-19
Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON} (21043..22...    88   1e-18
Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W (...    88   1e-18
YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}  SOR2...    88   1e-18
Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON} (51276....    87   2e-18
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    87   3e-18
KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON}              87   3e-18
ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly...    87   4e-18
Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)     86   6e-18
KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON}              86   6e-18
Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {...    86   9e-18
KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON...    85   1e-17
TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16 ...    85   1e-17
NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {O...    86   1e-17
ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {...    85   2e-17
ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON} S...    84   2e-17
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    85   2e-17
TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {O...    84   3e-17
SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]...    84   3e-17
KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {O...    84   5e-17
ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} simila...    83   7e-17
Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {O...    80   1e-16
SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]...    82   2e-16
NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16       81   3e-16
TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possib...    81   3e-16
KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2 Y...    81   4e-16
YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative...    80   1e-15
NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa] ...    79   2e-15
Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)      78   4e-15
Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)     77   9e-15
Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)     77   9e-15
KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON}                  74   6e-14
NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa] ...    74   1e-13
KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {...    73   1e-13
YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}  ...    71   6e-13
TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {O...    71   9e-13
KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3 Y...    69   3e-12
Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {...    69   4e-12
KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON...    68   6e-12
NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {O...    67   2e-11
Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON...    64   9e-11
KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {O...    65   9e-11
KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON}                   64   1e-10
KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.2...    64   2e-10
NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {O...    63   2e-10
TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.2...    63   2e-10
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    63   3e-10
KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly...    59   7e-09
KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} simila...    58   1e-08
NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa] ...    58   1e-08
Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON...    57   2e-08
NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON} Anc_3...    56   5e-08
Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318...    56   6e-08
SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly...    56   6e-08
NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON}             55   1e-07
Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON...    55   1e-07
ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly...    53   4e-07
NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON}               53   5e-07
KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} simila...    51   2e-06
CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {...    51   3e-06
KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa] ...    51   3e-06
SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} simi...    50   3e-06
SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]...    49   8e-06
KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly...    49   9e-06
CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa...    49   9e-06
YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON} ...    48   2e-05
Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}...    48   2e-05
Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {...    47   3e-05
ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic ho...    46   7e-05
TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON}                46   8e-05
Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {...    46   8e-05
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    45   2e-04
Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {...    45   2e-04
SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly s...    45   2e-04
NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253     45   2e-04
NDAI0H02940 Chr8 complement(717073..718158) [1086 bp, 361 aa] {O...    45   2e-04
KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {...    41   0.003
KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON}             40   0.007
CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {...    40   0.008
TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON}                 39   0.013
KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} simi...    39   0.014
SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON...    39   0.016
Skud_3.175 Chr3 (288164..289249) [1086 bp, 361 aa] {ON} YCR105W ...    39   0.019
Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159...    35   0.027
Kpol_1057.24 s1057 (53467..54549) [1083 bp, 360 aa] {ON} (53467....    37   0.047
Smik_3.203 Chr3 (301227..301247,301251..301589) [360 bp, 120 aa]...    35   0.066
Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON} (51360..5...    37   0.072
YCR105W Chr3 (309070..310155) [1086 bp, 361 aa] {ON}  ADH7NADPH-...    37   0.081
Kpol_257.4 s257 complement(12348..13430) [1083 bp, 360 aa] {ON} ...    37   0.096
KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {O...    36   0.11 
Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON} ...    33   0.16 
Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)      34   0.17 
Kpol_529.30 s529 (89344..90426) [1083 bp, 360 aa] {ON} (89344..9...    35   0.24 
KAFR0C01550 Chr3 complement(318350..319429) [1080 bp, 359 aa] {O...    35   0.34 
TBLA0A06640 Chr1 (1621352..1622437) [1086 bp, 361 aa] {ON}             35   0.38 
Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR10...    34   0.54 
Suva_7.5 Chr7 (12884..13522) [639 bp, 212 aa] {ON} YLR460C (REAL)      33   0.56 
TPHA0F02090 Chr6 (465913..466995) [1083 bp, 360 aa] {ON}               34   0.57 
TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON}                 34   0.58 
KLLA0B02673g Chr2 (235478..236803) [1326 bp, 441 aa] {ON} simila...    34   0.65 
TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {O...    33   0.82 
ZYRO0G00330g Chr7 complement(22695..26561) [3867 bp, 1288 aa] {O...    34   0.86 
ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} simila...    33   0.91 
KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {O...    33   1.1  
YNL134C Chr14 complement(372451..373581) [1131 bp, 376 aa] {ON} ...    32   2.2  
AFR625C Chr6 complement(1570346..1571452) [1107 bp, 368 aa] {ON}...    32   3.0  
KLLA0C18975g Chr3 complement(1684573..1688433) [3861 bp, 1286 aa...    32   3.0  
YLR460C Chr12 complement(1059757..1060887) [1131 bp, 376 aa] {ON...    31   4.1  
TDEL0D00250 Chr4 (40555..44409) [3855 bp, 1284 aa] {ON}                31   7.6  
KLTH0B10032g Chr2 (835039..838875) [3837 bp, 1278 aa] {ON} highl...    30   8.7  
KLTH0E00484g Chr5 complement(47160..50996) [3837 bp, 1278 aa] {O...    30   8.8  

>Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]
           {ON} YDL168W (SFA1) - Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
           [contig 161] FULL
          Length = 381

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/381 (100%), Positives = 381/381 (100%)

Query: 1   MSEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEG 60
           MSEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEG
Sbjct: 1   MSEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEG 60

Query: 61  AFPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120
           AFPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG
Sbjct: 61  AFPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120

Query: 121 KGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTT 180
           KGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTT
Sbjct: 121 KGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTT 180

Query: 181 GYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGAT 240
           GYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGAT
Sbjct: 181 GYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGAT 240

Query: 241 DFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVA 300
           DFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVA
Sbjct: 241 DFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVA 300

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDI 360
           AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDI
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDI 360

Query: 361 NSAFEDLHHGDCLRTVLDLLK 381
           NSAFEDLHHGDCLRTVLDLLK
Sbjct: 361 NSAFEDLHHGDCLRTVLDLLK 381

>KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 381

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/381 (93%), Positives = 373/381 (97%)

Query: 1   MSEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEG 60
           MSEGKPITC AAVAYEAGKPLT+EEIVVDPPKAHEVR+K+ YTAVCHTDAYTLSGVDPEG
Sbjct: 1   MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEG 60

Query: 61  AFPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120
           AFPSILGHEGAG+VES+GEGVTNVK GDHVIALYTAECKECKFCKSGKTNLCGSVRATQG
Sbjct: 61  AFPSILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120

Query: 121 KGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTT 180
           KGVMPDGT+RFHNKKGED+LHFMGCSTFSQYTV+ADVSVVAIDPKAPLDKTCLLGCGVTT
Sbjct: 121 KGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTT 180

Query: 181 GYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGAT 240
           GYGAAVKTA+VQKGDTVA+FGAGTVGLSVVQGA VRGAS+IIVVDINDQKKQW+ +FGAT
Sbjct: 181 GYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGAT 240

Query: 241 DFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVA 300
           DFVNPSK LKDG+TIVD LVEMTDGGLD+TFDCTGNTDVMRSALEACHKGWG+SIIIGVA
Sbjct: 241 DFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVA 300

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDI 360
           AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+SDYMDGKLKVDEFITHRRGFTDI
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDI 360

Query: 361 NSAFEDLHHGDCLRTVLDLLK 381
           NSAFEDLHHGDCLRTVLDL K
Sbjct: 361 NSAFEDLHHGDCLRTVLDLSK 381

>SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 383

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/383 (87%), Positives = 366/383 (95%), Gaps = 2/383 (0%)

Query: 1   MSE--GKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP 58
           MSE  GKPITCLAAVAYEAGKPLT+EEI+V+PPKAHEVR++I YTAVCHTDAYTLSGVDP
Sbjct: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60

Query: 59  EGAFPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRAT 118
           EGAFPSILGHEGAG+VES+G+GVTNVKPGDHV+ALYTAEC++CKFC SGKTNLCGSVRAT
Sbjct: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120

Query: 119 QGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGV 178
           QGKGVMPDGT+RF  K GE ILHFMGCSTFSQYTV+ADVSVVA+D +APLD+ CLLGCGV
Sbjct: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTVVADVSVVAVDSQAPLDRICLLGCGV 180

Query: 179 TTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFG 238
           TTGYGAA+KTANVQKGDTVAVFGAGTVGLSVVQGAK RGASRIIVVDINDQKKQWA++FG
Sbjct: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240

Query: 239 ATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIG 298
           ATDFVNPSKDLK+G+TIV  L+E+TDGGLD+TFDCTGNT VMR ALEACHKGWG+SIIIG
Sbjct: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 299 VAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFT 358
           VAAAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+SDYMDG+LKVDEFITHRR FT
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360

Query: 359 DINSAFEDLHHGDCLRTVLDLLK 381
           +IN+AF+DLHHGDCLRTVLDL K
Sbjct: 361 EINAAFDDLHHGDCLRTVLDLSK 383

>NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa]
           {ON} Anc_7.350
          Length = 451

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/380 (86%), Positives = 356/380 (93%)

Query: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA 61
           ++GKPITC AAVAY AGKPLT+E+IVVDPPKAHEVR+KI YTAVCHTDAYTLSG+DPEGA
Sbjct: 72  TQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGA 131

Query: 62  FPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121
           FPSILGHEG+GIVES+GEGVTNVK GDHVIALYTAEC +CKFCKSGKTNLCGSVRATQGK
Sbjct: 132 FPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQGK 191

Query: 122 GVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTG 181
           GVMPDGT+RFHN+KGE +LHFMGCSTFSQYTV+ADVSVVA+DPKAPLD   LLGCGVTTG
Sbjct: 192 GVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTVVADVSVVAVDPKAPLDSISLLGCGVTTG 251

Query: 182 YGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATD 241
           YGAA+KTANVQKGDTVAVFGAGTVGLSVVQGAK RGAS+IIVVDIN+ KKQW+ +FGATD
Sbjct: 252 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATD 311

Query: 242 FVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAA 301
           FVNP +DLK+G+TIV  L+EMTDGGL+YTFDCTGN  VMR ALEACHKGWGESIIIGVA 
Sbjct: 312 FVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWGESIIIGVAG 371

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDIN 361
           AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI DY +GKLKVDEFITHRR FT+IN
Sbjct: 372 AGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEIN 431

Query: 362 SAFEDLHHGDCLRTVLDLLK 381
            AFEDLHHGDCLRTVLDL K
Sbjct: 432 DAFEDLHHGDCLRTVLDLAK 451

>KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 384

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/378 (83%), Positives = 348/378 (92%)

Query: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA 61
           + GKPI C+AAVAYEAGKPLT+E+I+VD PKAHEVRV++ +TAVCHTDAYTLSGVDPEGA
Sbjct: 5   TAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA 64

Query: 62  FPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121
           FPSILGHEGAGIVES+G+GVTNVK GDHV+ LYTAEC +CKFCKS KTNLCGSVRATQGK
Sbjct: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGK 124

Query: 122 GVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTG 181
           GVMPDGTTRFHN KGE +LHFMGCSTFSQYTV+ADVS+V IDP APL   CLLGCGVTTG
Sbjct: 125 GVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTG 184

Query: 182 YGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATD 241
           YGAAVKTANVQ+GDTVAVFGAGTVGLSVVQGAK RGAS+IIVVD+NDQKKQW+ +FGAT 
Sbjct: 185 YGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATG 244

Query: 242 FVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAA 301
           FVNP KDLK+G+TIV  L++MTDGGLD+TFDCTGN  VMR ALEACHKGWG+SIIIGVAA
Sbjct: 245 FVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSIIIGVAA 304

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDIN 361
           AG+EISTRPFQL+TGRVWKGSAFGGIKGRSEMG L++ Y  G LKVD+FITH+R FT+IN
Sbjct: 305 AGEEISTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEIN 364

Query: 362 SAFEDLHHGDCLRTVLDL 379
           +AFEDLHHGDCLRTVLDL
Sbjct: 365 NAFEDLHHGDCLRTVLDL 382

>TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.350
           YDL168W
          Length = 385

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/380 (85%), Positives = 352/380 (92%)

Query: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA 61
           +EGK ITC+AAVAYEAGKPLT+EEI V+ P+AHEVR+KI YTAVCHTDAYTLSGVDPEGA
Sbjct: 6   TEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA 65

Query: 62  FPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121
           FPSILGHEGAGIVES+GEGVTNVKPGDHVIALYTAEC++CKFCKSGKTNLC SVRATQGK
Sbjct: 66  FPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGK 125

Query: 122 GVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTG 181
           GVMPDGT+RF N+KGE++ HFMGCSTFSQYTV+ADVSVVA+DP APL+  CLLGCGVTTG
Sbjct: 126 GVMPDGTSRFKNQKGEELKHFMGCSTFSQYTVVADVSVVAVDPSAPLESICLLGCGVTTG 185

Query: 182 YGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATD 241
           YGAA KTANVQKGDTVAVFGAGTVGLSV+QGAKVRGASRII+VDINDQK+++ NEFGATD
Sbjct: 186 YGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATD 245

Query: 242 FVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAA 301
           F+NP  DLKDG+TIV+ L+EMTDGGLDYTFDCTGNT VMR ALEACHKGWG S+IIGVAA
Sbjct: 246 FINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDIN 361
           A +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI DY  G LKVDEFIT+ R FT+IN
Sbjct: 306 AEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEIN 365

Query: 362 SAFEDLHHGDCLRTVLDLLK 381
            AFEDLH GDCLRTVLDL K
Sbjct: 366 KAFEDLHAGDCLRTVLDLKK 385

>Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON}
           (77132..78274) [1143 nt, 381 aa]
          Length = 380

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/376 (83%), Positives = 341/376 (90%), Gaps = 1/376 (0%)

Query: 4   GKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFP 63
           GKPITC AAVAYEA KPL +EEIVVDPPKAHEVR+KI  TAVCHTDAYTLSGVDPEG FP
Sbjct: 5   GKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGLFP 64

Query: 64  SILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
            +LGHEG+GIVES+G+ VT VKPGDHV+ALYTAEC +CKFC SGKTNLCGSVRATQGKGV
Sbjct: 65  CVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
           MPDGT RFHNKKGE + HFMGCSTFS+YTV+ADVSVVAIDP APLD  CLLGCGVTTGYG
Sbjct: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184

Query: 184 AAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFV 243
           AA+KTANVQKGDTVAVFGAGTVGLSVVQGAK RGAS+IIVVDIN+ KK+W+ EFGATDFV
Sbjct: 185 AAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFV 244

Query: 244 NPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAG 303
           NPS +L +G+ IV  LVEMTDGGLD+TFDCTGN +VMR ALEACHKGWG+SIIIGVAAAG
Sbjct: 245 NPS-ELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAG 303

Query: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSA 363
           KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI DY +G LKVDEFIT+RR F +IN A
Sbjct: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEINDA 363

Query: 364 FEDLHHGDCLRTVLDL 379
           FE+LHHG+CLRTVL  
Sbjct: 364 FEELHHGNCLRTVLSF 379

>CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168w SFA1 long-chain alcohol dehydrogenase
          Length = 381

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/381 (80%), Positives = 342/381 (89%)

Query: 1   MSEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEG 60
           M+EGKPI CLAAVAYEAGKP  +E+IVVDPPKAHEVR+KI  TAVCHTDAYTLSG DPEG
Sbjct: 1   MTEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEG 60

Query: 61  AFPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120
            FP +LGHEGAGIVES+G+GVTNVKPGDHVIALYTAEC++CKFC SGKTNLCG+VRATQG
Sbjct: 61  LFPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQG 120

Query: 121 KGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTT 180
           KGVMPDGT+RFHNKKGE + HFMGCSTFS+YTV+ADVSVVAID  APL+  CLLGCGVTT
Sbjct: 121 KGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTT 180

Query: 181 GYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGAT 240
           GYGAAVKTANVQKGDTVAVFG GTVGLSV+QGA  RGASRII +D NDQKK +  +FGAT
Sbjct: 181 GYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGAT 240

Query: 241 DFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVA 300
           DF+NP+KDLK+ +TIV  L+EMTDGGLD+TFDCTGN +VMRSALEACHKGWG+S+IIGVA
Sbjct: 241 DFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVA 300

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDI 360
           AAG+EISTRPFQLVTGRVWKGSAFGG+KGRSEM GLI  Y  G+LKVDEFITHRR F +I
Sbjct: 301 AAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEI 360

Query: 361 NSAFEDLHHGDCLRTVLDLLK 381
           N AF+DLH+G CLRTVL   K
Sbjct: 361 NEAFDDLHNGLCLRTVLSFSK 381

>YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}
           SFA1Bifunctional enzyme containing both alcohol
           dehydrogenase and glutathione-dependent formaldehyde
           dehydrogenase activities, functions in formaldehyde
           detoxification and formation of long chain and complex
           alcohols, regulated by Hog1p-Sko1p
          Length = 386

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/374 (81%), Positives = 340/374 (90%)

Query: 4   GKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFP 63
           GKPI C+AAVAY+A KPL++EEI VD PKAHEVR+KI YTAVCHTDAYTLSG DPEG FP
Sbjct: 7   GKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFP 66

Query: 64  SILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
            +LGHEGAGIVES+G+ V  VKPGDHVIALYTAEC +CKFC SGKTNLCG+VRATQGKGV
Sbjct: 67  CVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGV 126

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
           MPDGTTRFHN KGEDI HFMGCSTFS+YTV+ADVSVVAIDPKAPLD  CLLGCGVTTG+G
Sbjct: 127 MPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFG 186

Query: 184 AAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFV 243
           AA+KTANVQKGDTVAVFG GTVGLSV+QGAK+RGAS+II +DIN++KKQ+ ++FGATDFV
Sbjct: 187 AALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQFGATDFV 246

Query: 244 NPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAG 303
           NP +DL   +TIV+ L+EMTDGGLD+TFDCTGNT +MR ALEACHKGWG+SIIIGVAAAG
Sbjct: 247 NPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVAAAG 306

Query: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSA 363
           +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI DY  G LKV+EFITHRR F +IN A
Sbjct: 307 EEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEINQA 366

Query: 364 FEDLHHGDCLRTVL 377
           FEDLH+GDCLRTVL
Sbjct: 367 FEDLHNGDCLRTVL 380

>Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W
           (REAL)
          Length = 386

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/376 (81%), Positives = 339/376 (90%)

Query: 4   GKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFP 63
           GKPI C+AAVAY+A KP ++EEI VD PKAHEVR+KI YTAVCHTDAYTLSG DPEG FP
Sbjct: 7   GKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFP 66

Query: 64  SILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
            ILGHEGAGIVES+G+GV  VKPGDHVIALYTAEC +CKFC SGKTNLC +VRATQGKGV
Sbjct: 67  CILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGV 126

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
           MPDGTTRFHN KG+DI HFMGCSTFS+YTV+ADVSVVAIDPKAPLD +CLLGCGVTTGYG
Sbjct: 127 MPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYG 186

Query: 184 AAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFV 243
           AAVKTANVQKGDTVAVFG GTVGLSV+QGAK+RGAS+II VDIN+ KK++ ++FGATDF+
Sbjct: 187 AAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFI 246

Query: 244 NPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAG 303
           NP +DL   +TIV+ LVEMTDGGLD+TFDCTGNT +MR ALEACHKGWG+SIIIGVAAAG
Sbjct: 247 NPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVAAAG 306

Query: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSA 363
           +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI DY  G LKV+EFITHRR F +IN A
Sbjct: 307 EEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEINHA 366

Query: 364 FEDLHHGDCLRTVLDL 379
           FEDLH+GDCLRTVL  
Sbjct: 367 FEDLHNGDCLRTVLKF 382

>Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii ACL148C
          Length = 381

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/379 (81%), Positives = 340/379 (89%)

Query: 1   MSEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEG 60
           ++ GK I C AA+AY AG PL IE I VDPPKAHEVR+KI +TA+CHTDAYTLSGVDPEG
Sbjct: 3   ITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEG 62

Query: 61  AFPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120
            FPSILGHEG+GIVES+G GVTNVK GDHVI LYTAEC+ECKFC SGKTNLCGSVRATQG
Sbjct: 63  IFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQG 122

Query: 121 KGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTT 180
           KG+MPDGT+RF N KGE I HFMGCSTFS+YTV+ADVSVVAID KAPLDK CLLGCGVTT
Sbjct: 123 KGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTT 182

Query: 181 GYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGAT 240
           GYGAAVKTA+VQKGDTVAVFGAGTVGLSVVQGA+ RGAS+IIVVDIND KK+W+ +FGAT
Sbjct: 183 GYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGAT 242

Query: 241 DFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVA 300
           DF+NP+KDL DG+TIV  L++MTDGGLD+TFDCTGNT VMR ALEACHKGWG+SIIIGVA
Sbjct: 243 DFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVA 302

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDI 360
           AAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMG LISDY  GKLKVDEF+TH R F++I
Sbjct: 303 AAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEI 362

Query: 361 NSAFEDLHHGDCLRTVLDL 379
           N    DLHHGDCLRTVL+ 
Sbjct: 363 NDGLTDLHHGDCLRTVLNF 381

>Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/374 (81%), Positives = 339/374 (90%)

Query: 4   GKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFP 63
           GKPI C+AAVAY A K L++EEI VDPPKAHEVR+KI +TAVCHTDAYTLSG DPEG FP
Sbjct: 7   GKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFP 66

Query: 64  SILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
            ILGHEGAGIVES+G+ V  VKPGDHVIALYTAEC +CKFC SGKTNLC +VRATQGKGV
Sbjct: 67  CILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGV 126

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
           MPDGTTRFHN KGEDI HFMGCSTFS+YTV+ADVSVVAIDPKAPLD  CLLGCGVTTGYG
Sbjct: 127 MPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYG 186

Query: 184 AAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFV 243
           AA+KTANVQ+GDTVAVFG GTVGLSV+QGAK RGAS+II VDIN++K+Q+++ FGATDF+
Sbjct: 187 AAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFI 246

Query: 244 NPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAG 303
           NP +DL + +TIV+ L++MTDGGLD+TFDCTGNT++MR ALEACHKGWG+SIIIGVAAAG
Sbjct: 247 NPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSIIIGVAAAG 306

Query: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSA 363
           +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI DY  G LKV+EFITHRR F +IN A
Sbjct: 307 EEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEINQA 366

Query: 364 FEDLHHGDCLRTVL 377
           FEDLH+GDCLRTVL
Sbjct: 367 FEDLHNGDCLRTVL 380

>Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/378 (80%), Positives = 338/378 (89%)

Query: 4   GKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFP 63
           GKPI C+AA+AY+A KPL++EEI VDPPKAHEVR+KI YTAVCHTDAYTLSG DPEG FP
Sbjct: 7   GKPIQCIAAIAYDAKKPLSVEEITVDPPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFP 66

Query: 64  SILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
            ILGHEGAGIVES+G+ VT VKPGDHVIALYTAEC +CKFC SGKTNLC +VRATQG+G+
Sbjct: 67  CILGHEGAGIVESVGDDVTTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGRGI 126

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
           MPD TTRFHN KGEDI HFMGCSTFS+YTV+ADVSVVAIDPKAPLD   LLGCGVTTGYG
Sbjct: 127 MPDETTRFHNGKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAASLLGCGVTTGYG 186

Query: 184 AAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFV 243
           AAVKTANVQKGDTVAVFG GTVGLSV+QGAK RGAS+II +DIN++KKQ+  +FGATDF+
Sbjct: 187 AAVKTANVQKGDTVAVFGCGTVGLSVIQGAKARGASKIIGIDINNKKKQYCFDFGATDFI 246

Query: 244 NPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAG 303
           NP +DL  G+TIV+ L+E TDGGLD+TFDCTGNT +MR ALEACHKGWG+SIIIGVAAAG
Sbjct: 247 NPKEDLAKGQTIVEKLIETTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVAAAG 306

Query: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSA 363
           +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI DY +G LKV+EFITHRR F +IN A
Sbjct: 307 EEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGALKVEEFITHRRPFKEINQA 366

Query: 364 FEDLHHGDCLRTVLDLLK 381
           FEDLH GDCLRTVL   K
Sbjct: 367 FEDLHQGDCLRTVLKFDK 384

>TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/380 (79%), Positives = 343/380 (90%)

Query: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA 61
           ++GKPI CLAAVAY+A +PLT+EEI+V+PP+AHEVR+KI +TAVCHTDAYTLSGVDPEGA
Sbjct: 4   TQGKPIKCLAAVAYKAAEPLTVEEIIVEPPEAHEVRIKITHTAVCHTDAYTLSGVDPEGA 63

Query: 62  FPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121
           FP +LGHEG+GIVES+GEGV++VK GDHVIALYTAEC  CKFCKSGKTNLCGSVR TQGK
Sbjct: 64  FPCVLGHEGSGIVESVGEGVSSVKVGDHVIALYTAECGVCKFCKSGKTNLCGSVRETQGK 123

Query: 122 GVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTG 181
           GVMPDGT+RF N KGE +LHFMGCSTFSQYTV+ADVSVVAI+  APL   CLLGCGVTTG
Sbjct: 124 GVMPDGTSRFKNLKGESLLHFMGCSTFSQYTVVADVSVVAINKTAPLQSVCLLGCGVTTG 183

Query: 182 YGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATD 241
           YGAA+KTANVQK DTVAVFGAGTVGLSVVQGA+ RGAS+II+VD+N +K+ ++ +FGATD
Sbjct: 184 YGAAIKTANVQKNDTVAVFGAGTVGLSVVQGAQARGASKIIMVDVNSKKETYSRQFGATD 243

Query: 242 FVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAA 301
           F+NP  DLK G+TIV  LVEMTDGGLD+TFDCTGN  VMR ALE CHKGWG+SIIIGVAA
Sbjct: 244 FINPMTDLKPGETIVSKLVEMTDGGLDHTFDCTGNVKVMRDALECCHKGWGQSIIIGVAA 303

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDIN 361
           AG+EISTRPFQLVTGRVWKGSAFGG+KGRSEMGGLI  Y  G LKVD+FIT++R FT+IN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMGGLIESYQKGDLKVDQFITNKRPFTEIN 363

Query: 362 SAFEDLHHGDCLRTVLDLLK 381
           +AFEDLHHGDCLRTVLDL K
Sbjct: 364 AAFEDLHHGDCLRTVLDLEK 383

>ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 382

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/377 (82%), Positives = 347/377 (92%)

Query: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA 61
           +EGKP+T LAAVAYEAGKPL++EEI VDPPKAHEVR+++  TAVCHTDAYTLSG DPEGA
Sbjct: 3   TEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA 62

Query: 62  FPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121
           FPSILGHEGAGIVES+GEGVT+VKPGDHV+ALYTAEC +CKFCKSGKTNLCGSVRATQGK
Sbjct: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGK 122

Query: 122 GVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTG 181
           GVMPDGT+RF NKKGE +LHFMGCSTFS+YTV+ADVSVVA+DPKAPL+  CLLGCGVTTG
Sbjct: 123 GVMPDGTSRFKNKKGETLLHFMGCSTFSEYTVVADVSVVAVDPKAPLESACLLGCGVTTG 182

Query: 182 YGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATD 241
           YGAAVKTANVQKGDTVA+FGAGTVGLSV QGAK RGAS+II+VDIND KK++ +EFGATD
Sbjct: 183 YGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATD 242

Query: 242 FVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAA 301
           F+NP+ DL++G+TIV+ L+EMTDGGLD+TFDCTGN  VMR ALEACHKGWG S++IGVAA
Sbjct: 243 FINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKGWGVSVVIGVAA 302

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDIN 361
           +G+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI DY  G LKVDEFIT+RR F  IN
Sbjct: 303 SGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQIN 362

Query: 362 SAFEDLHHGDCLRTVLD 378
            AFEDLH GD LRTVL+
Sbjct: 363 EAFEDLHAGDSLRTVLN 379

>TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/375 (81%), Positives = 335/375 (89%), Gaps = 1/375 (0%)

Query: 4   GKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFP 63
           GKPITC AA+AYEA KPLT+ EIVVDPPKAHEVR+KI  TAVCHTDAY+LSGVDPEG FP
Sbjct: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64

Query: 64  SILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
            +LGHEG+GIVESIG  VTNVK GDHVIALYTAEC +CKFC SGKTNLCGSVRATQGKGV
Sbjct: 65  CVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
           MPDGTTRFH+K G+ I HFMGCSTFSQYTV+ADVS+VA D     + T LLGCGVTTGYG
Sbjct: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184

Query: 184 AAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFV 243
           AA+KTAN+QKGDTVAVFGAGTVGLSVVQGAK RGAS+IIVVD+N+ KK W+ EFGATDFV
Sbjct: 185 AAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244

Query: 244 NPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAG 303
           NP K+LKD + IV  L+EMTDGGLD+TFDCTGN +VMR+ALEACHKGWG+SIIIGVAAAG
Sbjct: 245 NP-KELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303

Query: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSA 363
           +EI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGLI DY  G LKVDEFIT RR FT+IN+A
Sbjct: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363

Query: 364 FEDLHHGDCLRTVLD 378
           FEDLH+G CLRTVLD
Sbjct: 364 FEDLHNGSCLRTVLD 378

>ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL168W
           (SFA1)
          Length = 381

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/378 (80%), Positives = 343/378 (90%)

Query: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA 61
           ++GKPI C AAVAY AG+PL IE++ VDPPKAHEVR+KI  +A+CHTDAYTLSG DPEG 
Sbjct: 4   TQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL 63

Query: 62  FPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121
           FP ILGHEG+GIVES+GEGVTNVKPGDHV+ LYTAEC++CKFC SGKTNLCG+VRATQGK
Sbjct: 64  FPCILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQGK 123

Query: 122 GVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTG 181
           GVMPDGT+RF N KGE + HFMGCSTFS+YTV+ADVSVVA+D +APL+  CLLGCGVTTG
Sbjct: 124 GVMPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVSVVAVDQQAPLETVCLLGCGVTTG 183

Query: 182 YGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATD 241
           YGAAVKTA+VQ+GDTVAVFGAGTVGLSVVQGAK R ASRIIVVDIND K++WA++FGATD
Sbjct: 184 YGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATD 243

Query: 242 FVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAA 301
           F+NP  DLK+G+TIV  L+EMTDGGLD+TFDCTGNT VMR ALEACHKGWG+SIIIGVAA
Sbjct: 244 FINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDIN 361
           AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY++G LKV EF+TH+R F +IN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEIN 363

Query: 362 SAFEDLHHGDCLRTVLDL 379
           S FEDLHHGDCLRTVL L
Sbjct: 364 SGFEDLHHGDCLRTVLSL 381

>KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/378 (76%), Positives = 331/378 (87%)

Query: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA 61
           ++GK I C AAVAYEA KPL +++++VD PKAHEVR+KI  TA+CHTDAYTLSGVDPEG 
Sbjct: 4   TQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL 63

Query: 62  FPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121
           FP ILGHEG+GIVESIGEGVT+VK GDHVI LYTAEC++CKFCKSGKTNLCG+VR TQGK
Sbjct: 64  FPCILGHEGSGIVESIGEGVTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQGK 123

Query: 122 GVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTG 181
           GVMPDGT+RFH  +G+DI HFMGCSTFS+YTV+ADVSVVAID K  L+   LLGCGVTTG
Sbjct: 124 GVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTG 183

Query: 182 YGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATD 241
           +GAAVK ANVQKGDTVAVFGAGTVGLSVVQGA++RG S++IVVDIND+KKQ++ +FGATD
Sbjct: 184 FGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATD 243

Query: 242 FVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAA 301
           FVNP  DLKDG+TIV+ L+ MTDGGLDYTFDCTGN  VMR+ALEACHKGWG+S IIGVAA
Sbjct: 244 FVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAA 303

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDIN 361
           AG+EISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY  G LK+DEFITHRR F +IN
Sbjct: 304 AGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIN 363

Query: 362 SAFEDLHHGDCLRTVLDL 379
             FEDLH G CLRTVL  
Sbjct: 364 DGFEDLHMGTCLRTVLKF 381

>NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350
          Length = 422

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/380 (74%), Positives = 306/380 (80%), Gaps = 46/380 (12%)

Query: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA 61
           ++GKPITC AAVAYEAGKPLT+E+IVVDPPKAHEVR+KI YTAVCHTDAYTLSGVDPEGA
Sbjct: 89  TQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGA 148

Query: 62  FPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121
           FPSILGHEG+GIVES+GEGVTNVK GDHVIALYTAEC ECKFCKSG              
Sbjct: 149 FPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGECKFCKSGXXX----------- 197

Query: 122 GVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTG 181
                                                  A+D  AP+D  CLLGCGVTTG
Sbjct: 198 -----------------------------------XXXXAVDKNAPMDSICLLGCGVTTG 222

Query: 182 YGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATD 241
           YGAA+KTANVQKGDTVAVFGAGTVGLSVVQGAK RGAS+IIVVD+NDQKKQW+ +FGATD
Sbjct: 223 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATD 282

Query: 242 FVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAA 301
           F+NP  DLK+G+TIV  L+EMTDGGL+YTFDCTGNT VMR ALEACHKGWGESIIIGVAA
Sbjct: 283 FINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWGESIIIGVAA 342

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDIN 361
           AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI DY +G LKVDEFITHRR FT+IN
Sbjct: 343 AGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTEIN 402

Query: 362 SAFEDLHHGDCLRTVLDLLK 381
           +AFEDLHHGDCLRTVLDL K
Sbjct: 403 NAFEDLHHGDCLRTVLDLSK 422

>KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {ON}
           Anc_7.350 YDL168W
          Length = 382

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/384 (72%), Positives = 312/384 (81%), Gaps = 13/384 (3%)

Query: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA 61
           +EG+ ITC AAVAY AGKPLT+E+I V+ P       + AY    H   Y   G      
Sbjct: 4   TEGQTITCTAAVAYAAGKPLTVEQITVEAPTG----ARGAYQD--HQHCYLPHGCVHSVW 57

Query: 62  FPS-------ILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGS 114
           F S         G  GAG+VES+G  VT+VK GDHVIALYTAECKECK CKSGKTNLC +
Sbjct: 58  FGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSA 117

Query: 115 VRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLL 174
           VRATQGKGVMPDGT+RF N KGE +LHFMGCSTF++YTV+ADVSVVAID  APL+K CLL
Sbjct: 118 VRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLL 177

Query: 175 GCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWA 234
           GCGVTTGYGAA+KTANVQKGDTVAVFGAGT+GLSVVQGAK R AS+IIVVDIND KK++A
Sbjct: 178 GCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFA 237

Query: 235 NEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGES 294
            +FGATDFVNP  DLKDG+TIV+ LVEMTDGGLD+TFD TGN  VMR ALEACHKGWG+S
Sbjct: 238 FDFGATDFVNPKTDLKDGQTIVEKLVEMTDGGLDFTFDGTGNVQVMRDALEACHKGWGQS 297

Query: 295 IIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHR 354
           IIIGVAAAGKEISTRPFQLVTGRVWKGSAFGG+KGRSEMG LI DY  G LK+DEFIT++
Sbjct: 298 IIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNK 357

Query: 355 RGFTDINSAFEDLHHGDCLRTVLD 378
           R F +IN  FEDLHHGDCLRTVL+
Sbjct: 358 RPFKEINEGFEDLHHGDCLRTVLN 381

>SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON}
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione- dependent formaldehyde dehydrogenase)
          Length = 388

 Score =  456 bits (1172), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 214/377 (56%), Positives = 281/377 (74%), Gaps = 3/377 (0%)

Query: 3   EGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAF 62
           EG+PI C AAVAY   KPL +E+I+VDPP+ HEVRVK+  TA+C TD +TL G++PEG F
Sbjct: 5   EGEPIRCTAAVAYSINKPLVLEQIIVDPPQEHEVRVKVTNTALCRTDLFTLKGLNPEGKF 64

Query: 63  PSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKG 122
           P +LGHEG+GIVES G  V  VK GDHV+ LY  EC  C  CKS K+NLC  ++ATQ +G
Sbjct: 65  PCVLGHEGSGIVESCGSKVETVKKGDHVLLLYIPECGHCADCKSEKSNLCSVIKATQAQG 124

Query: 123 VMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGY 182
           VMP G++R HN + + + HFMGCS+FSQY V++D+S V I   APLDK CLLGCGVTTG+
Sbjct: 125 VMPQGSSRLHNLENKTLWHFMGCSSFSQYAVVSDISCVKIRDDAPLDKICLLGCGVTTGF 184

Query: 183 GAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
           GA +    V+ GD VAVFG+GTVGLSVVQ        ++IVVD+ D K++WA  FGATDF
Sbjct: 185 GAPI-AKGVKAGDRVAVFGSGTVGLSVVQSCSQLKCFQVIVVDVQDNKREWALGFGATDF 243

Query: 243 VNPSKDLKDGKTIVDMLVEMTDG-GLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAA 301
           +NP K  K+ K+++  L++ + G G D+TFDCTG+T VMR+ALE+C KGWG S+IIG+A 
Sbjct: 244 INPQKIPKN-KSLLQTLIDKSGGDGFDFTFDCTGSTSVMRTALESCRKGWGTSVIIGLAG 302

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDIN 361
           AG+EIST P+ L+ GR W+G AFGG+KGRSE+  L+  YM+ ++K+DE+IT++R   +IN
Sbjct: 303 AGEEISTLPYNLIVGRSWEGCAFGGVKGRSELPTLVERYMNNEIKLDEYITNKRPLKEIN 362

Query: 362 SAFEDLHHGDCLRTVLD 378
            A ++L  G  L+TVLD
Sbjct: 363 EALKELEDGLVLKTVLD 379

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score =  115 bits (287), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 95/347 (27%), Positives = 156/347 (44%), Gaps = 48/347 (13%)

Query: 38  VKIAYTAVCHTDAYTLSGVDPE---------GAFP-SILGHEGAGIVESIGEGVTNVKPG 87
           +K+ +T++C TD     G +PE         G+F   ILGHEG GI++ +G+ V N K G
Sbjct: 60  IKMTHTSICGTDLGIWKGKNPEIEQTAQTKEGSFNGRILGHEGIGIIDEVGDAVHNFKKG 119

Query: 88  DHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCST 147
           D VI    + C  C+ C     + C     T G G                IL +M   T
Sbjct: 120 DRVIVSCISRCGTCENCAKSLYSHC-----TNGGGW---------------ILGYMIDGT 159

Query: 148 FSQY--TVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTV 205
            ++Y  T  AD S+ ++      +   +L   + T +   V+  NV+ GDTVA+ GAG V
Sbjct: 160 QAEYVRTPFADTSLYSVPENLSDEAAVMLSDALPTAHEIGVQMGNVKPGDTVAIVGAGPV 219

Query: 206 GLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG 265
           G+  V  +++   S +IVVDI+D +   A E G+T  +N +K+       V  ++E T+G
Sbjct: 220 GMGCVLTSQLYSPSLLIVVDIDDNRLAMAKEMGSTHTINSAKE-----DAVSKILEYTNG 274

Query: 266 -GLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVW--KGS 322
            G+D   +  G     ++  + C +   E    G   A   +  +P      ++W    +
Sbjct: 275 RGVDCVMEAVG----AQATWDICQRVIKE----GGHLANVGVHGKPVNFEIDKLWIKNLT 326

Query: 323 AFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHH 369
              G+   +  G L+     GKLK +  +TH   F +++  +    H
Sbjct: 327 ITSGLVNTNTTGMLMKSCCSGKLKSERLVTHHCNFGEMSGNYNIFKH 373

>SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar to
           uniprot|P35497 Saccharomyces cerevisiae YJR159W SOR1
           Sorbitol dehydrogenase expression is induced in the
           presence of sorbitol
          Length = 354

 Score =  112 bits (280), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 117/385 (30%), Positives = 179/385 (46%), Gaps = 58/385 (15%)

Query: 12  AVAYEAGKPLTIEEIVV----DPPKAHEVRVKIAYTAVCHTDA-YTLSGVDPEGAF---- 62
           AV  +    +T E+I V    DP   H V++ I  T +C +D  Y  +G    G F    
Sbjct: 7   AVVLQKQGLITFEDIPVPQIEDP---HYVKLAIKKTGICGSDVHYYKTGAI--GNFVVKD 61

Query: 63  PSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKG 122
           P +LGHE +G+V  +G  VT+VK GD V        +  K  KSG  NLC S+       
Sbjct: 62  PMVLGHESSGVVVEVGSKVTSVKVGDRVAIEPGVPSRYSKATKSGHYNLCPSMAFAATPP 121

Query: 123 VMPDGTTRFHNKKGEDILHFMGCS-TFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTG 181
           +  DGT   +    ED L  +  S +F +   +  +SV                 GV   
Sbjct: 122 I--DGTLLKYYLSPEDFLVKLPDSVSFEEGACVEPLSV-----------------GV--- 159

Query: 182 YGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATD 241
              A K A+V+ G  V VFGAG VGL     ++  GA+ ++ VD+ D K +  NEFGAT 
Sbjct: 160 --HANKLADVRFGSKVVVFGAGPVGLLAGAVSRAFGATDVVFVDVFDHKLERTNEFGATQ 217

Query: 242 FVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAA 301
            VN SK   +   + ++   ++    +  F+C+G    +R+ ++AC  G G  + +G+  
Sbjct: 218 TVNSSKFKSEDDLVKEIQRVLSGEQPEVVFECSGAEVCIRAGIKACKAG-GRYVQVGMGK 276

Query: 302 AG-----KEISTRPFQLV-TGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRR 355
                   E+ ++  Q++ T R   G     +K       LIS   +GK+ V   ITHR 
Sbjct: 277 DNVNFPISEVVSKELQVLGTFRYCFGDYNDSVK-------LIS---EGKVNVKPLITHRF 326

Query: 356 GFTDINSAFE-DLHHG-DCLRTVLD 378
            F D   A+E ++ HG D ++T++D
Sbjct: 327 KFQDAIKAYEFNIEHGEDVVKTIID 351

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score =  113 bits (282), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 101/378 (26%), Positives = 164/378 (43%), Gaps = 53/378 (14%)

Query: 10  LAAVAYEAGKPLTIEEIVVDPPKAHEVR---VKIAYTAVCHTDAYTLSGVDPE------- 59
           + A+ Y     L  E+  +  PK  + R   +K+  T++C TD     G  PE       
Sbjct: 31  MKAMVYYGANDLRFEDRAI--PKIIDQRDAIIKMTNTSICGTDVGIWKGKSPEIEEIAVK 88

Query: 60  --GAFP-SILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVR 116
             G+F   +LGHEG GIV  +G+ V N+K GD VI      C  C+ C  G    C    
Sbjct: 89  NEGSFNGRVLGHEGTGIVTEVGDAVRNIKKGDKVIISCITRCGTCENCARGMYAHC---- 144

Query: 117 ATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQY--TVLADVSVVAIDPKAPLDKTCLL 174
                  M DG            L +    T ++Y  T  AD S+ A+      +   LL
Sbjct: 145 -------MNDGGWA---------LGYSIDGTQAEYVRTPFADTSLYALPEGLSDENAVLL 188

Query: 175 GCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWA 234
              + T +   V+  NV+ GD+VA+ GAG VG+  V  +++   S +IVVD++D + + A
Sbjct: 189 SDALPTAHEIGVQMGNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLLIVVDMDDNRLEMA 248

Query: 235 NEFGATDFVNPSKDLKDGKTIVDMLVEMTDG-GLDYTFDCTGNTDVMRSALEACHKGWGE 293
            E GAT  +N  K+       V  ++E+T+G G+D   +  G     +   + C +   E
Sbjct: 249 KEMGATHTINSGKE-----DAVAKILEITNGRGVDCAMEAVG----AQPTWDICQQIIKE 299

Query: 294 SIIIGVAAAGKEISTRPFQLVTGRVW--KGSAFGGIKGRSEMGGLISDYMDGKLKVDEFI 351
               G   A   +  +P      ++W    +   G+   +    L+ +   GKL+ D+ +
Sbjct: 300 ----GGHLANVGVHGKPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKNCCSGKLQSDKLV 355

Query: 352 THRRGFTDINSAFEDLHH 369
           +H   F D+ + +    H
Sbjct: 356 SHHCNFKDMANNYNIFKH 373

>SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {ON}
           uniprot|Q6XQ74 Saccharomyces kluyveri ADH1 Alcohol
           dehydrogenase 1
          Length = 351

 Score =  109 bits (272), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 108/383 (28%), Positives = 166/383 (43%), Gaps = 45/383 (11%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A + YE G  L  ++I V  PK++E+ + I Y+ VCHTD +   G  P     P 
Sbjct: 7   PETQKAVIFYENGGELQYKDIPVPKPKSNEILINIKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAGIV  +GE V   K GD+  I      C  C++C+    + C           
Sbjct: 67  VGGHEGAGIVVGMGENVKGWKIGDYAGIKWLNGSCMSCEYCELSNESNC----------- 115

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PD     +   G          +F QY     V    I P   L +   + C   T Y 
Sbjct: 116 -PDADLSGYTHDG----------SFQQYATADAVQAARIAPGTDLAEVAPVLCAGITVY- 163

Query: 184 AAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN++ G+ VA+ GA G +G   +Q AK  G  R++ +D  D+K     E G   F
Sbjct: 164 KALKSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGDEKAALFKELGGEVF 222

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACH---KGWGESIIIGV 299
           +    D    K +V  +V+ T+GG         N  V  +A+EA     +  G  +++G+
Sbjct: 223 I----DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEASTVYCRANGTVVLVGL 274

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTD 359
               K  S    Q+V      GS  G    R++    +  +  G +K    +    G ++
Sbjct: 275 PGGAKCKSDVFNQVVKSISIVGSYVG---NRADTREALDFFSRGLVKSPIMVV---GLSE 328

Query: 360 INSAFEDLHHGDCL-RTVLDLLK 381
           + S +E +  G  + R V+D  K
Sbjct: 329 LPSIYEKMEKGAIVGRYVVDTSK 351

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score =  106 bits (264), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 106/391 (27%), Positives = 166/391 (42%), Gaps = 53/391 (13%)

Query: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EG 60
           S+  P +  A V YE    L  ++I V  PKA+E+ V + Y+ VCH+D +   G  P + 
Sbjct: 3   SQAIPESQKAIVFYETNGKLEYKDIAVPEPKANEILVHVKYSGVCHSDLHAWRGDWPFQL 62

Query: 61  AFPSILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQ 119
            FP I GHEGAG+V  +G  V   K GD   I      C  C++C+ G  + C  +    
Sbjct: 63  KFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL---- 118

Query: 120 GKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVT 179
                 DGT   H+             TF +Y     V    +     L +   + C   
Sbjct: 119 ------DGTGFTHD------------GTFQEYATADAVQAAHLPENVDLAEVAPILCAGV 160

Query: 180 TGYGAAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFG 238
           T Y  A+K AN+  G  V + GA G +G   +Q A   G  R+I +D  + KKQ     G
Sbjct: 161 TVY-KALKRANLIPGQWVTISGACGGLGSLAIQYATAMG-YRVIGIDEGETKKQLFEGLG 218

Query: 239 ATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIG 298
              F++ +K+    K IV  +++ TDGG     + + +   + ++   C    G  +++G
Sbjct: 219 GEVFIDFTKE----KDIVGAVIKATDGGSHGVINVSVSEAAIEASTRYCRPN-GTVVLVG 273

Query: 299 VAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITH----- 353
           + A     S    Q+V             K  S +G  + +  D +  +D F  H     
Sbjct: 274 MPAHAYCKSDVFNQVV-------------KSISIVGSCVGNRADTREALDFFARHLVKSP 320

Query: 354 --RRGFTDINSAFEDLHHGDCL-RTVLDLLK 381
               G +D+   FE + +G  + R V+D  K
Sbjct: 321 IRLAGLSDVPEIFEKMENGSIVGRYVVDTSK 351

>NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118
          Length = 351

 Score =  106 bits (264), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 97/387 (25%), Positives = 169/387 (43%), Gaps = 53/387 (13%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A +    G  L  ++I V  PK++E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFETNGGKLEYKDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V ++G+ V   K GD+  I      C  C++C+ G  + C           
Sbjct: 67  VGGHEGAGVVVAMGDAVKGWKIGDYAGIKWLNGSCMSCEYCELGNESNCPHA-------- 118

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         D+  +    +F QY     V    I P + L +   + C   T Y 
Sbjct: 119 --------------DLSGYTHDGSFQQYATADAVQAARIAPGSDLAEVAPVLCAGITVY- 163

Query: 184 AAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN++ G+ VA+ GA G +G   +Q AK  G  R++ +D  D+K +   + G   F
Sbjct: 164 KALKSANLRAGEWVAISGACGGLGSLAIQFAKAMG-YRVVGIDGGDEKAKMFKDLGGEVF 222

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAA 302
           +    D    K IV  +++ T+GG     + + +   + ++++ C    G ++++G+   
Sbjct: 223 I----DFTKTKDIVGDIIKATNGGAHGVINVSVSEQAIDASVKYCRAN-GTAVLVGM-PG 276

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFI-------THRR 355
           G ++ +  F  V            +K  S +G  + +  D +  +D F         H  
Sbjct: 277 GAQVKSDVFNQV------------VKSISIVGSYVGNRADTREALDFFSRGLVKSPIHIA 324

Query: 356 GFTDINSAFEDLHHGDCL-RTVLDLLK 381
             +D+   FE +  G  + R V+D  K
Sbjct: 325 KLSDVPEIFEKMEKGQIVGRYVVDCSK 351

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score =  105 bits (261), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 93/345 (26%), Positives = 153/345 (44%), Gaps = 37/345 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPS 64
           P +    + YE G  L  +++ V  PK +E+ + + Y+ VCHTD +   G  P GA  P 
Sbjct: 28  PQSQKGVIFYEHGGKLEYKDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWPLGAKLPL 87

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V + G  VTN + GD+  I      C  C+FC+ G  + C           
Sbjct: 88  VGGHEGAGVVVAKGSSVTNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKA-------- 139

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         D+  +    +F QY     +    I     L +   + C   T Y 
Sbjct: 140 --------------DLSGYTHDGSFQQYATADAIQAAQIPKGTDLAQVAPILCAGVTVY- 184

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K ++V+ G  VA+ G AG +G   VQ AK  G  R++ +D  D+K++     G   F
Sbjct: 185 KALKDSDVKPGQWVAISGAAGGLGSLAVQYAKAMGM-RVLGIDAGDEKRKLFESLGGNHF 243

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAA 302
           V    D    K +V  + E+T+GG     + + +   +  ++E   +  G  +++G+  A
Sbjct: 244 V----DFTKTKDLVSEIQEITEGGPHGVINVSVSEKAIGQSVEYV-RPCGTVVLVGL-PA 297

Query: 303 GKEISTRPFQLVTGRV-WKGSAFGGIKGRSEMGGLISDYMDGKLK 346
           G  + +  F  V   +  KGS  G    R++    I  +  G++K
Sbjct: 298 GATVKSDVFNHVIKSINIKGSYVG---NRADTREAIDFFAKGQVK 339

>Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar to
           Ashbya gossypii AER032W
          Length = 348

 Score =  103 bits (258), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 95/348 (27%), Positives = 152/348 (43%), Gaps = 45/348 (12%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A + YE G  L   +I V  PK  E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKAVIFYENGGELKYTDIPVPKPKPSELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V ++GE V   K GD   I      C  C++C+    + C           
Sbjct: 64  VGGHEGAGVVVAMGENVRGWKIGDFAGIKWLNGSCMTCEYCEKSNESNC----------- 112

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PD     +   G          +F QY     V    I     L +   + C   T Y 
Sbjct: 113 -PDADLSGYTHDG----------SFQQYATADAVHAAKIPQGTDLAQVAPVLCAGITVY- 160

Query: 184 AAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+A +Q G+ VA+ GA G +G   VQ AK  G  RI+ +D  ++KK+   E G   F
Sbjct: 161 KALKSARLQAGEWVAISGASGGLGSLAVQYAKAMG-YRILGIDSGEEKKKLFKELGGEYF 219

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAA 302
           +    D  + K +V  ++++T+GG     + + +   + ++ E C    G  +++G+  A
Sbjct: 220 I----DFAESKDVVAEVIKVTNGGAHGVINVSVSEAAIAASAEYCRSN-GTVVLVGL-PA 273

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEF 350
           G ++ +  F  V            +K  S +G  + +  D +  +D F
Sbjct: 274 GAQMRSEVFSHV------------VKSISVVGSYVGNRADSREAIDFF 309

>AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL086C (ADH1) and
           YBR145W (ADH5)
          Length = 351

 Score =  103 bits (258), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 86/302 (28%), Positives = 134/302 (44%), Gaps = 32/302 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A + YE G PL   +I V  PKA E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 7   PRTQKAVIFYENGGPLQYTDIEVPKPKATELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V ++GE V   K GD   I      C  C++C+    + C           
Sbjct: 67  VGGHEGAGVVVAMGENVRGWKIGDLAGIKWLNGSCMACEYCEKSNESNC----------- 115

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+     +   G          +F QY     V    I     L +   + C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY- 163

Query: 184 AAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN++ GD VA+ GA G +G   +Q A   G  R++ +D  ++K+Q   + G   F
Sbjct: 164 KALKSANLRAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKEQLFRQLGGEVF 222

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAA 302
           +    D +  K IV  +V+ T+GG     + + +   + S+ E      G  +++G+   
Sbjct: 223 I----DFRKSKDIVADVVKATNGGAHGVINVSVSEAAIESSTEYVRSN-GTVVLVGLPGG 277

Query: 303 GK 304
            K
Sbjct: 278 AK 279

>KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]
           {ON} highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 351

 Score =  103 bits (258), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 107/387 (27%), Positives = 165/387 (42%), Gaps = 59/387 (15%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE G  L  ++I V  PKA+E+ V + Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKGVIFYETGGKLEYKDIDVPTPKANELLVNVKYSGVCHTDLHAYHGDWPLPVKLPL 66

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V ++GE V   K GD   I      C  C+ C+ G  + C           
Sbjct: 67  VGGHEGAGVVVAMGENVKGWKVGDLAGIKWLNGSCMSCESCELGNESNC----------- 115

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+     +   G          +F QY     V    I   A L +   + C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQQYATADAVQAAKIPAGADLAEIAPILCAGITVY- 163

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN+Q GD VA+ G AG +G   VQ AK  G  R++ +D  ++K+Q   + G   F
Sbjct: 164 KALKSANLQAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEEKEQLFRQLGGEVF 222

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACH---KGWGESIIIGV 299
           +    D +  K I   +++ T+GG         N  V  +A+E+     +  G  +++G+
Sbjct: 223 I----DFRTCKDIEGEIIKATNGGAHGVI----NVSVSEAAIESSTNYVRANGTVVLVGL 274

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFI-------T 352
            A  K  S    Q+V             K  S +G  + +  D +  +D F+        
Sbjct: 275 PAGAKCKSDVFNQVV-------------KSISIVGSYVGNRADTREALDFFVRGLVRSPI 321

Query: 353 HRRGFTDINSAFEDLHHGDCL-RTVLD 378
              G + +   FE +  G  + R V+D
Sbjct: 322 KVVGLSTLPEIFEKMEKGQIVGRYVVD 348

>SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} similar
           to uniprot|P00331 Saccharomyces cerevisiae YMR303C ADH2
           Glucose-repressible alcohol dehydrogenase II
          Length = 351

 Score =  103 bits (257), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 104/383 (27%), Positives = 166/383 (43%), Gaps = 45/383 (11%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A + YE G  L  ++I V  PK++E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFYENGGELQYKDIPVPKPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V +IGE V   K GD+  I      C  C++C+    + C           
Sbjct: 67  VGGHEGAGVVVAIGENVKGWKIGDYAGIKWLNGSCMACEYCELSNESNC----------- 115

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+     +   G          +F QY     V    I     L +   + C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQQYATADAVQAARIPAGTDLAEVAPVLCAGITVY- 163

Query: 184 AAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN++ G+ VA+ GA G +G   +Q AK  G  R++ +D  ++K     E G   F
Sbjct: 164 KALKSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGEEKAALFKELGGEVF 222

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACH---KGWGESIIIGV 299
           +    D    K +V  +V+ T+GG         N  V  +A+EA     +  G  +++G+
Sbjct: 223 I----DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEASTVYCRANGTVVLVGL 274

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTD 359
               K  S    Q+V      GS  G    R++    +  +  G +K    +    G ++
Sbjct: 275 PGGAKCKSDVFNQVVKSTTIVGSYVG---NRADTREALDFFARGLVKSPIKVV---GLSE 328

Query: 360 INSAFEDLHHGDCL-RTVLDLLK 381
           + S +E +  G  + R V+D  K
Sbjct: 329 LPSIYEKMEKGAIVGRYVVDTSK 351

>KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON}
           uniprot|P20369 Kluyveromyces lactis KLLA0F21010g ADH1
           Alcohol dehydrogenase 1
          Length = 350

 Score =  102 bits (255), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 106/388 (27%), Positives = 165/388 (42%), Gaps = 45/388 (11%)

Query: 1   MSEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-E 59
           M+   P T    + YE G  L  ++I V  PKA+E+ + + Y+ VCHTD +   G  P  
Sbjct: 1   MAASIPETQKGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLP 60

Query: 60  GAFPSILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRAT 118
              P + GHEGAG+V ++GE V   K GD   I      C  C++C+    + C      
Sbjct: 61  TKLPLVGGHEGAGVVVAMGENVKGWKIGDFAGIKWLNGSCMSCEYCELSNESNC------ 114

Query: 119 QGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGV 178
                 P+           D+  +    +F QY     V    I     L +   + C  
Sbjct: 115 ------PEA----------DLSGYTHDGSFQQYATADAVQAAKIPVGTDLAEVAPVLCAG 158

Query: 179 TTGYGAAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEF 237
            T Y  A+K+AN++ GD VA+ G AG +G   VQ AK  G  R++ +D  ++K +   + 
Sbjct: 159 VTVY-KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDAGEEKAKLFKDL 216

Query: 238 GATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACH---KGWGES 294
           G   F+    D    K I + ++E T GG         N  V   A+E      +  G  
Sbjct: 217 GGEYFI----DFTKSKNIPEEVIEATKGGAHGVI----NVSVSEFAIEQSTNYVRSNGTV 268

Query: 295 IIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHR 354
           +++G+    K  S    Q+V      GS  G    R++    I  +  G +K      H 
Sbjct: 269 VLVGLPRDAKCKSDVFNQVVKSISIVGSYVG---NRADTREAIDFFSRGLVKAP---IHV 322

Query: 355 RGFTDINSAFEDLHHGDCL-RTVLDLLK 381
            G +++ S +E +  G  + R V+D  K
Sbjct: 323 VGLSELPSIYEKMEKGAIVGRYVVDTSK 350

>KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar to
           uniprot|P39713 Saccharomyces cerevisiae YAL061W putative
           polyol dehydrogenase
          Length = 382

 Score =  103 bits (256), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 103/398 (25%), Positives = 170/398 (42%), Gaps = 83/398 (20%)

Query: 10  LAAVAYEAGKPLTIEEIVVDPPKAHE--VRVKIAYTAVCHTD----------------AY 51
           + A+AY   K +   + +  P  +HE  V + +++  VC +D                 +
Sbjct: 1   MRALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHEYLDGPIFFPANGKTH 60

Query: 52  TLSGVDPEGAFPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKE----------- 100
            +SG       P  +GHE +GIV  +G  V+ VK GDHV+      C++           
Sbjct: 61  AMSG----QGLPQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCEDRARWPDVKHER 116

Query: 101 ---CKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHF--MGCST--FSQYTV 153
              C  CK+G  N C                           L F  +GC +  F++  V
Sbjct: 117 EGLCIACKTGNPNCCTD-------------------------LGFCGLGCQSGGFAEKIV 151

Query: 154 LADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGA 213
           L++ +VV I    PLD   L+     + +  AV+ + +Q G T  V GAG +GL+ V   
Sbjct: 152 LSERNVVKIPNSLPLDVAALVEPISVSWH--AVRISKLQPGQTALVLGAGPIGLAAVLAL 209

Query: 214 KVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG--GLDYTF 271
           +  GA  IIV +  D ++Q A   GA  F NP+   + G  +++ L ++  G  G ++++
Sbjct: 210 QSHGAGTIIVSEPADTRRQKAEALGAQTF-NPT---EHGDNVIEALRKLAPGGEGFNFSY 265

Query: 272 DCTGNTDVMRSALEACHKGWGESIIIGVAAAG-KEISTRPFQLVTG-RVWKGSAFGGIKG 329
           DC G ++   + L   H    + + + +A  G K I   P  + T  R   GS     + 
Sbjct: 266 DCCGTSETFSAGL---HTLTPKGVAVNIAVWGPKPIDFYPMDVTTSERFVTGSICYTTQD 322

Query: 330 RSEMGGLISDYMD-GKLKVDEFITHRRGFTDINSAFED 366
             E    + D MD GK+ +++  T   G   I + FE+
Sbjct: 323 FEE----VVDAMDKGKIDINKVKTMITGRERIENGFEN 356

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score =  102 bits (254), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 100/375 (26%), Positives = 160/375 (42%), Gaps = 39/375 (10%)

Query: 11  AAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPSILGHE 69
           A V YE    L  +++ V  PK +E+ V + Y+ VCH+D +   G  P +  FP I GHE
Sbjct: 12  AIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHE 71

Query: 70  GAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGT 128
           GAG+V  +G  V   K GD   I      C  C++C+ G  + C  +          DGT
Sbjct: 72  GAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYL----------DGT 121

Query: 129 TRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
              H+             TF +Y     V    I P   L +   + C   T Y  A+K 
Sbjct: 122 GFTHD------------GTFQEYATADAVQAAHIPPNVNLAEVAPILCAGITVY-KALKR 168

Query: 189 ANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSK 247
           ANV  G  V + GA G +G   +Q A   G  R+I +D  + K++   + G   F+    
Sbjct: 169 ANVIPGQWVTISGACGGLGSLAIQYALAMG-YRVIGIDGGNAKRKLFEQLGGEIFI---- 223

Query: 248 DLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEIS 307
           D  + K IV  +++ T+GG     + + +   + ++   C    G  +++G+ A     S
Sbjct: 224 DFTEEKDIVGAIIKATNGGSHGVINVSVSEAAIEASTRYCRPN-GTVVLVGMPAHAYCNS 282

Query: 308 TRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDL 367
               Q+V      GS  G    R++    +  +  G +K      H  G +D+   F  +
Sbjct: 283 DVFNQVVKSISIVGSCVG---NRADTREALDFFARGLIKSP---IHLAGLSDVPEIFAKM 336

Query: 368 HHGDCL-RTVLDLLK 381
             G+ + R V++  K
Sbjct: 337 EKGEIVGRYVVETSK 351

>KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {ON}
           uniprot|P49384 Kluyveromyces lactis KLLA0B09064g ADH3
           Alcohol dehydrogenase III mitochondrial precursor
          Length = 374

 Score =  102 bits (254), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 101/378 (26%), Positives = 165/378 (43%), Gaps = 41/378 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE G  L  ++I V  PK +E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 30  PETQKGVIFYENGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 89

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V ++GE V     GD   I      C  C++C+    + C           
Sbjct: 90  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC----------- 138

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PD           D+  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 139 -PDA----------DLSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY- 186

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN++ GD VA+ G AG +G   VQ AK  G  R++ +D  ++K +   + G   F
Sbjct: 187 KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKGKLVKQLGGEAF 245

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAA 302
           V    D    K +V  + E+T+GG     + + +   M ++ +      G  +++G+  A
Sbjct: 246 V----DFTKTKDMVAEIQEITNGGPHGVINVSVSEAAMNASTQFVRPT-GTVVLVGL-PA 299

Query: 303 GKEISTRPFQLVTGRV-WKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDIN 361
           G  I +  F  V   +  KGS  G    R++    I+ + +G +     +    G +++ 
Sbjct: 300 GAVIKSEVFSHVVKSINIKGSYVG---NRADTREAINFFANGHVHSPIKVV---GLSELP 353

Query: 362 SAFEDLHHGDCL-RTVLD 378
             +E +  G  L R V+D
Sbjct: 354 KVYELMEQGKILGRYVVD 371

>KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3.118
           YBR145W
          Length = 350

 Score =  101 bits (252), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 101/385 (26%), Positives = 164/385 (42%), Gaps = 39/385 (10%)

Query: 1   MSEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEG 60
           MS   P T +  +    G PL  +EI V  PKA+E+ + + Y+ VCHTD +   G  P  
Sbjct: 1   MSSSIPETQMGVIFESNGGPLEYKEIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLP 60

Query: 61  A-FPSILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRAT 118
              P + GHEGAGIV ++G+ V N   GD+  I      C  C+ C+    + C     +
Sbjct: 61  VKLPLVGGHEGAGIVVAMGDSVKNWNIGDYAGIKWLNGSCMNCESCELANESNCPQADLS 120

Query: 119 QGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGV 178
              G   DG                   +F QY     V    I     L +   + C  
Sbjct: 121 ---GYTHDG-------------------SFQQYATADAVQAAKIPHGTDLAEVAPILCAG 158

Query: 179 TTGYGAAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEF 237
            T Y  A+K+AN++ GD VA+ GA G +G   +Q A   G  R++ +D  ++K +   + 
Sbjct: 159 VTVY-KALKSANLKAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKAELFKKL 216

Query: 238 GATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIII 297
           G   F+    D    K ++  ++E+TDGG     + + +   + ++   C    G  +++
Sbjct: 217 GGEYFI----DFTKCKDVIAEILEVTDGGAHGVINVSVSEAAIEASTRYCRAN-GTVVLV 271

Query: 298 GVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGF 357
           G+ A     S    Q+V      GS  G    R++    +  +  G +K      H    
Sbjct: 272 GLPANAYCKSEVFSQVVKSISIVGSYVG---NRADTRQALDFFARGLVKSP---IHIAPL 325

Query: 358 TDINSAFEDLHHGDCL-RTVLDLLK 381
           +D+   F+ +  G  + R V+D  K
Sbjct: 326 SDLPEIFDKMAKGQIVGRYVVDTSK 350

>SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON}
           uniprot|Q9P8S5 Saccharomyces kluyveri Alcohol
           dehydrogenase isozyme 3
          Length = 373

 Score =  101 bits (251), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 101/374 (27%), Positives = 161/374 (43%), Gaps = 41/374 (10%)

Query: 13  VAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 71
           + YE G  L  E+I V  PK +E+ + + Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 36  IFYENGGELKYEDIPVPKPKPNELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 95

Query: 72  GIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTR 130
           G+V ++GE V   K GD   I      C  C++C+    + C                  
Sbjct: 96  GVVVAMGENVKGWKIGDLAGIKWLNGSCLSCEYCEKSNESNCPHA--------------- 140

Query: 131 FHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAN 190
                  D+  +    +F QY     V    I     L +   + C   T Y  A+K+AN
Sbjct: 141 -------DLSGYTHDGSFQQYATADYVQAARIPEGTDLAEVSPILCAGVTVY-KALKSAN 192

Query: 191 VQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDL 249
           ++ GD VA+ G AG +G   VQ AK  G  R++ +D   +K +   + G   F+    D 
Sbjct: 193 LKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGAEKGELVKKLGGEVFI----DF 247

Query: 250 KDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTR 309
              K +V+ + E T+GG     + + +   M ++ +      G  +++G+  AG  I + 
Sbjct: 248 TKHKNLVEAVQEATNGGPHGVINVSVSEAAMTASTQFVRPT-GTVVLVGL-PAGAVIKSE 305

Query: 310 PFQLVTGRV-WKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLH 368
            F  V   +  KGS  G    R++    I  +  G +K      H  G +++   +E + 
Sbjct: 306 VFSHVVKSINIKGSYVG---NRADTREAIDFFARGMVKSP---IHVVGLSELPKVYELME 359

Query: 369 HGDCL-RTVLDLLK 381
            G  L R V+D  K
Sbjct: 360 KGKILGRYVVDTAK 373

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score =  101 bits (251), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 100/373 (26%), Positives = 161/373 (43%), Gaps = 39/373 (10%)

Query: 13  VAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 71
           + YE G  L  +++ V  PK +E+ + + Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 52  IFYEHGGELHYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGA 111

Query: 72  GIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTR 130
           G+V + GE VTN + GD+  I      C  C+ C+ G    C                  
Sbjct: 112 GVVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNC------------------ 153

Query: 131 FHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAN 190
               +  D+  +    +F QY     V    I     L +   + C   T Y  A+KTA+
Sbjct: 154 ----EHADLSGYTHDGSFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTVY-KALKTAD 208

Query: 191 VQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDL 249
           V+ G  VA+ G AG +G   VQ AK  G  R++ +D  + KK+  ++ G   F+    D 
Sbjct: 209 VRPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGEDKKKLFHDLGGETFI----DF 263

Query: 250 KDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTR 309
           +  K +V  + E T GG     + + +   +  + E   +  G  +++G+ A     S  
Sbjct: 264 RTTKDMVGAIQEATQGGPHAVINVSVSEAAISMSTEYV-RPTGSVVLVGLPANAYVKSEV 322

Query: 310 PFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHH 369
              +V     KGS  G    R++    I  +  G +K    I    G +++  A++ +  
Sbjct: 323 FSHVVKSISIKGSYVG---NRADTREAIDFFARGLVKAPIKII---GLSELPEAYKLMEA 376

Query: 370 GDCL-RTVLDLLK 381
           G  L R V+D  K
Sbjct: 377 GKILGRYVVDTEK 389

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score =  100 bits (250), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 118/264 (44%), Gaps = 31/264 (11%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T  A V YE G PL    I V  PK +E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 33  PTTQKAVVFYENGGPLKYTTIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL 92

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V + G  V N + GD+  I      C  C+ C+ G  + C           
Sbjct: 93  VGGHEGAGVVVAKGSEVKNFEIGDYAGIKWLNGSCMSCELCEKGFESNC----------- 141

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                      +  D+  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 142 -----------EQADLSGYTHDGSFQQYATADAVQAAHIPKNVDLAEVAPILCAGVTVY- 189

Query: 184 AAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+KTA+V+ G  VA+ GA G +G   VQ AK  G  R++ +D  D+KK+  +  G   F
Sbjct: 190 KALKTADVKPGQWVAISGACGGLGSLAVQYAKAMGL-RVVGIDGGDEKKKLFHSLGGDIF 248

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGG 266
           V    D     +IV  + ++T+GG
Sbjct: 249 V----DFTKTHSIVKDIQDVTNGG 268

>KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]
           {ON} similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score =  100 bits (248), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 102/364 (28%), Positives = 164/364 (45%), Gaps = 52/364 (14%)

Query: 27  VVDPPKAHEVRVKIAYTAVCHTDA-YTLSGVDPEGAF----PSILGHEGAGIVESIGEGV 81
           + DP   H V+++I  T +C +D  Y ++G    G F    P ILGHE +G+V  +G  V
Sbjct: 26  ITDP---HYVKLQIKKTGICGSDVHYYVAGAI--GDFVVKKPMILGHESSGLVVEVGSEV 80

Query: 82  TNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILH 141
           + V+ GD V        +     K+G+ NLC  ++      +  DGT   +    ED L 
Sbjct: 81  SRVRVGDRVAIEPGVPSRYSDETKAGRYNLCPHMQFAATPPI--DGTLVKYYLAPEDFLV 138

Query: 142 FMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 201
            +      +   L       ++P         L  GV      A K A V     VAVFG
Sbjct: 139 KLPDHVSYEEGAL-------VEP---------LSVGVH-----ANKLAGVAFNQRVAVFG 177

Query: 202 AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVE 261
           AG VGL     A+  GAS ++ +D+ + K   ++ FG T FVN S ++KD   +V  +  
Sbjct: 178 AGPVGLLTGAVARAFGASEVVYIDVFEHKLSLSSNFGGTQFVN-SANIKDEDDLVKEIER 236

Query: 262 MTDGGL-DYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWK 320
           +  G   D  FDCTG    +R+ ++ C+ G G  + +G+   G +    P   +  +  K
Sbjct: 237 VLGGARPDVVFDCTGAEICIRTGIKVCNSG-GTYVQVGM---GHDDVNFPIGAIGAKELK 292

Query: 321 -----GSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFE-DLHHG-DCL 373
                  AFG  +   ++         G + V   +THR  F D  +A+E ++ HG + +
Sbjct: 293 VLGCFRYAFGDYRDAVQL------IASGDVNVKPLVTHRFKFEDAEAAYEFNIKHGSEVI 346

Query: 374 RTVL 377
           +T++
Sbjct: 347 KTII 350

>KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {ON}
           Anc_3.118 YBR145W
          Length = 351

 Score = 99.8 bits (247), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 102/387 (26%), Positives = 160/387 (41%), Gaps = 59/387 (15%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE G  L  ++I V  PKA+E+ + + Y+ VCHTD +   G  P +   P 
Sbjct: 7   PKTQKGVIFYENGGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWKGDWPLDVKLPL 66

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V ++GE V   K GD+  I      C  C++C+    + C           
Sbjct: 67  VGGHEGAGVVVAMGENVRGWKIGDYAGIKWLNGSCMSCEYCELSNESNC----------- 115

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+     +   G          +F QY     V    I     L +   + C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY- 163

Query: 184 AAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN+  G+ VA+ GA G +G   +Q AK  G  RI+ +D  D+K     E G   F
Sbjct: 164 KALKSANLSAGEWVAISGACGGLGSLAIQYAKAMG-YRILGIDGGDEKAALFKELGGEVF 222

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACH---KGWGESIIIGV 299
           +    D    K I   ++E T+GG         N  V  +A+E+     +  G  +++G+
Sbjct: 223 I----DFTKTKDIEAAVIEATNGGAHGVI----NVSVSEAAIESSTRYVRSNGTCVLVGL 274

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFI-------T 352
              G    +  F  V            +K  S +G  + +  D +  +D F         
Sbjct: 275 -PGGAYCKSEVFSHV------------VKSISIVGSYVGNRADTREAIDFFTRGLVKAPI 321

Query: 353 HRRGFTDINSAFEDLHHGDCL-RTVLD 378
           H    + +   FE +  G  + R V+D
Sbjct: 322 HIAPLSAVPEIFEKMEKGQIVGRYVVD 348

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 99.4 bits (246), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 103/384 (26%), Positives = 163/384 (42%), Gaps = 39/384 (10%)

Query: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EG 60
           S+  P T  A V YE    L  +++ V  PK +E+ V + Y+ VCH+D +   G  P + 
Sbjct: 3   SQVVPKTQKAIVFYETDGKLEYKDVAVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQL 62

Query: 61  AFPSILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQ 119
            FP I GHEGAG+V  +G  V   K GD   I      C  C++C+ G  + C  +    
Sbjct: 63  KFPLIGGHEGAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQCPHL---- 118

Query: 120 GKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVT 179
                 DGT   H+             TF +Y     V    I     L +   + C   
Sbjct: 119 ------DGTGFTHD------------GTFQEYATADAVQAAHIPQNVDLAEVAPILCAGI 160

Query: 180 TGYGAAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFG 238
           T Y  A+K AN+  G  V + GA G +G   VQ A   G  R+I +D  + K++   E  
Sbjct: 161 TVY-KALKRANLMPGQWVTISGACGGLGSLAVQYALAMG-YRVIGIDGGEAKQKLFEELH 218

Query: 239 ATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIG 298
              F++ +K+    K +V  +++ TDGG     + + +   + ++   C    G  +++G
Sbjct: 219 GEIFIDFTKE----KDVVGAVIKATDGGSHGVINVSVSEAAIEASTRYCRPN-GTVVLVG 273

Query: 299 VAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFT 358
           + A     S    Q+V      GS  G    R++    +  +  G +K      H  G +
Sbjct: 274 MPAHAYCKSDVFNQVVKSISIVGSCVG---NRADTREALDFFARGLIKSP---IHLAGLS 327

Query: 359 DINSAFEDLHHGDCL-RTVLDLLK 381
           D+   F  +  G  + R V+D  K
Sbjct: 328 DVPEIFGKMERGQIVGRYVVDTSK 351

>CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
           uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2
          Length = 352

 Score = 99.4 bits (246), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 104/390 (26%), Positives = 163/390 (41%), Gaps = 59/390 (15%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE    L  ++I V  PKA+E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 8   PETQKGVIFYENNGKLEYKDIPVPKPKANEILINVKYSGVCHTDLHAWHGDWPLATKLPL 67

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V  +GE V   K GD+  I      C  C++C+    + C           
Sbjct: 68  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESNC----------- 116

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+           D+  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 117 -PEA----------DLSGYTHDGSFQQYATADYVQAARIPQGTDLAQVAPILCAGITVY- 164

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN+  G+ VA+ G AG +G   VQ AK  G  RI+ +D  D+KK   +E G   F
Sbjct: 165 KALKSANLNAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGDEKKALFHELGGEIF 223

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACH---KGWGESIIIGV 299
           V    D    K +   ++  T+GG         N  V  +A+E+     +  G  +++G+
Sbjct: 224 V----DFTKSKNVEQDILVATNGGAHGVI----NVSVSEAAIESSTRYVRSNGTVVLVGL 275

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFI-------T 352
            A  K  S+  F  V            +K  S +G  + +  D +  +D F         
Sbjct: 276 PANAK-CSSDVFNHV------------VKSISIVGSYVGNRADTREALDFFSRGLVKSPI 322

Query: 353 HRRGFTDINSAFEDLHHGDCL-RTVLDLLK 381
              G +++   +E +  G  + R V+D  K
Sbjct: 323 KIAGLSELPEIYEKMEKGQIVGRYVVDTSK 352

>CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar to
           uniprot|P39714 Saccharomyces cerevisiae YAL060w FUN49 or
           uniprot|P39713 Saccharomyces cerevisiae YAL061w FUN50
          Length = 383

 Score = 99.8 bits (247), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 90/327 (27%), Positives = 147/327 (44%), Gaps = 71/327 (21%)

Query: 28  VDPPKA---HEVRVKIAYTAVCHTD----------------AYTLSGVDPEGAFPSILGH 68
           +D PK    HE+ + +A+  +C TD                 + LSG+D     P  +GH
Sbjct: 18  IDTPKINNDHELMIDVAWCGICGTDLHEFLEGPIFMPKDGDTHYLSGLD----LPLPMGH 73

Query: 69  EGAGIVESIGEGVTNVKPGDHVIALYTAECKE--------------CKFCKSGKTNLCGS 114
           E +GIV+ +G+GVT  KPGD V+   T  C +              C  C+ G  N C +
Sbjct: 74  EMSGIVKEVGKGVTRFKPGDRVVIEATTSCGDTHRWPKSKVAKGELCPACEMGLPNCC-T 132

Query: 115 VRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLL 174
             + QG G +  G                    F++  V+ +  VV I  K PLD   L+
Sbjct: 133 HGSFQGLGSVGGG--------------------FAEQVVVGEKHVVKIPDKLPLDVAALV 172

Query: 175 GCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWA 234
              ++  + AA + A  ++G    V G+G +GL+++   K   A +I+V +    +++ A
Sbjct: 173 E-PLSVAWHAA-RLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPAKLRRELA 230

Query: 235 NEFGATDFVNPSKDLKDGKTIVDMLVEMT--DGGLDYTFDCTGNTDVMRSALE-ACHKGW 291
            +     F NP+      +  ++ L E++  D G DYTFDC+G  D   +A++ AC +G 
Sbjct: 231 EKLNVVVF-NPTH--TRAQNAIEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKAACIQGH 287

Query: 292 GESIIIGVAAAG-KEISTRPFQLVTGR 317
               I+ VA  G K ++  P  +  G 
Sbjct: 288 ----IVNVAIWGPKPVAFHPMDMTYGE 310

>Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ABL033C
          Length = 375

 Score = 99.0 bits (245), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 106/385 (27%), Positives = 169/385 (43%), Gaps = 41/385 (10%)

Query: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA 61
           S G P+T  A + YE G  L  ++I V  PK +E+ V + Y+ VCHTD +   G  P   
Sbjct: 27  SSGIPLTQKAVIFYEHGDKLHYKDIPVPKPKPNEILVNVKYSGVCHTDIHAWKGDWPLAT 86

Query: 62  -FPSILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQ 119
             P + GHEGAGIV + G  VTN + GD+  +      C  C++C++G  + C     + 
Sbjct: 87  KLPLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKWLNKSCMSCEYCETGHESNCAEADLS- 145

Query: 120 GKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVT 179
             G   DG                   +F QY     V    I     L +   + C   
Sbjct: 146 --GYTRDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGV 184

Query: 180 TGYGAAVKTANVQKGDTVAV-FGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFG 238
           T Y  A+KTAN+  G  VA+    G +G   VQ AK  G  R++ +D    K     + G
Sbjct: 185 TVY-KALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGL-RVVGIDGGAAKDALFKKLG 242

Query: 239 ATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIG 298
              F+    D    K IV  + E T+GG     + + +   +  +++   +  G  +++G
Sbjct: 243 GEVFI----DFTKSKDIVADIQEATNGGPHGAVNVSVSEAAIVQSVKYI-RPTGTVVLVG 297

Query: 299 VAAAGKEISTRPFQLVTGRV-WKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGF 357
           +  A   +++  F  V   +  KGS  G    R++M   I  +  G +K    I    G 
Sbjct: 298 L-PANSYVNSEIFSHVIKSISIKGSYVG---NRADMREAIDFFTRGLVKAPIKII---GL 350

Query: 358 TDINSAFEDLHHGDCL-RTVLDLLK 381
           +++ +A+ +L  G+ + R V+D  K
Sbjct: 351 SELPTAYHELEAGNMVGRFVVDTSK 375

>YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON}
           XYL2Xylitol dehydrogenase, converts xylitol to
           D-xylulose; expression induced by xylose, even though
           this pentose sugar is not well utilized by S.
           cerevisiae; null mutant has cell wall defect
          Length = 356

 Score = 98.6 bits (244), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 108/384 (28%), Positives = 174/384 (45%), Gaps = 46/384 (11%)

Query: 7   ITCLAAVAYEAGKPLTIEEIVVDPPK---AHEVRVKIAYTAVCHTDAYTLSG---VDPEG 60
           +T   A+  E    +T+  + +  PK    +EV ++I  T +C +D +  +     +   
Sbjct: 4   LTTQEAIVLERPGKITLTNVSI--PKISDPNEVIIQIKATGICGSDIHYYTHGRIANYVV 61

Query: 61  AFPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120
             P +LGHE +GIV  IGE V  +K GD V        +     K G+ NL  +++    
Sbjct: 62  ESPMVLGHESSGIVALIGENVKTLKVGDRVALEPGIPDRFSPEMKEGRYNLDPNLKFAAT 121

Query: 121 KGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTT 180
                DGT   + K  +D ++ +      +   L +   VAI                  
Sbjct: 122 PPF--DGTLTKYYKTMKDFVYKLPDDVSFEEGALIEPLSVAIH----------------- 162

Query: 181 GYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGAT 240
               A K A ++ G    VFGAG +GL   + A V GA+ ++ VD+ + K + A +FGAT
Sbjct: 163 ----ANKLAKIKFGARCVVFGAGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGAT 218

Query: 241 DFVNPSKDLKDGKTIVDMLVEMTDG--GLDYTFDCTGNTDVMRSALEACHKGWGESIIIG 298
             VN S DL  G T VD +++   G  G D  F+C+G    +R+ +E C  G G  + +G
Sbjct: 219 HIVN-SGDLPHGVT-VDSVIKKAIGKKGADVVFECSGAEPCVRAGIEVCKAG-GTIVQVG 275

Query: 299 VAAAGKEISTRPFQLV-TGRVWKGSAFGGIKG-RSEMGGLISDYMDGKLKVDEFITHRRG 356
           +   G+E    P  ++ T  +     F   +G  S+   L+S     KL +  FITHR  
Sbjct: 276 M---GQEEIQFPISIIPTKELTFQGCFRYCQGDYSDSIELVSSR---KLSLKPFITHRYS 329

Query: 357 FTDINSAFEDLHHG--DCLRTVLD 378
           F D   AFE+  H   + ++T+++
Sbjct: 330 FKDAVEAFEETSHHPLNNIKTIIE 353

>NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 97.8 bits (242), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 96/377 (25%), Positives = 162/377 (42%), Gaps = 39/377 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A +    G PL  ++I V  PK++E+ V I Y+ VCHTD +   G  P +   P 
Sbjct: 7   PKTQKAIIFESNGGPLEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPLDTKLPL 66

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAGIV +IG+ V   K GD+  +      C  C++C+ G  + C           
Sbjct: 67  VGGHEGAGIVVAIGDNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNC----------- 115

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+     +   G          +F QY     V    I     L +   + C   T Y 
Sbjct: 116 -PNADLSGYTHDG----------SFQQYATADAVQAARIPAGTNLSEVAPILCAGMTVY- 163

Query: 184 AAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN++ G+ VA+ GA G +G   +Q A   G  R++ +D  D K +   +     F
Sbjct: 164 KALKSANLRAGEWVAISGACGGLGSLCIQYANAMG-YRVLGIDGGDDKAKLFKQLHGEVF 222

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAA 302
           +    D    K ++  + ++T+GG     + + +   + ++ + C    G  +++G+   
Sbjct: 223 I----DFTKTKDVISEVNKVTNGGAHGVINVSVSEAAIEASTKYCRAN-GTVVLVGLPGG 277

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINS 362
            K  S    Q+V      GS  G    R++    +  +  G +K      H    + + +
Sbjct: 278 AKCKSDVFNQVVKSMTIVGSYVG---NRADTREALDFFTRGLVKAP---IHVAPLSTLPT 331

Query: 363 AFEDLHHGDCL-RTVLD 378
            FE +  G  + R V+D
Sbjct: 332 IFEKMEKGQIVGRYVVD 348

>YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON}
           ADH1Alcohol dehydrogenase, fermentative isozyme active
           as homo- or heterotetramers; required for the reduction
           of acetaldehyde to ethanol, the last step in the
           glycolytic pathway
          Length = 348

 Score = 97.8 bits (242), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 89/305 (29%), Positives = 137/305 (44%), Gaps = 38/305 (12%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE+   L  ++I V  PKA+E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPL 63

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V  +GE V   K GD+  I      C  C++C+ G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
             DG                   +F QY     V    I     L +   + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVY- 160

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN+  G  VA+ G AG +G   VQ AK  G  R++ +D  + K++     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVF 219

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACH---KGWGESIIIGV 299
           ++ +K+    K IV  +++ TDGG         N  V  +A+EA     +  G ++++G+
Sbjct: 220 IDFTKE----KDIVGAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGM 271

Query: 300 AAAGK 304
            A  K
Sbjct: 272 PAGAK 276

>Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 97.8 bits (242), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 104/390 (26%), Positives = 167/390 (42%), Gaps = 59/390 (15%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE+   L  ++I V  PKA+E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V ++GE V     GD+  I      C  C++C+ G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
             DG                   +F QY     V    I     L +   + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAAHIPQGTDLAEVAPVLCAGITVY- 160

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN+  G  VA+ G AG +G   VQ AK  G  R++ +D  + K++     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVF 219

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACH---KGWGESIIIGV 299
           ++ +K+    K IV+ +++ TDGG         N  V  +A+EA     +  G ++++G+
Sbjct: 220 IDFTKE----KDIVNAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGM 271

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFI-------T 352
            A  K  S+  F  V            +K  S +G  + +  D +  +D F         
Sbjct: 272 PANAK-CSSDVFNQV------------VKSISIVGSYVGNRADTREALDFFARGLVKSPI 318

Query: 353 HRRGFTDINSAFEDLHHGDCL-RTVLDLLK 381
              G + +   +E +  G  + R V+D  K
Sbjct: 319 KVVGLSTLPEIYEKMEKGQIVGRYVVDTAK 348

>Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 97.4 bits (241), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 89/305 (29%), Positives = 137/305 (44%), Gaps = 38/305 (12%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE+   L  ++I V  PKA+E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V ++GE V     GD   I      C  C++C+ G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
             DG                   +F QY     V    + P   L +   + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAAHVAPGTDLAEVAPVLCAGITVY- 160

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN+  G  VA+ G AG +G   VQ AK  G  R+I +D  + K++     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGEGKEELFRSIGGEVF 219

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACH---KGWGESIIIGV 299
           V+ +K+    K IV  +++ T+GG         N  V  +A+EA     +  G ++++G+
Sbjct: 220 VDFTKE----KDIVGAVLKATNGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGM 271

Query: 300 AAAGK 304
            A  K
Sbjct: 272 PANAK 276

>Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON}
           YJR159W (SOR1) - sorbitol-induced sorbitol dehydrogenase
           [contig 159] FULL
          Length = 356

 Score = 97.4 bits (241), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 103/362 (28%), Positives = 162/362 (44%), Gaps = 57/362 (15%)

Query: 34  HEVRVKIAYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESIGEGVTNVKPG 87
           +  +V +  T +C +D   Y   G+   G +    P +LGHE +G+V  +G  V  +K G
Sbjct: 30  YYAKVAVKATGICGSDVHYYRSGGI---GKYILNSPMVLGHESSGVVVEVGPKVEKIKVG 86

Query: 88  DHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGT-TRFHNKKGEDILHFMGCS 146
           D V        +     K+GK NLC  +       +  DGT  +++    + ++      
Sbjct: 87  DRVAIEPGVPDRYSDETKAGKYNLCPHMAFAATPPI--DGTLVKYYLSPADFLVKLPDHV 144

Query: 147 TFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVG 206
           +F +   +  +SV                 GV +      K A V+ G TV VFGAG VG
Sbjct: 145 SFEEGACIEPLSV-----------------GVHSN-----KLAKVRFGQTVVVFGAGPVG 182

Query: 207 LSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLK-DGKTIVDMLVEMTDG 265
           L     AK  GAS ++ VD+ DQK + A  FGAT  +N +K  K D + + D + ++  G
Sbjct: 183 LLTGAVAKAFGASDVVFVDVFDQKLERAKNFGATHVINSTKLPKNDPQALADEVEKLLGG 242

Query: 266 GL-DYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAF 324
            L D  F+C+G    + + ++A   G G  + IG+   GK     P   V+G+  + +  
Sbjct: 243 ALADVVFECSGAESCIDAGVKATKNG-GTMVQIGM---GKNYVNFPIAEVSGK--EMTLV 296

Query: 325 GGIKGRSEMGGLISDYMD-------GKLKVDEFITHRRGFTDINSA--FEDLHHGDCLRT 375
           G    R   G    DY D       G++ V + ITHR  F D   A  F   H G+ ++T
Sbjct: 297 GCF--RYSYG----DYKDAVNLVSTGRVDVKKLITHRFSFEDAAKAYDFNIAHGGEVVKT 350

Query: 376 VL 377
           ++
Sbjct: 351 II 352

>Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 97.1 bits (240), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 85/302 (28%), Positives = 136/302 (45%), Gaps = 32/302 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE+   L  ++I V  PK +E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V +IG+ V   K GD   I    + C  C++C+ G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVAIGDNVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLS---GY 120

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
             DG                   +F QY     V    I     L +   + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAARIPEGTDLAQVAPILCAGITVY- 160

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN++ G  VA+ G AG +G   VQ AK  G  R++ +D  + K++     G   F
Sbjct: 161 KALKSANLRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFTSLGGEVF 219

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAA 302
           ++ +K+    K IV  +V+ TDGG     + + +   + ++   C    G  +++G+ A 
Sbjct: 220 IDFTKE----KDIVSAVVKATDGGAHGIVNVSVSEAAIEASTRYCRAN-GTVVLVGLPAG 274

Query: 303 GK 304
            K
Sbjct: 275 AK 276

>KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON}
           uniprot|P49385 Kluyveromyces lactis ADH4 Alcohol
           dehydrogenase IV, mitochondrial precursor
          Length = 375

 Score = 97.4 bits (241), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 103/380 (27%), Positives = 163/380 (42%), Gaps = 39/380 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE G  L  +++ V  PKA+E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 31  PETQKGVIFYENGGKLEYKDLPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPVKLPL 90

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAGIV + GE V N + GD+  I      C  C+ C+ G  + C          +
Sbjct: 91  VGGHEGAGIVVAKGENVKNFEIGDYAGIKWLNGSCMSCELCEQGYESNC----------L 140

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
             D +   H+             +F QY     V    I     L +   + C   T Y 
Sbjct: 141 QADLSGYTHD------------GSFQQYATADAVQAAQIPKGTDLAEIAPILCAGVTVY- 187

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+KTA+++ G  VA+ G AG +G   VQ AK  G  R++ +D  D K++   + G   F
Sbjct: 188 KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDGKEELFKQCGGEVF 246

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAA 302
           +    D +  K +V  + E T+GG     + + +   +  + E      G  +++G+ A 
Sbjct: 247 I----DFRKSKDMVADIQEATNGGPHGVINVSVSEAAISMSTEYVRPT-GVVVLVGLPAD 301

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINS 362
               S     +V     KGS  G    R++       +  G +K    I    G +++  
Sbjct: 302 AYVKSEVFSHVVKSISIKGSYVG---NRADTREATDFFTRGLVKSPIKII---GLSELPE 355

Query: 363 AFEDLHHGDCL-RTVLDLLK 381
           A+E +  G  L R V+D  K
Sbjct: 356 AYELMEQGKILGRFVVDTYK 375

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 97.1 bits (240), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 98/381 (25%), Positives = 163/381 (42%), Gaps = 39/381 (10%)

Query: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EG 60
           S+  P T  A V YE    L  +++ V  PK +E+ V + Y+ VCH+D +   G  P + 
Sbjct: 3   SQAIPKTQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQL 62

Query: 61  AFPSILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQ 119
            FP I GHEGAG+V  +G  V   K GD   I      C  C++C+ G  + C  +    
Sbjct: 63  KFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL---- 118

Query: 120 GKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVT 179
                 DGT   H+             TF +Y     V    I     L +   + C   
Sbjct: 119 ------DGTGFTHD------------GTFQEYATADAVQAAHIPQNVNLAEVAPILCAGI 160

Query: 180 TGYGAAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFG 238
           T Y  A+K AN+  G  V + GA G +G   +Q A   G  R+I +D  + K++   + G
Sbjct: 161 TVY-KALKRANLMPGQWVTISGACGGLGSLAIQYALAMGF-RVIGIDGGEAKRKLFEKLG 218

Query: 239 ATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIG 298
              F++ +K+    + +   +++ T+GG     + + +   + ++   C    G  +++G
Sbjct: 219 GEIFIDFTKE----RDVAGAVIKATNGGSHGIINVSVSEAAIEASTRYCRPN-GTVVLVG 273

Query: 299 VAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFT 358
           + A     S    Q+V      GS  G    R++    +  +  G +   E   H  G +
Sbjct: 274 MPAHAHCKSDVFNQVVKSISIVGSCVG---NRADTREALDFFARGLI---ESPIHLAGLS 327

Query: 359 DINSAFEDLHHGDCL-RTVLD 378
           D+   F  +  G+ + R V+D
Sbjct: 328 DVPEIFGKMEKGEIVGRYVVD 348

>NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON}
           Anc_3.118
          Length = 351

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 102/380 (26%), Positives = 161/380 (42%), Gaps = 39/380 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T  A +    G  L  ++I V  PK+ E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFETNGGKLEYKDIPVPVPKSTEILINVKYSGVCHTDLHAWKGDWPLATKLPL 66

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAGIV  +GE V   K GD   I      C  C++C+ G  + C           
Sbjct: 67  VGGHEGAGIVVQVGENVQGWKVGDLAGIKWLNGSCMACEYCELGNESNC----------- 115

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+     +   G          +F QY     V    I     L +   + C   T Y 
Sbjct: 116 -PNADLSGYTHDG----------SFQQYATADAVQAARIPQGTDLAEVAPVLCAGITVY- 163

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN++ G+ VA+ G AG +G   VQ AK  G  RI+ +D  ++K++   E G   F
Sbjct: 164 KALKSANLRAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGEEKEKLFRELGGEIF 222

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAA 302
           +    D    K IV  +++ T+GG     + + +   + ++ E C    G  +++G+   
Sbjct: 223 I----DFTKTKDIVGDIIKATNGGAHGVINVSVSEAAIGASTEYCRAN-GTVVLVGLPRD 277

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINS 362
            K  S    Q+V      GS  G    R++    +  +  G +K      H    +D+  
Sbjct: 278 AKCKSDVFNQVVKSISIVGSYVG---NRADTREALDFFSRGLVKSP---IHIAPLSDLPE 331

Query: 363 AFEDLHHGDCL-RTVLDLLK 381
            F  +  G  + R V+D  K
Sbjct: 332 IFGKMEKGQIVGRYVVDTSK 351

>Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 100/380 (26%), Positives = 161/380 (42%), Gaps = 39/380 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE+   L  ++I V  PKA+E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESHGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPL 63

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V ++GE V     GD   I      C  C++C+ G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
             DG                   +F QY     V    I     L +   + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADSVQAAHIPKGTDLAECAPVLCAGITVY- 160

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN+  G  VA+ G AG +G   VQ AK  G  R++ +D  + K++     G   F
Sbjct: 161 KALKSANLSAGQWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEGKEELFRSIGGEVF 219

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAA 302
           +    D    K IV  +++ TDGG     + + +   + ++   C    G ++++G+ A 
Sbjct: 220 I----DFTTEKDIVGAVIKATDGGAHGIINVSVSEAAIEASTRYCRAN-GTTVLVGMPAG 274

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINS 362
            K  S    Q+V      GS  G    R++    +  +  G +K    +    G + +  
Sbjct: 275 AKCCSDVFNQVVKSISIVGSYVG---NRADTREALDFFARGLVKSPIKVV---GLSTLPE 328

Query: 363 AFEDLHHGDCL-RTVLDLLK 381
            +E +  G  + R V+D  K
Sbjct: 329 IYEKMEKGQIVGRYVVDTSK 348

>KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]
           {ON} uniprot|P49383 Kluyveromyces lactis KLLA0F18260g
           ADH2 Alcohol dehydrogenase 2
          Length = 348

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/264 (29%), Positives = 117/264 (44%), Gaps = 31/264 (11%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE G  L  ++I V  PKA+E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V ++GE V     GD   I      C  C++C+    + C           
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC----------- 112

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PD     +   G          +F QY     V    I     L +   + C   T Y 
Sbjct: 113 -PDADLSGYTHDG----------SFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY- 160

Query: 184 AAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+A+++ GD VA+ GA G +G   +Q AK  G  R++ +D   +K +   E G   F
Sbjct: 161 KALKSADLKAGDWVAISGACGGLGSLAIQYAKAMG-YRVLGIDTGAEKAKLFKELGGEYF 219

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGG 266
           V    D    K ++  +V+ T+GG
Sbjct: 220 V----DYAVSKDLIKEIVDATNGG 239

>Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {ON}
           YMR083W (ADH3) - 1:1 [contig 55] FULL
          Length = 387

 Score = 96.3 bits (238), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 100/380 (26%), Positives = 162/380 (42%), Gaps = 39/380 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE G  L  +++ V  PK +E+ + + Y+ VCHTD +   G  P +   P 
Sbjct: 43  PTTQKGVIFYEHGGELQYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLDVKLPL 102

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V + GE VTN + GD   I      C  C+ C+ G    C           
Sbjct: 103 VGGHEGAGVVVAKGENVTNFEIGDLAGIKWLNGSCMSCELCEQGHEPNC----------- 151

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                      +  D+  +    +F QY     V    +     L +   + C   T Y 
Sbjct: 152 -----------EHADLSGYTHDGSFQQYATADAVQAAQLPKGINLAEVAPILCAGVTVY- 199

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+KTA++  G  VA+ G AG +G   VQ AK  G  R++ +D  D+KK+  ++ G   F
Sbjct: 200 KALKTADLIPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDEKKELFHKLGGEIF 258

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAA 302
           +    D    K +V  + E T GG     + + +   +  + +   +  G  +++G+ A 
Sbjct: 259 I----DYTTTKDMVGAIQEATQGGPQGVINVSVSEAAISLSTQYV-RPTGSVVLVGLPAN 313

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINS 362
               S     +V     KGS  G    R++    I  +  G +K    I    G +++  
Sbjct: 314 AYVKSEVFSHVVKSISIKGSYVG---NRADTREAIDFFNRGLIKAPIKII---GLSELPQ 367

Query: 363 AFEDLHHGDCL-RTVLDLLK 381
           A++ +  G  L R V+D  K
Sbjct: 368 AYKMMEAGKILGRYVVDTSK 387

>Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 84/302 (27%), Positives = 135/302 (44%), Gaps = 32/302 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE+   L  ++I V  PK +E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESNGKLEHKDIPVPTPKPNELLINVKYSGVCHTDLHAWHGDWPLATKLPL 63

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V ++GE V   K GD   I    + C  C++C+ G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVAMGENVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLS---GY 120

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
             DG                   +F QY     V    I     L +   + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAAHIPEGTDLAEVAPILCAGITVY- 160

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN++ G  VA+ G AG +G   VQ AK  G  R++ +D    K++     G   F
Sbjct: 161 KALKSANLRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGPGKEELFTSLGGEVF 219

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAA 302
           ++ +K+    K IV  +++ TDGG     + + +   + ++   C    G  +++G+ A 
Sbjct: 220 IDFTKE----KDIVGAVIKATDGGAHGIVNVSVSEAAIEASTRYCRAN-GTVVLVGLPAG 274

Query: 303 GK 304
            K
Sbjct: 275 AK 276

>Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON}
           (41165..42226) [1062 nt, 354 aa]
          Length = 353

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 97/343 (28%), Positives = 147/343 (42%), Gaps = 48/343 (13%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAF----PSILGHEGAGIVESIGEGVTNVKPGDH 89
           H V+V+I  T +C +D +  +     G+F    P +LGHE +GIV  +G  VT V  GD 
Sbjct: 31  HFVKVQIKATGICGSDVHFCTH-GAIGSFIVKEPMVLGHESSGIVVEVGSEVTKVAVGDR 89

Query: 90  VIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFS 149
           V        +  +   SG  NLC  ++      V  DGT   + +  ED ++ +      
Sbjct: 90  VAIEPGYPSRYSEETVSGHYNLCPGMKFAATPPV--DGTLLKYFQVPEDFVYKLPDDVTF 147

Query: 150 QYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSV 209
           +   L +   VA+                      AVK A V+ GD V VFGAG VGL V
Sbjct: 148 EEGALVEPLAVAVH---------------------AVKLAGVKFGDKVVVFGAGPVGLLV 186

Query: 210 VQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDY 269
               K  GA+ ++ +D+ D+K   + E G+T  +N SKD+ +    +++  ++     + 
Sbjct: 187 GSVCKAFGATEVVSIDVVDKKLDKSLEMGSTIAIN-SKDMAEEALALEIQNDLNGQHPNK 245

Query: 270 TFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKG 329
             DCTG    +RS++ AC  G G  + +G+      +       V+  V K   F G   
Sbjct: 246 VIDCTGAEPCLRSSILACKPG-GTVVQVGMGTTNASLP------VSDIVIKELTFKG--- 295

Query: 330 RSEMGGLISDYMDG-------KLKVDEFITHRRGFTDINSAFE 365
              M     DY D        K+ V   ITHR  F D   A +
Sbjct: 296 --SMRYCHGDYQDAIQLLKYKKVDVKAIITHRFSFDDAIKALQ 336

>TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 95.9 bits (237), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 101/380 (26%), Positives = 160/380 (42%), Gaps = 39/380 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE   PL  ++I V  PK++E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 33  PKTQKGVIFYENNGPLEYKDIPVPKPKSNEILINVEYSGVCHTDLHAWKGDWPLPVKLPL 92

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V  +G+ V N K GD   I      C  C+ C++G    C           
Sbjct: 93  VGGHEGAGVVVGMGDNVKNWKIGDLAGIKWLNGSCMSCELCENGFEANC----------- 141

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                      +  D+  +    +F QY     V    I     L     + C   T Y 
Sbjct: 142 -----------EHADLSGYTHDGSFQQYATADAVQAARIPAGTDLANVAPILCAGVTVY- 189

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+KTA+++ GD VA+ G AG +G   VQ A   G  R+I +D  + KK+   + G   F
Sbjct: 190 KALKTADLKPGDWVAISGAAGGLGSLAVQYAAAMGL-RVIGIDGGEDKKKLFEKCGGEVF 248

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAA 302
           +    D    K IV  + E T GG     + + +   +  +++      G  +++G+ A 
Sbjct: 249 I----DFTKSKDIVKDIQEATHGGPHGVINVSVSDKAISQSVQYIRPT-GTVVVVGMPAN 303

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINS 362
               S    Q+V     KGS  G    R++    +  +  G +K    +    G +++  
Sbjct: 304 AVVKSDVFNQVVKSIQIKGSYVG---NRADTREALDFFTRGLVKSPIKVV---GLSELPK 357

Query: 363 AFEDLHHGDCL-RTVLDLLK 381
            +E +  G  L R V+D  K
Sbjct: 358 VYELMETGKILGRYVVDTSK 377

>Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 95.5 bits (236), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 81/302 (26%), Positives = 135/302 (44%), Gaps = 32/302 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE+   L  + I V  PK +E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYESNGKLEHKNIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V +IG+ V   K GD   +    + C  C++C+ G  + C           
Sbjct: 64  VGGHEGAGVVVAIGDNVRGWKVGDLAGVKWLNSSCMACEYCELGNESNCPHA-------- 115

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         D+  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 116 --------------DLSGYTHDGSFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY- 160

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN++ G+ VA+ G AG +G   VQ AK  G  R++ +D    K++     G   F
Sbjct: 161 KALKSANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKQELFTSLGGEVF 219

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAA 302
           ++ +K+    K I+  +V+ TDGG     + + +   + ++ + C    G  +++G+ A 
Sbjct: 220 IDFTKE----KDIIGAVVKATDGGAHGIINVSVSEAAIEASTKYCRAN-GTVVLVGLPAG 274

Query: 303 GK 304
            K
Sbjct: 275 AK 276

>Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 95.5 bits (236), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 77/264 (29%), Positives = 116/264 (43%), Gaps = 31/264 (11%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE    L  ++I V  PK +E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 31  PKTQKGVIFYENNGKLHYKDIPVPQPKPNEILINVKYSGVCHTDLHAWHGDWPLAVKLPL 90

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V  +G  V   K GD   I      C  C+FC+SG  + C           
Sbjct: 91  VGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC----------- 139

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+           D+  +    +F Q+     +    I P   L +   + C   T Y 
Sbjct: 140 -PEA----------DLSGYTHDGSFQQFATADAIQAAKIQPGTDLAEVAPILCAGVTVY- 187

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K AN++ GD VA+ G AG +G   VQ A   G  R++ +D  ++K++   + G   F
Sbjct: 188 KALKEANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKQLGGEVF 246

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGG 266
           +    D    K +V  + E T GG
Sbjct: 247 I----DFTKTKDMVSDIQEATKGG 266

>KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 348

 Score = 94.7 bits (234), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 105/383 (27%), Positives = 159/383 (41%), Gaps = 45/383 (11%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T  A V    G  L  ++I V  P A+E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKAVVFETNGGELEYKDIPVPKPAANEILINVKYSGVCHTDLHAWKGDWPLATKLPL 63

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V  IGE V   K GD   I      C  C+ C+    + C           
Sbjct: 64  VGGHEGAGVVVGIGENVKGWKLGDLAGIKWLNGSCMACESCELSNESNCPHA-------- 115

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         D+  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 116 --------------DLSGYTHDGSFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY- 160

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN++ G+ VA+ G AG +G   VQ AK  G  R+I +D  D+K+Q   + G   F
Sbjct: 161 KALKSANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGDEKEQLFKKLGGEYF 219

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACH---KGWGESIIIGV 299
           V    D +  K +V  ++E+T GG         N  V  +A+E+     +  G  +++G+
Sbjct: 220 V----DFRKSKDVVAEILEVTGGGAHGVV----NVSVSEAAIESSTHYVRANGTVVLVGL 271

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTD 359
               K  S     +V      GS  G    R++    +  +  G +K    I    G ++
Sbjct: 272 PGGAKCCSDVFNHVVKSISIVGSYVG---SRADTRQALDFFARGLVKSPIKIV---GLSE 325

Query: 360 INSAFEDLHHGDCL-RTVLDLLK 381
           +   FE +  G    R V+D  K
Sbjct: 326 LPDVFEKMEKGQIAGRYVVDTAK 348

>TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {ON}
           Anc_3.118 YBR145W
          Length = 350

 Score = 94.7 bits (234), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 101/393 (25%), Positives = 161/393 (40%), Gaps = 61/393 (15%)

Query: 1   MSEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEG 60
           MS   P T    + YE   PL  ++I V  P  +E+ + + Y+ VCHTD +   G  P  
Sbjct: 1   MSTEIPKTQKGVIFYENNGPLEYKDIPVPTPLPNELLIHVLYSGVCHTDLHAWHGDWPLP 60

Query: 61  A-FPSILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRAT 118
              P + GHEGAG+V  +G  V   K GD+  I      C  C+ C+    + C      
Sbjct: 61  VKLPLVGGHEGAGVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNC------ 114

Query: 119 QGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGV 178
                 P+     +   G          +F QY     V    I   A L     + C  
Sbjct: 115 ------PEADLSGYTHDG----------SFQQYATADAVQAAKIPAGADLKNIAPILCAG 158

Query: 179 TTGYGAAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEF 237
            T Y  A+K+AN++ GD +A+ GA G +G   +Q  K  G  RI+ +D   +K++   + 
Sbjct: 159 VTVY-KAIKSANLKAGDWLAISGACGGLGSLAIQYGKAMGF-RILGIDGGAEKEELFKKL 216

Query: 238 GATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACH---KGWGES 294
           G   F+    D    K I+  + + T+GG         N  V  +A+EA     +  G  
Sbjct: 217 GGEYFI----DFTQCKDIIAEVKKATNGGAHGVI----NVSVSEAAIEASTNYVRSNGTV 268

Query: 295 IIIGVAAAGKEISTRPFQLVTGRVWKGSAFGG-IKGRSEMGGLISDYMDGKLKVDEFI-- 351
           +++G+ A              G V K + F   +K    +G  + +  D +  +D F+  
Sbjct: 269 VLVGLPA--------------GAVCKSNVFNQVVKSTKIVGSYVGNRADTREAIDFFVRG 314

Query: 352 -----THRRGFTDINSAFEDLHHGDCL-RTVLD 378
                    G + + S F+D+  G  + R V+D
Sbjct: 315 LVKSPIKVVGLSQLASVFDDMQAGKIVGRVVVD 347

>AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR303C (ADH2)
          Length = 385

 Score = 94.7 bits (234), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 84/302 (27%), Positives = 132/302 (43%), Gaps = 32/302 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A V  + G PL   EI V  PK  E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 41  PKTQHAIVFDKNGGPLEYREIEVPEPKPTELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 100

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V ++GE V   + GD   I      C  C+ C+ G  + C           
Sbjct: 101 VGGHEGAGVVVAMGENVRGWQVGDLAGIKWLNGSCMSCEACEQGHESNC----------- 149

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+           D+  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 150 -PEA----------DLSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY- 197

Query: 184 AAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN++ G+ VA+ GA G +G   +Q A+  G  R++ +D  D+K+    + G   F
Sbjct: 198 KALKSANLRAGNWVAISGACGGLGSLAIQYARAMG-YRVLEIDGGDEKEALFRKLGGEVF 256

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAA 302
           V    D +  K +V  +V+ T GG     + + +   + S+ E      G  +++G+   
Sbjct: 257 V----DFRKSKDVVADVVKATGGGAHGVINVSVSEAAIESSTEYVRSN-GTVVLVGLPGG 311

Query: 303 GK 304
            K
Sbjct: 312 AK 313

>TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 94.4 bits (233), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 101/383 (26%), Positives = 166/383 (43%), Gaps = 45/383 (11%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A + YE+G  L  +++ V  PK +E+ + I Y+ VCHTD +   G  P +   P 
Sbjct: 7   PKTQKAVIFYESGGALEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPL 66

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           I GHEGAG+V  +G  V   K GD+  +      C  C+ C+    + C           
Sbjct: 67  IGGHEGAGVVVGMGANVRGWKIGDYAGVKWLNGSCMSCEECELSNESNC----------- 115

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+     +   G          +F +Y     V    I   A L +   + C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQEYCTADAVQAARIPQGADLAEVAPILCAGVTVY- 163

Query: 184 AAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+A++  G+ VA+ GA G +G   VQ AK  G  R++ +D  ++KK+  +E G   F
Sbjct: 164 KALKSADLAAGEWVAISGACGGLGSLAVQFAKAMGL-RVLGIDGGEEKKKMFHEMGGEVF 222

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACH---KGWGESIIIGV 299
           +    D +  K +   +++ T+GG         N  V  +A+EA     +  G  +++G+
Sbjct: 223 L----DFRLEKDMEAAVIKATNGGAHGVI----NVSVSEAAIEASTRYVRSNGTVVLVGL 274

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTD 359
            A     S    Q+V      GS  G    R++    +  ++ G +K      H  G + 
Sbjct: 275 PANAYCKSEVFSQVVKSYKIVGSYVG---NRADTREALDFFVRGLVKSP---IHIVGLST 328

Query: 360 INSAFEDLHHGDCL-RTVLDLLK 381
           +   +E +  G  + R V+D  K
Sbjct: 329 LPEIYEKMEKGQIVGRYVVDTTK 351

>NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480
          Length = 381

 Score = 94.4 bits (233), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 79/264 (29%), Positives = 114/264 (43%), Gaps = 31/264 (11%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A V YE G PL  ++I V  PKA+E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 37  PKTQKAVVFYENGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 96

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEG+G+V  +GE V   K GD   I      C  C+ C++G  + C           
Sbjct: 97  VGGHEGSGVVMQVGENVKGWKVGDLAGIKWLNGSCMACELCETGNESNC----------- 145

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                      +  D+  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 146 -----------EHADLSGYTHDGSFQQYATADAVQAARIPEGTNLAEVAPILCAGITVY- 193

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K A+++ G  V + G AG +G   VQ AK  G  R+I +D    K++     G   F
Sbjct: 194 KALKEADLKAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGKAKEELFKSMGGEVF 252

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGG 266
           +    D    K +V  + E T GG
Sbjct: 253 I----DFTKSKDMVKDIQEATKGG 272

>KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 101/377 (26%), Positives = 162/377 (42%), Gaps = 44/377 (11%)

Query: 13  VAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 71
           + YE G PLT +++ V  PK +E+ + + Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 37  IFYENGGPLTYKDMPVPVPKPNEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 96

Query: 72  GIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTR 130
           GIV + G  V N + GD   I      C  C+ C+ G  + C                  
Sbjct: 97  GIVVAKGSNVKNFEIGDLAGIKWLNGSCMACELCEKGYESNC------------------ 138

Query: 131 FHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAN 190
               +  D+  +    +F QY          I     L +   + C   T Y  A+KTA 
Sbjct: 139 ----EHADLSGYTHDGSFQQYATADATQAAQIPRGTDLAEVAPILCAGVTVY-KALKTAA 193

Query: 191 VQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDL 249
           +Q G+ VA+ GA G +G   +Q AK  G  R++ +D  + K +   E G   F++ +K  
Sbjct: 194 LQPGEWVAISGACGGLGSLAIQYAKAMGL-RVLGIDGGEAKAKMFKELGGETFIDFTK-Y 251

Query: 250 KDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACH---KGWGESIIIGVAAAGKEI 306
           K+ + ++  + E T GG         N  V  +A+ A     +  G  +I+G+  AG  +
Sbjct: 252 KNNEAMIKDIQEATKGGPQGVI----NVSVSEAAISASTQYVRPTGTVVIVGM-PAGAYV 306

Query: 307 STRPFQLVTGRV-WKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFE 365
            +  F  V   +  KGS  G    R++    I  +  G +K    +    G +++   +E
Sbjct: 307 KSDVFSHVVKSISIKGSYVG---NRADTREAIDFFSRGLVKSPITVV---GLSELPKIYE 360

Query: 366 DLHHGDCL-RTVLDLLK 381
            +     L R V+D  K
Sbjct: 361 LMEKNKILGRYVVDTSK 377

>YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}
           BDH1NAD-dependent (R,R)-butanediol dehydrogenase,
           catalyzes oxidation of (R,R)-2,3-butanediol to
           (3R)-acetoin, oxidation of meso-butanediol to
           (3S)-acetoin, and reduction of acetoin; enhances use of
           2,3-butanediol as an aerobic carbon source
          Length = 382

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 110/241 (45%), Gaps = 39/241 (16%)

Query: 60  GAFPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAEC--------------KECKFCK 105
            A P  +GHE +GIV  +G  VT VK GDHV+    + C              K C  C+
Sbjct: 65  AALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQ 124

Query: 106 SGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPK 165
            G  NLC       G GV+  G                    F++  V++   ++ +  +
Sbjct: 125 RGSENLCTHA-GFVGLGVISGG--------------------FAEQVVVSQHHIIPVPKE 163

Query: 166 APLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVD 225
            PLD   L+     T +  AVK +  +KG +  V GAG +GL  +   K  GAS+I+V +
Sbjct: 164 IPLDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSE 221

Query: 226 INDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALE 285
           I +++ + A + G   F NPSK       I+  L +  D G DY++DC+G      ++L+
Sbjct: 222 IAERRIEMAKKLGVEVF-NPSKHGHKSIEILRGLTKSHD-GFDYSYDCSGIQVTFETSLK 279

Query: 286 A 286
           A
Sbjct: 280 A 280

>YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON}
           ADH2Glucose-repressible alcohol dehydrogenase II,
           catalyzes the conversion of ethanol to acetaldehyde;
           involved in the production of certain carboxylate
           esters; regulated by ADR1
          Length = 348

 Score = 93.6 bits (231), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 83/302 (27%), Positives = 134/302 (44%), Gaps = 32/302 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A + YE+   L  ++I V  PK +E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKAIIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V  +GE V   K GD+  I      C  C++C+ G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
             DG                   +F +Y     V    I     L +   + C   T Y 
Sbjct: 121 THDG-------------------SFQEYATADAVQAAHIPQGTDLAEVAPILCAGITVY- 160

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN++ G   A+ G AG +G   VQ AK  G  R++ +D    K++     G   F
Sbjct: 161 KALKSANLRAGHWAAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKEELFTSLGGEVF 219

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAA 302
           ++ +K+    K IV  +V+ T+GG     + + +   + ++   C    G  +++G+ A 
Sbjct: 220 IDFTKE----KDIVSAVVKATNGGAHGIINVSVSEAAIEASTRYCRAN-GTVVLVGLPAG 274

Query: 303 GK 304
            K
Sbjct: 275 AK 276

>SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON}
           uniprot|Q6XQ71 Saccharomyces kluyveri ADH4 Alcohol
           dehydrogenase 4
          Length = 377

 Score = 93.6 bits (231), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 80/264 (30%), Positives = 114/264 (43%), Gaps = 31/264 (11%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE+G  L  ++I V  PK +E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 33  PTTQKGVIFYESGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 92

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V + GE V N + GD   I      C  C+ C+ G  + C           
Sbjct: 93  VGGHEGAGVVVAKGENVMNFEIGDLAGIKWLNGSCMACELCEQGHESNC----------- 141

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                   H     D+  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 142 -------LH----ADLSGYTHDGSFQQYATADAVQAAQIPKGTDLAEVAPILCAGVTVY- 189

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+KTA+++ G  VA+ G AG +G   VQ AK  G  RI+ +D    K++     G   F
Sbjct: 190 KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RILGIDGGPGKEELFKSLGGEVF 248

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGG 266
           +    D    K IV  + E T GG
Sbjct: 249 I----DFTKTKDIVSAIQEATKGG 268

>ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR083W
           (ADH3)
          Length = 373

 Score = 93.6 bits (231), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 104/382 (27%), Positives = 160/382 (41%), Gaps = 41/382 (10%)

Query: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSG---VDP 58
           S   P T  A V YE G  L   +I V  PK +E+ V I Y+ VCHTD +   G   + P
Sbjct: 25  STAIPTTQKAVVFYEHGGELKYTDIPVPKPKPNEILVNIKYSGVCHTDLHAWKGDWAIKP 84

Query: 59  EGAFPSILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRA 117
           +   P + GHEGAG+V + G  VTN + GD+  +      C EC+FC+ G    C +   
Sbjct: 85  K--LPLVGGHEGAGVVVAKGANVTNFEIGDYAGVKWLGKTCMECEFCQKGFEPNCETPTL 142

Query: 118 TQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCG 177
           +   G   DG                   TF QY     +    I P   L K   + C 
Sbjct: 143 S---GYTHDG-------------------TFQQYATADAIHAAHIPPGTDLAKVAPILCA 180

Query: 178 VTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEF 237
             T Y  A+KTA +  G  VA+ GAG    S+     V    R++ +D  ++K+      
Sbjct: 181 GITVY-KALKTAALIPGQWVAISGAGGGLGSLAVQYAVAMGYRVVGIDGGNEKEALFRSL 239

Query: 238 GATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIII 297
           G   FV    D    K IV  + E T GG     + + +T+ +  ++E   +  G  +++
Sbjct: 240 GGETFV----DFHKNKDIVSAVREATGGGPHGVVNVSVSTNAILQSVEYV-RPTGTVVLV 294

Query: 298 GVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGF 357
           G+       S     ++     KGS  G    R++    I  +  G ++    I    G 
Sbjct: 295 GLPPDATVKSDVLTHVLKSINIKGSYVG---NRADTKEAIEFFTRGLVQSPIKII---GL 348

Query: 358 TDINSAFEDLHHGDCL-RTVLD 378
           + +  A++ +  G  + R V+D
Sbjct: 349 SQLEEAYKAMEEGTSIGRYVVD 370

>ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|P00330 Saccharomyces cerevisiae
           YOL086C ADH1 Alcohol dehydrogenase involved in the
           production of certain carboxylate esters
          Length = 379

 Score = 93.6 bits (231), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 89/302 (29%), Positives = 128/302 (42%), Gaps = 38/302 (12%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    V  E+  PL  +EI V  PK +E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 35  PKTQKGVVFNESNGPLEYKEIPVPTPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPL 94

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG V ++G  V N K GD   I      C  C+ C+    + C           
Sbjct: 95  VGGHEGAGEVIALGSNVKNWKVGDLAGIKWLNGSCMSCESCEQSNESNC----------- 143

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PD           D+  +    +F QY     V    I P   L +   + C   T Y 
Sbjct: 144 -PDA----------DLSGYTHDGSFQQYATADAVQAAHIPPGTDLAEVAPVLCAGITVY- 191

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN++ G  VA+ G AG +G   VQ AK  G  R++ +D    K++     G   F
Sbjct: 192 KALKSANLKAGQWVAISGAAGGLGSLAVQFAKAMGL-RVVGIDGGPGKEELFKTLGGEVF 250

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHK---GWGESIIIGV 299
           +    D +    IV  +V  T+GG         N  V   A+ A  K     G S+++G+
Sbjct: 251 I----DFQKESDIVGAVVNATNGGAHGVV----NVSVSEGAISASTKYVRACGTSVLVGM 302

Query: 300 AA 301
            A
Sbjct: 303 PA 304

>TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 99/383 (25%), Positives = 163/383 (42%), Gaps = 45/383 (11%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A + Y+ G PL  +++ V  PK +E+ + I Y+ VCHTD +   G  P +   P 
Sbjct: 7   PQTQKAVIFYKNGGPLEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPL 66

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           I GHEGAG+V  +G  V   K GD+  +      C  C+ C+    + C           
Sbjct: 67  IGGHEGAGVVVGMGSNVKGWKIGDYAGVKWLNGSCMSCEECELSNESNC----------- 115

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+     +   G          +F +Y     V    I     L +   L C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQEYCTADAVQAARIPQGTDLAQVAPLLCAGVTVY- 163

Query: 184 AAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+A++  G  VA+ GA G +G   +Q AK  G  R++ +D  ++KK+  +E G   F
Sbjct: 164 KALKSADLAAGQWVAISGACGGLGSLAIQFAKAMGL-RVLGIDGGEEKKKMFHELGGEVF 222

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACH---KGWGESIIIGV 299
           +    D +  K +   +++ T+GG         N  V  +A+E+     +  G  +++G+
Sbjct: 223 L----DFRLEKDMEAAIIKATNGGAHGVI----NVSVSEAAIESSTRYVRSNGTVVLVGL 274

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTD 359
            A     S    Q+V      GS  G    R++    +  +  G +K      H  G + 
Sbjct: 275 PANAYCKSEVFAQVVKSYKIVGSYVG---NRADTREALDFFSRGLVKSP---IHIVGLST 328

Query: 360 INSAFEDLHHGDCL-RTVLDLLK 381
           +   +E +  G  + R V+D  K
Sbjct: 329 LPEIYEKMEKGQIVGRYVVDTTK 351

>ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W
          Length = 370

 Score = 92.0 bits (227), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 96/380 (25%), Positives = 161/380 (42%), Gaps = 39/380 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE+G  L  +++ V  P+ +E+ V + Y+ VCHTD +   G  P +   P 
Sbjct: 26  PSTQKGVIFYESGGKLHYKDLAVPKPRNNEILVNVKYSGVCHTDLHAWKGDWPLDTKLPL 85

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V + GE V N + GD   I      C+ C+ C+ G  + C     +   G 
Sbjct: 86  VGGHEGAGVVVAKGENVKNFEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHADLS---GY 142

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
             DG                   TF QY     +    I     L     + C   T Y 
Sbjct: 143 THDG-------------------TFQQYATADAIQAAHIPKGTDLAGVAPILCAGVTVY- 182

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A++++  + G+ VA+ G AG +G    Q A+  G  R++ +D  + K +     G   F
Sbjct: 183 KALRSSGARPGEWVAISGAAGGLGSLATQYARAMGL-RVVGIDGGEDKAKLFKSLGGEIF 241

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAA 302
           ++ +K+    K I   ++E T GG     + + +   M  ++E   +  G  +++G+ A 
Sbjct: 242 IDFTKE----KDIPAAILEATQGGAHGVINVSVSEKAMSQSVEYV-RPQGTVVLVGLPAN 296

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINS 362
               S     +V     KGS  G    R++    +  +  G +K    I    G +++  
Sbjct: 297 AVIKSNVFNHVVKSFSIKGSYVG---NRADSREAVEFFSRGLVKSPIKIV---GLSELPK 350

Query: 363 AFEDLHHGDCL-RTVLDLLK 381
            +E +  G  L R V+D  K
Sbjct: 351 IYELMEAGKILGRYVVDTSK 370

>Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 91.7 bits (226), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 118/382 (30%), Positives = 160/382 (41%), Gaps = 62/382 (16%)

Query: 13  VAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDA--YTLSGVDPEGAF----PSIL 66
           +A E     TIE    DP   H V++ I  T +C +D   Y   G+   G +    P +L
Sbjct: 17  IAIEQRPVPTIE----DP---HYVKLAIKATGICGSDVHYYRSGGI---GKYILKAPMVL 66

Query: 67  GHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPD 126
           GHE +G V  +G  VT VK GD V        +     K G+ NLC  +       +  D
Sbjct: 67  GHESSGEVVEVGNAVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--D 124

Query: 127 GTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAV 186
           GT   +    ED L  +       Y   A      ++P         L  GV +      
Sbjct: 125 GTLVKYYLSPEDFL--VKLPEGVSYEEGA-----CVEP---------LSVGVHSN----- 163

Query: 187 KTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPS 246
           K A V+    V VFGAG VGL     A+  GAS ++ VD+ D K Q A +FGAT+  N S
Sbjct: 164 KLAGVRFSTRVVVFGAGPVGLLTGAVARAFGASDVVFVDVFDNKLQRAKDFGATNTFNSS 223

Query: 247 KDLKDGKTIVDMLVEMTDGG--LDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGK 304
           K   D    +   VE   GG   D  F+C+G  DV   A     K  G  + +G+   GK
Sbjct: 224 KIPTDKAQELASEVEKLLGGNHADVVFECSG-ADVCIDAGVKVTKVGGTMVQVGM---GK 279

Query: 305 EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMD-------GKLKVDEFITHRRGF 357
             +  P   V+G+  K    G    R   G    DY D       GK+ V   ITHR  F
Sbjct: 280 NYTNFPIAEVSGKEMK--LIGCF--RYSFG----DYRDAVNLVATGKVNVKPLITHRFKF 331

Query: 358 TDINSAFED--LHHGDCLRTVL 377
            D   A++    H GD ++T++
Sbjct: 332 EDAAKAYDYNISHGGDVVKTII 353

>TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 91.3 bits (225), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 79/264 (29%), Positives = 116/264 (43%), Gaps = 31/264 (11%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE    L  ++I V  P  +E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 7   PETQKGVIFYENNGTLEYKDIPVPKPAPNELLINVKYSGVCHTDLHAWKGDWPLPVKLPL 66

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V ++G  V N K GD+  I      C  C+ C+ G  + C     +   G 
Sbjct: 67  VGGHEGAGVVVALGSNVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNCPQADLS---GY 123

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
             DG                   +F QY     V    I P   L +   + C   T Y 
Sbjct: 124 THDG-------------------SFQQYATTDAVQAAKISPGTDLAEVAPVLCAGLTVY- 163

Query: 184 AAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+A ++ G  VA+ GA G +G   VQ AK  G  R++ +D  D+K +   E G   F
Sbjct: 164 KALKSAELEAGQWVAISGACGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKMFKELGGEYF 222

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGG 266
           +    D    K I+  +V+ T+GG
Sbjct: 223 I----DFTKCKDIIGEVVKATNGG 242

>Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 91.3 bits (225), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/264 (29%), Positives = 114/264 (43%), Gaps = 31/264 (11%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE    L  ++I V  PK +E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 31  PQTQKGVIFYENNGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPL 90

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V  +G  V   K GD   I      C  C+FC+SG  + C           
Sbjct: 91  VGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC----------- 139

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PD           D+  +    +F Q+     +    I     L +   + C   T Y 
Sbjct: 140 -PDA----------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY- 187

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K AN++ GD VA+ G AG +G   VQ A   G  R++ +D   +K++   + G   F
Sbjct: 188 KALKEANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGAEKEKLFKQLGGEVF 246

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGG 266
           +    D    K +V  + E T GG
Sbjct: 247 I----DFTKTKDMVSDIQEATKGG 266

>Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 106/367 (28%), Positives = 157/367 (42%), Gaps = 54/367 (14%)

Query: 26  IVVDPPKAHEVRVKIAYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESIGE 79
           I+ DP   H V++ I  T +C +D   Y   G+   G +    P +LGHE +G V  +G 
Sbjct: 26  IIEDP---HYVKIAIKATGICGSDIHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGS 79

Query: 80  GVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDI 139
            VT VK GD V        +     K G+ NLC  +       +  DGT   +    ED 
Sbjct: 80  AVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDF 137

Query: 140 LHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAV 199
           L  +       Y   A      ++P         L  GV +      K A V+ G  V V
Sbjct: 138 L--VKLPEGVSYEEGA-----CVEP---------LSVGVHSN-----KLAGVRFGSRVVV 176

Query: 200 FGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDG-KTIVDM 258
           FGAG VGL     A+  GAS ++ +D+ D K   A EFGAT   N SK   D  + + D 
Sbjct: 177 FGAGPVGLLTGAVARAFGASDVVFIDVFDNKLDRAKEFGATHTFNSSKFPADKTQELADE 236

Query: 259 LVEMTDG-GLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGR 317
           + ++  G   D  F+C+G    + + ++    G G  + IG+   GK  +  P   V+G+
Sbjct: 237 VEKLLSGHHADIVFECSGADACIDAGVKITKVG-GTMVQIGM---GKNYTNFPIAEVSGK 292

Query: 318 VWK-----GSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSA--FEDLHHG 370
             K       +FG  +   ++         GK+ V   ITHR  F D   A  F   H G
Sbjct: 293 EMKLIGCFRYSFGDYRDAVKL------VASGKVNVKAMITHRFKFEDAAKAYDFNIAHGG 346

Query: 371 DCLRTVL 377
           + ++T++
Sbjct: 347 EVVKTII 353

>Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086C
           (ADH1) - Alcohol dehydrogenase [contig 183] FULL
          Length = 351

 Score = 90.5 bits (223), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 80/284 (28%), Positives = 122/284 (42%), Gaps = 35/284 (12%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A + YE G PL  ++I V  P A E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFYENGGPLEYKDIPVPKPSATELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V ++GE V   K GD+  I      C  C+ C+    + C           
Sbjct: 67  VGGHEGAGVVVAMGENVKGWKIGDYAGIKWLNGSCMSCESCELSNESNC----------- 115

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+     +   G          +F QY     V    I     L +   + C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQQYATADAVQAAKIPQGTDLAEVAPVLCAGITVY- 163

Query: 184 AAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN+  GD VA+ GA G +G   +Q A   G  R++ +D   +K +   + G   F
Sbjct: 164 KALKSANLSAGDWVAISGACGGLGSLCIQYATAMG-YRVLGIDGGAEKAELFKQLGGEVF 222

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEA 286
           +    D    K +   +++ T+GG         N  V  +A+E+
Sbjct: 223 I----DFTTCKDVEGEIIKATNGGAHGVI----NVSVSEAAIES 258

>Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 125/280 (44%), Gaps = 55/280 (19%)

Query: 35  EVRVKIAYTAVC------HTDAYTLSGVDPE------GAFPSILGHEGAGIVESIGEGVT 82
           EV + +++  +C      +TD       D E       A P  +GHE +GI+  +G  VT
Sbjct: 28  EVIIDVSWCGICGSDLHEYTDGPIFMPKDGECHALSNAALPLAMGHEMSGIIAKVGPRVT 87

Query: 83  NVKPGDHVIALYTAEC--------------KECKFCKSGKTNLCGSVRATQGKGVMPDGT 128
            VK GDHV+    + C              K C+ CK G  NLC       G GV+  G 
Sbjct: 88  KVKVGDHVVVDAGSSCADLHCWPHSKYYNSKPCEACKKGSENLCAH-SGFVGLGVISGG- 145

Query: 129 TRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
                              F++  V+++  ++ +  + PLD   L+     T +  AVK 
Sbjct: 146 -------------------FAEQVVVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVKL 184

Query: 189 ANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKD 248
           +  +KG +  V GAG +GL  +   K  GA +I+V ++ +++ + A       F NP+  
Sbjct: 185 SGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVAERRLKMAKSLDVEVF-NPA-- 241

Query: 249 LKDGKTIVDMLVEMTDG--GLDYTFDCTGNTDVMRSALEA 286
            + G   V++L  +T+   G DY++DC+G      ++L+A
Sbjct: 242 -QHGHKSVELLRGLTESHDGFDYSYDCSGIQATFETSLKA 280

>YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}
           ADH3Mitochondrial alcohol dehydrogenase isozyme III;
           involved in the shuttling of mitochondrial NADH to the
           cytosol under anaerobic conditions and ethanol
           production
          Length = 375

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 115/264 (43%), Gaps = 31/264 (11%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE    L  ++I V  PK +E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 31  PKTQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPL 90

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V  +G  V   K GD   I      C  C+FC+SG  + C           
Sbjct: 91  VGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC----------- 139

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PD           D+  +    +F Q+     +    I     L +   + C   T Y 
Sbjct: 140 -PDA----------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY- 187

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K A+++ GD VA+ G AG +G   VQ A   G  R++ +D  ++K++   + G   F
Sbjct: 188 KALKEADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKLGGEVF 246

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGG 266
           +    D    K +V  + E T GG
Sbjct: 247 I----DFTKTKNMVSDIQEATKGG 266

>TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {ON}
           Anc_2.480 YMR083W
          Length = 373

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 95/378 (25%), Positives = 156/378 (41%), Gaps = 41/378 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE G  L  ++I V  PK +E+ + I Y+ VCHTD +   G  P     P 
Sbjct: 29  PATQKGVIFYENGGELHYKDIAVPKPKPNEILINIKYSGVCHTDLHAWKGDWPLPVKLPL 88

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V + G+ VTN + GD   +    + C  C++C+ G  + C           
Sbjct: 89  VGGHEGAGVVVAKGKDVTNFEIGDLAGVKWLNSSCMACEYCELGHESNCAKA-------- 140

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         D+  +    +F QY     +    I     L +   + C   T Y 
Sbjct: 141 --------------DLSGYTHDGSFQQYATADAIQAAPIPKDTDLAEVAPILCAGVTVY- 185

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+KT+  + G  VA+ G AG +G   VQ A   G  R++ +D  + K++     G   F
Sbjct: 186 KALKTSGAKPGQWVAISGAAGGLGSLAVQYATAMGL-RVLGIDGGEGKEELFKSLGGEVF 244

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAA 302
           V    D    K +V  + E T+GG     + + +   ++ + E   +  G  +++G+ A 
Sbjct: 245 V----DFTKTKDMVSAIQEATNGGPHAVVNVSVSEAAIQQSTEYV-RPTGTVVLVGLPAH 299

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIS-DYMDGKLKVDEFITHRRGFTDIN 361
               S     +V     KGS  G      E     S + +   +K+        G +++ 
Sbjct: 300 AYVKSEIFSHVVKSISIKGSYVGNRADTREAIDFFSRNLVKSPIKI-------IGLSELP 352

Query: 362 SAFEDLHHGDCL-RTVLD 378
             +E +  G  L R V+D
Sbjct: 353 KVYELMEEGKILGRYVVD 370

>Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)
          Length = 357

 Score = 90.1 bits (222), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 105/367 (28%), Positives = 157/367 (42%), Gaps = 57/367 (15%)

Query: 28  VDPPKAHEVRVKIAYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESIGEGV 81
           +D P  H V++ I  T +C +D   Y   G+   G +    P +LGHE +G V  +G+ V
Sbjct: 27  IDDP--HYVKLAIKATGICGSDVHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAV 81

Query: 82  TNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILH 141
           T VK GD V        +     K G+ NLC  +       +  DGT   +    ED L 
Sbjct: 82  TRVKIGDRVAIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTLVRYYLSPEDFL- 138

Query: 142 FMGCSTFSQYTVLADVSVVAIDPKAPLDKTCL--LGCGVTTGYGAAVKTANVQKGDTVAV 199
                            V   D  +  +  C+  L  GV +      K A V+ G  V V
Sbjct: 139 -----------------VKLPDGVSYEEGACVEPLSVGVHSN-----KLAGVRFGTRVVV 176

Query: 200 FGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSK-DLKDGKTIVDM 258
           FGAG VGL     A   GAS +I VD+ D + Q A +FGA+   N SK  + + + + D 
Sbjct: 177 FGAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADE 236

Query: 259 LVEMTDG-GLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGR 317
           + ++  G   D  F+C+G  DV   A     K  G  + +G+   GK  +  P   V+G+
Sbjct: 237 VEKLLGGHHADVVFECSG-ADVCIDAGVKTTKVGGTMVQVGM---GKNYTNFPIAEVSGK 292

Query: 318 VWK-----GSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFED--LHHG 370
             +       +FG  +    +         GK+ V   ITHR  F D   A++    H G
Sbjct: 293 EMRLIGCFRYSFGDYRDAVNL------VASGKVNVKPLITHRFKFEDAAKAYDYNIAHGG 346

Query: 371 DCLRTVL 377
           D ++T++
Sbjct: 347 DVVKTII 353

>Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 90.1 bits (222), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 105/367 (28%), Positives = 157/367 (42%), Gaps = 57/367 (15%)

Query: 28  VDPPKAHEVRVKIAYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESIGEGV 81
           +D P  H V++ I  T +C +D   Y   G+   G +    P +LGHE +G V  +G+ V
Sbjct: 27  IDDP--HYVKLAIKATGICGSDVHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAV 81

Query: 82  TNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILH 141
           T VK GD V        +     K G+ NLC  +       +  DGT   +    ED L 
Sbjct: 82  TRVKIGDRVAIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTLVRYYLSPEDFL- 138

Query: 142 FMGCSTFSQYTVLADVSVVAIDPKAPLDKTCL--LGCGVTTGYGAAVKTANVQKGDTVAV 199
                            V   D  +  +  C+  L  GV +      K A V+ G  V V
Sbjct: 139 -----------------VKLPDGVSYEEGACVEPLSVGVHSN-----KLAGVRFGTRVVV 176

Query: 200 FGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSK-DLKDGKTIVDM 258
           FGAG VGL     A   GAS +I VD+ D + Q A +FGA+   N SK  + + + + D 
Sbjct: 177 FGAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADE 236

Query: 259 LVEMTDG-GLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGR 317
           + ++  G   D  F+C+G  DV   A     K  G  + +G+   GK  +  P   V+G+
Sbjct: 237 VEKLLGGHHADVVFECSG-ADVCIDAGVKTTKVGGTMVQVGM---GKNYTNFPIAEVSGK 292

Query: 318 VWK-----GSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFED--LHHG 370
             +       +FG  +    +         GK+ V   ITHR  F D   A++    H G
Sbjct: 293 EMRLIGCFRYSFGDYRDAVNL------VASGKVNVKPLITHRFKFEDAAKAYDYNIAHGG 346

Query: 371 DCLRTVL 377
           D ++T++
Sbjct: 347 DVVKTII 353

>KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON}
           similar to uniprot|P39714 Saccharomyces cerevisiae
           YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
           dehydrogenase
          Length = 385

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 107/230 (46%), Gaps = 43/230 (18%)

Query: 62  FPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAEC--------------KECKFCKSG 107
            P  +GHE +GIV  +G  VTN+K GDHV+   T  C               EC  C+ G
Sbjct: 67  LPQAMGHEMSGIVSKVGPKVTNIKAGDHVVVEATGTCLDHYTWPNAAHAKDAECAACQRG 126

Query: 108 KTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAP 167
             N C  +    G GV   G                    F++  V+++  VV I    P
Sbjct: 127 FYNCCAHL-GFMGLGVHSGG--------------------FAEKVVVSEKHVVKIPNTLP 165

Query: 168 LDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDIN 227
           LD   L+     + +  AV+ + +QKG +  V GAG +GL+ +   +  GAS+I+V +  
Sbjct: 166 LDVAALVEPISVSWH--AVRISKLQKGQSALVLGAGPIGLATILALQGHGASKIVVSEPA 223

Query: 228 DQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG--GLDYTFDCTG 275
           + ++  A + G   F +PS+  +D    V++L ++  G  G D+ +DC+G
Sbjct: 224 EIRRNQAAKLGVETF-DPSEHKEDA---VNILKKLAPGGEGFDFAYDCSG 269

>Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 123/278 (44%), Gaps = 51/278 (18%)

Query: 35  EVRVKIAYTAVCHTDAYT-LSG-----------VDPEGAFPSILGHEGAGIVESIGEGVT 82
           EV + +++  +C +D +  L G                  P  +GHE +GIV  +G  VT
Sbjct: 28  EVLIDVSWCGICGSDLHEYLDGPIFMPKDGECHALSNAGLPLAMGHEMSGIVAEVGPKVT 87

Query: 83  NVKPGDHVIALYTAEC--------------KECKFCKSGKTNLCGSVRATQGKGVMPDGT 128
            VK GDHV+    + C              K C+ CK G  NLC +     G GV+  G 
Sbjct: 88  KVKVGDHVVVDAASSCADLHCWPQSKHYSSKPCEACKKGSENLC-THGGFIGLGVISGG- 145

Query: 129 TRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
                              F++   +++  ++ +  + PLD   L+     T +  AVK 
Sbjct: 146 -------------------FAEQVAVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVKI 184

Query: 189 ANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKD 248
           +  +KG +  V GAG +GL  +   K  GA +I+V ++ +++ + A   G   F NPSK 
Sbjct: 185 SGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVAERRIEMAKNLGVEVF-NPSKH 243

Query: 249 LKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEA 286
            +    ++  L +  D G DY++DC+G      ++L+A
Sbjct: 244 GQKSIEVLRGLTKSHD-GFDYSYDCSGIQVTFETSLKA 280

>NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON}
           Anc_2.480
          Length = 373

 Score = 89.4 bits (220), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 77/257 (29%), Positives = 111/257 (43%), Gaps = 31/257 (12%)

Query: 13  VAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 71
           + YE G PL  ++I V  PKA+E+ + + Y+ VCHTD +   G  P     P + GHEG+
Sbjct: 36  IFYETGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGHEGS 95

Query: 72  GIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTR 130
           G V ++GE V   K GD   I      C  C+ C+SG  + C                  
Sbjct: 96  GEVVAMGENVKGWKIGDLAGIKWLNGSCMSCELCESGHESNC------------------ 137

Query: 131 FHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAN 190
               +  D+  +    +F QY     V    I     + +   + C   T Y  A+K A+
Sbjct: 138 ----EHADLSGYTHDGSFQQYATADAVQAARIPKGTNMAEVAPILCAGITVY-KALKEAD 192

Query: 191 VQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDL 249
           ++ G  V + G AG +G   VQ AK  G  R+I +D    K++     G   FV    D 
Sbjct: 193 MRAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGPGKEELFKSLGGEIFV----DF 247

Query: 250 KDGKTIVDMLVEMTDGG 266
              K IV  + E T GG
Sbjct: 248 TKTKDIVAEIQEATRGG 264

>Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W
           (BDH1) - (2R,3R)-2,3-butanediol dehydrogenase [contig
           44] FULL
          Length = 382

 Score = 89.4 bits (220), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 81/315 (25%), Positives = 133/315 (42%), Gaps = 73/315 (23%)

Query: 10  LAAVAYEAGKPLTIEEIVVDP--PKAHEVRVKIAYTAVCHTD----------------AY 51
           + A+AY   K +     + +P    + +V++ I++  VC +D                 +
Sbjct: 1   MRALAYFGQKDIRFTNDLPEPTIQASDDVQIAISWCGVCGSDLHEYLDGPIFFPKDGEKH 60

Query: 52  TLSGVDPEGAFPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECK------------ 99
            +SGV      P  +GHE +G+V  IG GV N+K GDHV+   T  CK            
Sbjct: 61  AMSGV----GLPQAMGHEMSGVVAKIGPGVKNIKVGDHVVVETTGTCKDRYRWPDVKHAS 116

Query: 100 --ECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHF--MGCST--FSQYTV 153
             EC  CK    N C                           L F  +GC +  F++  V
Sbjct: 117 DEECAACKKDFYNCCSE-------------------------LGFCGLGCHSGGFAEKVV 151

Query: 154 LADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGA 213
           +++  VV +    PLD   L+     + +  AV+ + ++ G +  + GAG +GL+ V   
Sbjct: 152 ISEKHVVKVPKDIPLDVAALVEPLAVSWH--AVRISQLKAGQSALILGAGPIGLATVLAL 209

Query: 214 KVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG--GLDYTF 271
           +  GA  I+V + +  +++ A   GA  F NP      G   VD L ++  G  G D+++
Sbjct: 210 QGHGAGTIVVSEPSASRRKQAEALGALTF-NP---FDHGDKAVDELRKIPPGSDGFDFSY 265

Query: 272 DCTGNTDVMRSALEA 286
           DC+G      + L A
Sbjct: 266 DCSGLKATFNTGLYA 280

>YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbitol
           dehydrogenase; expression is induced in the presence of
           sorbitol or xylose
          Length = 357

 Score = 89.0 bits (219), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 107/361 (29%), Positives = 156/361 (43%), Gaps = 55/361 (15%)

Query: 34  HEVRVKIAYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESIGEGVTNVKPG 87
           H V++ I  T +C +D   Y   G+   G +    P +LGHE +G V  +G+ VT VK G
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAVTRVKVG 87

Query: 88  DHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCST 147
           D V        +     K G+ NLC  +       +  DGT   +    ED L  +    
Sbjct: 88  DRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDFL--VKLPE 143

Query: 148 FSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGL 207
              Y   A      ++P         L  GV +      K A V+ G  V VFGAG VGL
Sbjct: 144 GVSYEEGA-----CVEP---------LSVGVHSN-----KLAGVRFGTKVVVFGAGPVGL 184

Query: 208 SVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKD-GKTIVDMLVEMTDGG 266
                A+  GA+ +I VD+ D K Q A +FGAT+  N S+   D  + + D + ++  G 
Sbjct: 185 LTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADGVQKLLGGN 244

Query: 267 -LDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAFG 325
             D  F+C+G  DV   A     K  G  + +G+   GK  +  P   V+G+  K    G
Sbjct: 245 HADVVFECSG-ADVCIDAAVKTTKVGGTMVQVGM---GKNYTNFPIAEVSGKEMK--LIG 298

Query: 326 GIKGRSEMGGLISDYMD-------GKLKVDEFITHRRGFTDINSAFED--LHHGDCLRTV 376
               R   G    DY D       GK+ V   ITH+  F D   A++    H G+ ++T+
Sbjct: 299 CF--RYSFG----DYRDAVNLVATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTI 352

Query: 377 L 377
           +
Sbjct: 353 I 353

>Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 89.0 bits (219), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 115/264 (43%), Gaps = 31/264 (11%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE    L  ++I V  PK +E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 31  PETQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPL 90

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V  +G  V   K GD   I      C  C+FC+SG  + C           
Sbjct: 91  VGGHEGAGVVVKLGSNVKGWKIGDLAGIKWLNGSCMTCEFCESGHESNC----------- 139

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PD           D+  +    +F Q+     +    I     L +   + C   T Y 
Sbjct: 140 -PDA----------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY- 187

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K A+++ GD VA+ G AG +G   VQ A   G  R++ +D  ++K++   + G   F
Sbjct: 188 KALKEADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKLGGEVF 246

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGG 266
           +    D    K +V  + E T GG
Sbjct: 247 I----DFTKTKDMVSDIQEATKGG 266

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 89.0 bits (219), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 76/279 (27%), Positives = 118/279 (42%), Gaps = 53/279 (18%)

Query: 35  EVRVKIAYTAVCHTD--AYTLSGV----DPE------GAFPSILGHEGAGIVESIGEGVT 82
           E+ + I++  +C TD   YT   +    D E         P  +GHE AG+V  +G GV 
Sbjct: 28  ELMIDISWCGICGTDLKEYTEGAIFFPNDGECHQISGEPLPQAMGHEMAGVVSRVGPGVK 87

Query: 83  NVKPGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGT 128
             K GDHV+   T  CK+              C  CK G  N+C  +    G GV   G 
Sbjct: 88  KFKVGDHVVVEPTGTCKDRYRWKNSPSKNDDMCNACKKGYYNICSKL-GLCGAGVQSGG- 145

Query: 129 TRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
                              F++  V+ +     +    PLD   L+       +  A++ 
Sbjct: 146 -------------------FAERVVMNESHCHKVPDDLPLDIAALIQPIAVCWH--ALRI 184

Query: 189 ANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKD 248
            N +KG +  V G+G +GL ++      G + I+V +    ++ +A E GAT F +PS  
Sbjct: 185 CNFKKGSSALVVGSGPIGLGIILALHGHGCTDIVVSEPAKIRRDFAKELGATVF-DPSS- 242

Query: 249 LKDGKTIVDMLVEMTDG--GLDYTFDCTGNTDVMRSALE 285
           L   +  +  L  +  G  G DYTFDC+GN     +++E
Sbjct: 243 LPTHEESIKYLRSIAPGGDGFDYTFDCSGNQYTFNASIE 281

>Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON}
           (21043..22185) [1143 nt, 381 aa]
          Length = 380

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 109/249 (43%), Gaps = 31/249 (12%)

Query: 21  LTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPSILGHEGAGIVESIGE 79
           L   +I V  PK++E+ + + Y+ VCHTD +   G  P     P + GHEGAG+V  IGE
Sbjct: 51  LKYTDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGAGVVVGIGE 110

Query: 80  GVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGED 138
            V   K GD   I      C  C+ C++G    C                      +  D
Sbjct: 111 NVKGWKLGDLAGIKWLNGSCMSCELCETGHEANC----------------------EHAD 148

Query: 139 ILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVA 198
           +  +    +F QY     V    I   + L +   + C   T Y  A+KTAN++ G+ VA
Sbjct: 149 LSGYTHDGSFQQYATADAVQAARIPEGSDLAQIAPILCAGITVY-KALKTANLKPGEWVA 207

Query: 199 VFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVD 257
           + G AG +G   VQ AK  G  R++ +D  ++K++     G   FV    D    K IV 
Sbjct: 208 ISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKEKLFRSLGGEVFV----DFTKSKDIVA 262

Query: 258 MLVEMTDGG 266
            +   T GG
Sbjct: 263 DIQNATKGG 271

>Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W
           (SOR1) - sorbitol-induced sorbitol dehydrogenase [contig
           381] FULL
          Length = 356

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 115/396 (29%), Positives = 166/396 (41%), Gaps = 63/396 (15%)

Query: 1   MSEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDA-YTLSGVDPE 59
           MS+  P   L  V     +   + E+    P  H V+V I  T +C +D  Y  SG    
Sbjct: 1   MSQSNPAVVLRKVGDIGIENRPVPEL----PNEHYVKVAIKATGICGSDIHYYKSG--SI 54

Query: 60  GAF----PSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSV 115
           G +    P +LGHE +G V  +G  V ++K GD V        +     K G+ NLC  +
Sbjct: 55  GKYVVNQPMVLGHESSGEVVEVGSAVRSIKVGDRVAIEPGVPDRYSDETKQGRYNLCPDM 114

Query: 116 RATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCL-- 173
                  +  DGT                      Y   AD  V   D  +  +  C+  
Sbjct: 115 AFAATPPI--DGT------------------LVKYYVSPADFLVKLPDHVSFEEGACIEP 154

Query: 174 LGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQW 233
           L  GV      A K A V  G  V VFGAG VGL     AK  GAS +I VD+ D K + 
Sbjct: 155 LSVGVH-----ANKLAKVHFGSVVVVFGAGPVGLLTGAVAKAFGASEVIYVDVFDNKLER 209

Query: 234 ANEFGATDFVNPSKDLK--DGKTIVDMLVEMTDGGL-DYTFDCTGNTDVMRSALEACHKG 290
           A  FGAT  +N SK L   +G  +   +     G L D  F+C+G    + S + +   G
Sbjct: 210 AKGFGATHTIN-SKSLPRGEGDAVSAAVSNYLGGALADVVFECSGAEPCINSGVLSTKNG 268

Query: 291 WGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMD-------G 343
            G  + IG+   GK     P   V+G+  + S  G    R   G    DY D       G
Sbjct: 269 -GTMVQIGM---GKNYINFPLAEVSGK--EMSVIGCF--RYSFG----DYRDAVRLVATG 316

Query: 344 KLKVDEFITHRRGFTDINSAFED--LHHGDCLRTVL 377
           +++V + IT+R  F D  +A++    + G+ ++T++
Sbjct: 317 QVEVKKMITNRFKFEDAAAAYDYNIANGGEVVKTII 352

>YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}
           SOR2Protein of unknown function; protein sequence is 99%
           identical to the Sor1p sorbitol dehydrogenase;
           computational analysis of large-scale protein-protein
           interaction data also suggests a role in fructose or
           mannose metabolism
          Length = 357

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 107/361 (29%), Positives = 155/361 (42%), Gaps = 55/361 (15%)

Query: 34  HEVRVKIAYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESIGEGVTNVKPG 87
           H V++ I  T +C +D   Y   G+   G +    P +LGHE +G V  +G+ VT VK G
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAVTRVKVG 87

Query: 88  DHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCST 147
           D V        +     K G  NLC  +       +  DGT   +    ED L  +    
Sbjct: 88  DRVAIEPGVPSRYSDETKEGSYNLCPHMAFAATPPI--DGTLVKYYLSPEDFL--VKLPE 143

Query: 148 FSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGL 207
              Y   A      ++P         L  GV +      K A V+ G  V VFGAG VGL
Sbjct: 144 GVSYEEGA-----CVEP---------LSVGVHSN-----KLAGVRFGTKVVVFGAGPVGL 184

Query: 208 SVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKD-GKTIVDMLVEMTDGG 266
                A+  GA+ +I VD+ D K Q A +FGAT+  N S+   D  + + D + ++  G 
Sbjct: 185 LTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADGVQKLLGGN 244

Query: 267 -LDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAFG 325
             D  F+C+G  DV   A     K  G  + +G+   GK  +  P   V+G+  K    G
Sbjct: 245 HADVVFECSG-ADVCIDAAVKTTKVGGTMVQVGM---GKNYTNFPIAEVSGKEMK--LIG 298

Query: 326 GIKGRSEMGGLISDYMD-------GKLKVDEFITHRRGFTDINSAFED--LHHGDCLRTV 376
               R   G    DY D       GK+ V   ITH+  F D   A++    H G+ ++T+
Sbjct: 299 CF--RYSFG----DYRDAVNLVATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTI 352

Query: 377 L 377
           +
Sbjct: 353 I 353

>Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON}
           (51276..52337) [1062 nt, 354 aa]
          Length = 353

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 121/284 (42%), Gaps = 35/284 (12%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE    L  +++ V  PK  E+ + + Y+ VCHTD +   G  P +   P 
Sbjct: 9   PKTQKGVIFYENNGELQYKDLPVPQPKPTELLIHVLYSGVCHTDLHAWKGDWPLDTKLPL 68

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V  +G  V   K GD   I      C  C+ C+    + C           
Sbjct: 69  VGGHEGAGVVVGMGSSVKGWKMGDLAGIKWLNGSCMNCEECELSNESNC----------- 117

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+     +   G          +F QY     V    I   A + +   + C   T Y 
Sbjct: 118 -PEADLSGYTHDG----------SFQQYATADAVQAAHIPQGADMAEVAPILCAGVTVY- 165

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+A ++ GD VA+ G AG +G   VQ AK  G  R++ +D  D+K+++    G   F
Sbjct: 166 KALKSAELKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGDEKEKFFKSMGGEVF 224

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEA 286
           V    D    K IV  + E T+GG      C  N  V   A+EA
Sbjct: 225 V----DFMTCKDIVGAVKEATNGG---AHGCI-NVSVSEKAIEA 260

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 122/305 (40%), Gaps = 51/305 (16%)

Query: 35  EVRVKIAYTAVCHTDAYTLS---------GVDPE---GAFPSILGHEGAGIVESIGEGVT 82
           E+ + I +  +C TD +  +         G   E      P  +GHE AGIV  +G GVT
Sbjct: 28  ELLIDIIFCGICGTDLHEYTDGPIFFPSDGHKHEISNNELPQAMGHEMAGIVREVGSGVT 87

Query: 83  NVKPGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGT 128
             K GDHV    T  C++              C  CK G  N+C  +    G GV   G 
Sbjct: 88  QFKVGDHVSVEPTGTCRDRYRWPEAPGVNKEKCAACKRGMYNVCSHL-GLIGNGVQSGG- 145

Query: 129 TRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
                              F++  V+ +     +    P++   L+     + +  AV+ 
Sbjct: 146 -------------------FAERVVINESHCYKLPNHIPMEVVALVQPIAVSWH--AVRV 184

Query: 189 ANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKD 248
           +  + G +V + G G +GLS +      G + I+V +    ++  A + GA  +      
Sbjct: 185 SKFKPGSSVLILGGGPIGLSTILALNGHGCTEIVVSEPAKIRRDLAEKMGAVVYDPMQHS 244

Query: 249 LKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEIST 308
            ++    +  L    D G DY FDC+G    +RS++E C    G ++ + + A GK I  
Sbjct: 245 YEENIKYLRALAPDKD-GFDYCFDCSGTPATLRSSIE-CLTFRGTAVNVAMWATGKPIDF 302

Query: 309 RPFQL 313
            P  +
Sbjct: 303 FPMDI 307

>KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 77/264 (29%), Positives = 116/264 (43%), Gaps = 31/264 (11%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSG-VDPEGAFPS 64
           P T  A +  E G  L  ++I V  PK++E+ + + Y+ VCH+D +   G +      P 
Sbjct: 7   PKTQKAIIFSEVGGKLEYKDIPVPVPKSNELLINVLYSGVCHSDLHIWQGDLPLPLKLPL 66

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V  +G  V   K GD+  I      C  C+FC+      C     T   G 
Sbjct: 67  VGGHEGAGVVVGMGSNVKGWKLGDYAGIKFLNGTCNACEFCEQSFEISCPHADFT---GT 123

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
           + DG                   +F QY     V    I     L     L C   T Y 
Sbjct: 124 VHDG-------------------SFQQYATADAVQAARIPQGTDLAAIAPLLCAGLTAY- 163

Query: 184 AAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN++ G  VA+ GA G +G   +Q A   G  R++ +D  ++K ++    G   F
Sbjct: 164 KALKSANMRPGQWVAISGACGGLGTYAIQYATAMG-YRVLGIDSGEEKAKYFKTLGGEVF 222

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGG 266
           +    D K  K +V  +++ TDGG
Sbjct: 223 I----DYKKSKDVVADVIKATDGG 242

>ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 348

 Score = 86.7 bits (213), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 84/302 (27%), Positives = 129/302 (42%), Gaps = 38/302 (12%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A +  E   PL  ++I V  PK +E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKAVIFSENNGPLEYKDIPVPKPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG V ++G  V N K GD   I      C  C+ C+    + C           
Sbjct: 64  VGGHEGAGEVVALGSDVKNWKIGDLAGIKWLNGSCMSCEACEQSHESNC----------- 112

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PD     +   G          +F QY     V    I     L +   + C   T Y 
Sbjct: 113 -PDADLSGYTHDG----------SFQQYATADAVQAAHIPAGTNLAEVAPVLCAGITVY- 160

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN++ G  VA+ G AG +G   VQ A+  G  R++ +D    K++     G   F
Sbjct: 161 KALKSANLKAGQWVAISGAAGGLGSLAVQYARAMGL-RVLGIDGGPGKEELFKTLGGECF 219

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHK---GWGESIIIGV 299
           ++ +K+      I + +++ T+GG         N  V   A+ A  K     G S+++G+
Sbjct: 220 IDFTKE----HDIAEAVIKATNGGAHGVI----NVSVSEGAISASTKYVRSCGTSVLVGM 271

Query: 300 AA 301
            A
Sbjct: 272 PA 273

>Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 86.3 bits (212), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 74/280 (26%), Positives = 123/280 (43%), Gaps = 55/280 (19%)

Query: 35  EVRVKIAYTAVCHTDAYTLSG------VDPE------GAFPSILGHEGAGIVESIGEGVT 82
           EV + +++  +C +D +  S        D E         P  +GHE +GI+  +G  VT
Sbjct: 28  EVILDVSWCGICGSDLHEYSDGPIFMPKDGECHSLSNAGLPQAMGHEMSGIIAKVGPKVT 87

Query: 83  NVKPGDHVIALYTAEC--------------KECKFCKSGKTNLCGSVRATQGKGVMPDGT 128
            VK GDHV+    + C              K C  CK G  NLC       G GV+  G 
Sbjct: 88  KVKVGDHVVVQAGSSCADLHCWPHSKHYNSKPCDACKKGCENLCTHA-GFIGLGVISGG- 145

Query: 129 TRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
                              F++  V+++  ++ +  + PLD   L+     T +  AV+ 
Sbjct: 146 -------------------FAEQVVVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVRL 184

Query: 189 ANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKD 248
           +  +KG +  V GAG +GL  +   K  GA +I+V ++ +++ + A   G   F +P   
Sbjct: 185 SGFKKGSSALVLGAGPIGLCTILVLKGMGAGQIVVSEVAERRMELARRLGVEIF-DPR-- 241

Query: 249 LKDGKTIVDMLVEMTDG--GLDYTFDCTGNTDVMRSALEA 286
            K G+  V+ L  +T    G DY++DC+G      ++L+A
Sbjct: 242 -KHGEKSVESLRALTKSHDGFDYSYDCSGIQATFDASLKA 280

>KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 85.9 bits (211), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 77/297 (25%), Positives = 122/297 (41%), Gaps = 32/297 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A V  E G  L   +I V   KA+E+ + + Y+ VCH+D Y      P     P 
Sbjct: 17  PKTQKAMVFSEYGGDLEYRDIPVPTKKANEILINVKYSGVCHSDLYVWKNRTPMTSKLPL 76

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V  +G  V N K GD   +    + C  C+ C+ G    C     ++  G 
Sbjct: 77  VGGHEGAGVVVGMGSNVKNWKIGDKAGVKWLNSTCMTCEHCELGNEPSC---LKSEYNGF 133

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
             +G                   +F QY  +  +    +     L +     C   T Y 
Sbjct: 134 TRNG-------------------SFQQYVAVDAIHAPRLPDNCDLAELAPASCAGVTVY- 173

Query: 184 AAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K+AN++ G  +A+ GA G +G   +Q  K  G  R++ +D  + K     E G   F
Sbjct: 174 KAIKSANIRAGQWMAITGACGGLGSVAIQYCKAMG-YRVVGIDAGEAKANLFKELGGEVF 232

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGV 299
           +    D    K +V  +V  T+GG           D + ++++      G  +I+ V
Sbjct: 233 I----DFTKSKDLVADVVSATNGGAHGVLSIAATEDAINTSVKYVRSN-GTCVIVSV 284

>Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {ON}
           YLR070C (REAL)
          Length = 356

 Score = 85.5 bits (210), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 99/364 (27%), Positives = 166/364 (45%), Gaps = 46/364 (12%)

Query: 28  VDPPK---AHEVRVKIAYTAVCHTDA-YTLSGVDPEGAF--PSILGHEGAGIVESIGEGV 81
           V+ PK   A++V V+I  T +C +D  Y   G         P +LGHE +G+V  IG+ V
Sbjct: 23  VNIPKISDANDVIVQIKATGICGSDIHYYTHGRISHFVVKSPMVLGHESSGVVVLIGDNV 82

Query: 82  TNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGT-TRFHNKKGEDIL 140
             +K GD V        +     K G+ NL   ++         DGT T+++    + + 
Sbjct: 83  KTLKVGDRVALEPGFPNRFSSELKEGRYNLDPDLKFAATPPY--DGTLTKYYRAPKDFVY 140

Query: 141 HFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVF 200
                 +F +  ++  +SV                         A + A ++ G    VF
Sbjct: 141 KIPDHVSFEEGALMEPLSVAV----------------------HANRLAKMRFGARCVVF 178

Query: 201 GAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLV 260
           GAG VGL   + A V GA+ ++ VD+++ K + A +FGAT  VN S DL  G +   ++ 
Sbjct: 179 GAGPVGLLTGKVASVFGATDVVFVDLSETKLERAKQFGATHMVN-SGDLPQGVSAETVIR 237

Query: 261 E-MTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGR-- 317
           + +   G D  F+C+G    +R+ +E C  G G  + +G+   G+E    P   +  +  
Sbjct: 238 KAIGKKGADVVFECSGAQPCIRTGIEVCKAG-GTYVQVGM---GQEEIQFPISKIPAKEI 293

Query: 318 VWKGSAFGGIKG-RSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDL--HHGDCLR 374
            ++GS F   +G  S+   L+S    GKL +   IT R  F +   AF++   H  D ++
Sbjct: 294 TFQGS-FRYCQGDYSDSIELVS---SGKLSLKPLITRRYQFKEAIEAFDENRDHPLDNVK 349

Query: 375 TVLD 378
           T+++
Sbjct: 350 TIIE 353

>KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON}
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 356

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 110/246 (44%), Gaps = 27/246 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P+T  A +  +    L ++ I V  PKA+E+ + + ++ VCH+D +   G  P +   P 
Sbjct: 10  PLTQRAVIFKKHSGKLELKSIEVQSPKANELLINVKFSGVCHSDLHAWKGDWPTKTKLPL 69

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAGIV ++G  V   K GD+  I    + C  C+ C+      C           
Sbjct: 70  VGGHEGAGIVVAMGASVRGWKIGDYAGIKWLNSCCMSCEQCELSNEPNCAYA-------- 121

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         DI  F    +F QY     V    I P   L +   + C   T + 
Sbjct: 122 --------------DISGFTRDGSFQQYATADAVQAARIPPGTNLAEVSPVLCAGITVF- 166

Query: 184 AAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+KTAN+  G+ VA+ GA G +G   +Q AK  G S ++ +D   +K+   N+ G   F
Sbjct: 167 KALKTANLTAGNWVAISGACGGLGSMAIQYAKAMGYS-VVGIDSGAEKEHLFNDLGGDVF 225

Query: 243 VNPSKD 248
           ++ SK 
Sbjct: 226 LDFSKS 231

>TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16
           YLR070C
          Length = 353

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 84/292 (28%), Positives = 130/292 (44%), Gaps = 45/292 (15%)

Query: 12  AVAYEAGKPLTIEEIVVDPPK-AHEVRVKIAYTAVCHTDAYTLSGVDPEGAF-------P 63
           AV  E  + + IE   +   K  H+V+++I  T +C +D +  +    +G+        P
Sbjct: 6   AVVLEKKELIQIESRPIPEIKNPHDVKIQIKATGICGSDVHYFT----QGSIGDFVVKSP 61

Query: 64  SILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
            +LGHE AG+V  +G+ V++VK GD V        +  K   SG  NLC  +        
Sbjct: 62  LVLGHESAGVVVEVGDAVSSVKVGDRVAVEPGVPSRYSKETMSGHYNLCPHMAFAATPPY 121

Query: 124 MPDGTTRFHNKKGEDILHFMGCS-TFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGY 182
             DGT   +    ED ++ +    +F +  V+  +SV                       
Sbjct: 122 --DGTLVKYYLSPEDFVYKLADHISFEEGAVVEPLSVAV--------------------- 158

Query: 183 GAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
             A + AN   G  V V GAG VGL     AK  GA+ ++ VDI + K + A +FGAT  
Sbjct: 159 -HANRLANTAFGQAVLVLGAGPVGLLAGAVAKAFGATDVVFVDIFESKLEKAKQFGATRT 217

Query: 243 V--NPSKDLKDGKTIVDMLVEMTDGGL--DYTFDCTGNTDVMRSALEACHKG 290
           V   P  D  D    +  LV  + GGL  D  F+C+G    +R+A+++  +G
Sbjct: 218 VLFKPDSDEND----LVSLVTKSLGGLHPDVVFECSGAEKCIRAAVKSVKRG 265

>NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/296 (25%), Positives = 132/296 (44%), Gaps = 60/296 (20%)

Query: 22  TIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSG----------VDPEG--AFPSILGHE 69
           T+ E  ++ P   EV ++++Y  +C TD +  +            +P      P  +GHE
Sbjct: 17  TLPEPKINSPD--EVLIEVSYCGICGTDLHEYTDGPIFFPKDGETNPLSNIPLPQPMGHE 74

Query: 70  GAGIVESIGEGVTNVKPGDHVIALYTAECKE-----------------CKFCKSGKTNLC 112
            +G V++IG  VT V+ GD V+      CK+                 C  C++G  N C
Sbjct: 75  FSGFVKAIGSNVTKVEVGDKVVVEAGCGCKDVHRWPDSKLYEKRKDTFCSACENGIDNCC 134

Query: 113 GSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTC 172
            +   T G GV+                       F++  V+ +  +V +  + P D   
Sbjct: 135 ENYDFT-GLGVV--------------------GGAFAERVVVGERHIVKLPEEVPTDVGA 173

Query: 173 LLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQ 232
           L+   ++  +  AV+ +  +KG +  + GAG +GL+ +   K  GAS+I+V ++ ++++ 
Sbjct: 174 LVE-PISVAW-HAVRVSKFEKGKSALILGAGPIGLAAILALKAHGASKIVVSELAERRRI 231

Query: 233 WANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG--GLDYTFDCTGNTDVMRSALEA 286
            A++ G   F +PS   K G   V  L  +  G  G DY FDC+G      +AL+A
Sbjct: 232 LASKMGVEVF-DPS---KHGDNAVTELRNIPRGQHGFDYAFDCSGVKATFNTALKA 283

>ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3
          Length = 373

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 99/370 (26%), Positives = 154/370 (41%), Gaps = 41/370 (11%)

Query: 18  GKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPSILGHEGAGIVES 76
           G  L  E++ V  P ++EV + + Y+ VCHTD +T  G  P +   P + GHEGAG+V +
Sbjct: 39  GPLLYREDLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVVA 98

Query: 77  IGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKK 135
            G+ V   + GD   +    + C  C+ C+ G    C      +  G   DG        
Sbjct: 99  KGKDVKTFEIGDLAGVKQLVSSCMGCESCEIGHEFGC---EQAEMSGSSHDG-------- 147

Query: 136 GEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGD 195
                      TF QY  +  +    +     L     + C   + Y  A+K  N+Q   
Sbjct: 148 -----------TFQQYVAIDALQAPPLPANVDLAAVAPIFCAGVSVY-KALKNGNLQTNQ 195

Query: 196 TVAVFGA-GTVGLSVVQGAKVRGASRIIVVD-INDQKKQWANEFGATDFVNPSKDLKDGK 253
            VA+FGA G +G   VQ AK  G  R++ +D   +++KQ  +  G   F+    D     
Sbjct: 196 WVAIFGATGGLGSIAVQYAKAMG-YRVLGIDGPGEERKQLFHSLGGEVFL----DYTQVD 250

Query: 254 TIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQL 313
            I   + + T GG     + T +       ++ C +  G  + +GV      + T  F +
Sbjct: 251 NIPAAVKQATQGGAHCVLNVTASLAAYDQTIK-CVRPLGTVVPVGVPPDSGLLKTDIFTI 309

Query: 314 VT-GRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGDC 372
           V  G   KGSA G    R++    +  +  G +K    I    G +++  AFE L  G  
Sbjct: 310 VQHGFSIKGSASG---SRADTREAVDFFTRGLIKSPIKIL---GLSELPKAFELLESGQT 363

Query: 373 L-RTVLDLLK 381
             R VLD  K
Sbjct: 364 TGRLVLDTSK 373

>ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR070C
           (XYL2)
          Length = 353

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 86/284 (30%), Positives = 119/284 (41%), Gaps = 38/284 (13%)

Query: 12  AVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDA-YTLSGVDPEGAF----PSIL 66
           A+ YE  +P+ + E   DP   H V+VKI  T +C +D  Y L G    G F    P +L
Sbjct: 16  AIVYE-HRPVPVIE---DP---HYVKVKIEKTGICGSDVHYYLHGSI--GPFVVRSPMVL 66

Query: 67  GHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPD 126
           GHE +G V  +G  VT V+ GD V        +  +  KSG  NLC  +R         D
Sbjct: 67  GHESSGTVVEVGSDVTRVRIGDRVAIEPGVPSRYSEETKSGHYNLCREMRFAATPPY--D 124

Query: 127 GTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAV 186
           GT   +    ED L  +  S   +   L +   VA+                      A 
Sbjct: 125 GTLVKYYISPEDFLVKLPDSVSLEEGALCEPLAVAVH---------------------AN 163

Query: 187 KTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPS 246
           + A  Q    V VFGAG VGL     AK  GA+ + +VDI+  K   A   G T  V+ S
Sbjct: 164 RLAGTQFPSRVVVFGAGPVGLLTASVAKAFGATTVAIVDISKHKLCVAPALGVTHPVD-S 222

Query: 247 KDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKG 290
            D    + + + L       +D  FDC+G    + +A+  C  G
Sbjct: 223 SDCSSPEALANKLRAELRSDVDIAFDCSGAEICIAAAVLICRPG 266

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/281 (27%), Positives = 121/281 (43%), Gaps = 54/281 (19%)

Query: 35  EVRVKIAYTAVCHTD--AYTLSGVD-PE---------GAFPSILGHEGAGIVESIGEGVT 82
           +V + I++  +C TD   YT   +  PE            P  +GHE +GI+ S+G G  
Sbjct: 28  DVIIDISWCGICGTDLKEYTDGAIFFPEDGCVNHISNNNLPQAMGHEISGIISSVGPGCK 87

Query: 83  NVKPGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGT 128
             K GDHV+   TA C +              C+ C++G  N+C  +  T G GV   G 
Sbjct: 88  KFKIGDHVVVEPTATCIDRYRWPNAPNRDTPMCEACRNGMPNICKYLGLT-GAGVEGGG- 145

Query: 129 TRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
                              F++  V+ +     I    PLD   L+       +  AVK 
Sbjct: 146 -------------------FAEKMVINEHHCHKIPHHMPLDVASLIQPISVCWH--AVKV 184

Query: 189 ANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKD 248
           ++ ++G +V + G G +GL  +   K  G   I+V +    +++ A + GA  F +PS  
Sbjct: 185 SHYKQGGSVLIVGGGPIGLGTILALKGFGCEDIVVSEPALIRRELAEKMGARVF-DPSNM 243

Query: 249 LKDGKTIVDMLVEMTDG--GLDYTFDCTGNTDVMRSALEAC 287
             D    +  L EM  G  G DYTFDC+G    ++ A+E C
Sbjct: 244 SLDNS--IKTLTEMAPGSQGFDYTFDCSGIPATLKVAIECC 282

>TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {ON}
           Anc_7.2 YAL061W
          Length = 382

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 78/278 (28%), Positives = 114/278 (41%), Gaps = 56/278 (20%)

Query: 35  EVRVKIAYTAVCHTDAYTLS----------GVDPEGA--FPSILGHEGAGIVESIGEGVT 82
           EV +++++  +C TD +  S          G  P      P  +GHE +GIV  IG  VT
Sbjct: 28  EVLIEVSWAGICGTDLHEYSDGPIFMPQDGGSHPLSGKKLPQPMGHEMSGIVSKIGSKVT 87

Query: 83  NVKPGDHVIALYTAEC--------------KECKFCKSGKTNLCGSVRATQGKGVMPDGT 128
            VK GDHV+      C              K C  C+ G  N+C     T G G    G 
Sbjct: 88  KVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTCSACEKGLVNICAHACFT-GLGTSGGG- 145

Query: 129 TRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
                              F++   ++    + I    PLD   L+     T + A  K 
Sbjct: 146 -------------------FAERLTVSQDHCIPIPKDLPLDVAALVEPLSVTWHAA--KV 184

Query: 189 ANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKD 248
           A  QKG T  V GAG +GL+ +   K  GAS+I+V ++   ++  A   G   F NP++ 
Sbjct: 185 AGFQKGQTACVLGAGPIGLATILTLKGLGASKIVVSELAQIRRDMAASMGVEVF-NPAEH 243

Query: 249 LKDGKTIVDMLVEMTDG--GLDYTFDCTGNTDVMRSAL 284
               K  +  L ++ +G  G D  FDC+G      +AL
Sbjct: 244 ----KDAIAELRKIPEGATGFDAAFDCSGVKATFNTAL 277

>SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]
           {ON} similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 385

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 130/307 (42%), Gaps = 56/307 (18%)

Query: 10  LAAVAYEAGKPLTIEEIVVDP--PKAHEVRVKIAYTAVCHTDAYTLSG---VDPE----- 59
           + A+AY   K +   + + +P      ++ + IA+  +C TD +  +      PE     
Sbjct: 1   MRALAYFGQKDIRFTDELPEPVISADDDLIIDIAWCGICGTDLHEYTDGPIFFPEDGHTH 60

Query: 60  ----GAFPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAEC--------------KEC 101
                  P  +GHE AG+V  IG GV   + GDHV+   T+ C              + C
Sbjct: 61  DISGNGLPQAMGHEMAGVVSKIGPGVQGFEVGDHVVVEPTSTCLDRYRFPNSKHSGEEPC 120

Query: 102 KFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVA 161
             CK G  N+C  +    G GV   G                    FS+  V+    V+ 
Sbjct: 121 AACKRGLYNICSHL-GLCGVGVQSGG--------------------FSERVVMNQKHVIK 159

Query: 162 IDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRI 221
           I    PLD   L+     + +  A++ + +  G +  V G G +GL  +   +  GAS+I
Sbjct: 160 IPKHIPLDVAALVQPLAVSWH--AIRISGLTAGKSALVVGGGPIGLGTILALQAYGASKI 217

Query: 222 IVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG--GLDYTFDCTGNTDV 279
           +V +    +++ A   GA  F +P++   +    V+ L ++  G  G DY+FDC+G    
Sbjct: 218 VVSEPAKNRRELAKLMGAEVF-DPTE--WEEHEAVEYLRKVAPGGDGFDYSFDCSGLPVT 274

Query: 280 MRSALEA 286
            R+++ A
Sbjct: 275 FRASVHA 281

>KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {ON}
           Anc_2.480 YMR083W
          Length = 374

 Score = 83.6 bits (205), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 75/264 (28%), Positives = 112/264 (42%), Gaps = 28/264 (10%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE G  L  ++I V  PK +E+ V + Y+ VCHTD +   G  P     P 
Sbjct: 27  PQTQKGVIFYEHGGDLHYKDIPVPKPKPNEILVNVKYSGVCHTDLHAWKGDWPLSVKLPL 86

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V + G  V N + GD   I      C  C+ C+SG  + C           
Sbjct: 87  VGGHEGAGVVVAKGSNVNNFEIGDLAGIKWLNGSCMSCELCESGHESNC----------- 135

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                      +  D+  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 136 -----------EHADLSGYTHDGSFQQYATADAVQAAKIPEGTNLAEVAPVLCAGITVY- 183

Query: 184 AAVKTANVQKGDTVAVFG-AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDF 242
            A+K A++  G  V + G AG +G   VQ  K  G  R+I +D    K++     G   F
Sbjct: 184 KALKEASLSPGQWVCISGAAGGLGSLAVQYGKAMGL-RVIGIDGGPGKEELFKSLGGEVF 242

Query: 243 VNPSKDLKDGKTIVDMLVEMTDGG 266
           ++ +K   D   +V  + + T+GG
Sbjct: 243 IDFTKQKTD-SDMVAAIQKATNGG 265

>ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q07786 Saccharomyces cerevisiae YDL246C SOR2
           Protein of unknown function computational analysis of
           large-scale protein-protein interaction data suggests a
           possible role in fructose or mannose metabolism
          Length = 351

 Score = 82.8 bits (203), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 94/354 (26%), Positives = 148/354 (41%), Gaps = 45/354 (12%)

Query: 34  HEVRVKIAYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESIGEGVTNVKPG 87
           H V++ I  T +C +D   YT   +   G F    P +LGHE +GIV  +G  VTNVK G
Sbjct: 29  HYVKLHIKATGICGSDVHYYTQGAI---GQFVVKSPMVLGHESSGIVAEVGSAVTNVKVG 85

Query: 88  DHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCST 147
           D V        +      SG  NLC  +          DGT   +    ED ++ M    
Sbjct: 86  DRVAIEPGIPSRYSDETMSGNYNLCPHMVFAATPPY--DGTLTKYYLAPEDFVYKMPDHL 143

Query: 148 FSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGL 207
             +   LA+   V +                      A K A  + G  V V GAG VGL
Sbjct: 144 SFEEGALAEPMSVGVH---------------------ANKLAGTRFGSKVLVSGAGPVGL 182

Query: 208 SVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGL 267
                A+  GA+ ++ VDI ++K + + +FGAT  V+ S    D +  V  + ++  G L
Sbjct: 183 LAGAVARAFGATEVVFVDIAEEKLERSKQFGATHTVSSS---SDEERFVSEVSKVLGGDL 239

Query: 268 -DYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLV-TGRVWKGSAFG 325
            +   +C+G    +R  ++AC K  G  + +G+   GK+    P   V +  +     F 
Sbjct: 240 PNIVLECSGAQPAIRCGVKAC-KAGGHYVQVGM---GKDDVNFPISAVGSKEITFHGCFR 295

Query: 326 GIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSA--FEDLHHGDCLRTVL 377
             KG  +    ++    G++     I+HR  F     A  F   H  + ++T++
Sbjct: 296 YKKG--DFADSVALLSSGRINGKPLISHRFAFDKAPEAYKFNAEHGNEVVKTII 347

>Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {ON}
           YOL086C (ADH1) - Alcohol dehydrogenase [contig 146] FULL
          Length = 216

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 102/235 (43%), Gaps = 27/235 (11%)

Query: 6   PITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A V    G  L  ++I V  P + E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKAIVFASNGGELEYKDIPVPKPSSTEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           + GHEGAG+V ++GE V   K GD   I      C  C++C+ G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVALGENVKGWKVGDLAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
             DG                   +F QY     V    I     L +   + C   T Y 
Sbjct: 121 THDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY- 160

Query: 184 AAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEF 237
            A+K+A+++ G  VA+ GA G +G   VQ A+  G  R++ +D  D K++   E 
Sbjct: 161 KALKSADLKAGQWVAISGACGGLGSLAVQYARAMG-YRVLGIDGGDDKRKLFKEL 214

>SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]
           {ON} highly similar to gnl|GLV|KLLA0F00506g
           Kluyveromyces lactis KLLA0F00506g and similar to YAL060W
           uniprot|P39714 Saccharomyces cerevisiae YAL060W BDH1
           NAD- dependent (2R 3R)-2 3-butanediol dehydrogenase a
           zinc- containing medium-chain alcohol dehydrogenase
           produces 2 3- butanediol from acetoin during
           fermentation and allows using 2 3-butanediol as a carbon
           source during aerobic growth
          Length = 383

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 80/308 (25%), Positives = 132/308 (42%), Gaps = 58/308 (18%)

Query: 10  LAAVAYEAGKPLTIEEIVVDPP--KAHEVRVKIAYTAVCHTDAYT-LSG---VDPEG--- 60
           + A+AY   K +     +  P     +E+ + I++  +C +D +  L G      EG   
Sbjct: 1   MRALAYFGKKDIHFSADIAKPEIGADNELEIDISWCGICGSDLHEYLDGPIFFPEEGKTH 60

Query: 61  -----AFPSILGHEGAGIVESIGEGVT-NVKPGDHVIALYTAECKE-------------- 100
                  P  +GHE +GIV  +G GV  + K GDHV+   T  C +              
Sbjct: 61  GVSGIGLPQPMGHEMSGIVSKVGPGVKGDYKVGDHVVVEATCTCLDRYRWPKIESSKLPP 120

Query: 101 CKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVV 160
           C  CK G  N C  +    G G    G                    FS+  V+++  V+
Sbjct: 121 CSACKRGIYNCCTHL-GFCGLGAHGGG--------------------FSEKVVISEQHVI 159

Query: 161 AIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASR 220
            I  + PLD   L+     + +  AVK +N++ G +  V GAG +GL+ +   +  GA +
Sbjct: 160 KIPKEIPLDIAALVEPISVSWH--AVKISNLKPGQSALVLGAGPIGLATILALQGHGAGK 217

Query: 221 IIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG--GLDYTFDCTGNTD 278
           I+V +    +++ A + G   F NP    + G+  V+ L ++  G  G D++FDC+G   
Sbjct: 218 IVVSEPAQIRREQAAKLGVETF-NP---FEHGEKAVEELRKIPPGGDGFDFSFDCSGMKA 273

Query: 279 VMRSALEA 286
              + L A
Sbjct: 274 TFDTGLHA 281

>NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16
          Length = 357

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 75/264 (28%), Positives = 118/264 (44%), Gaps = 32/264 (12%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAF----PSILGHEGAGIVESIGEGVTNVKPGDH 89
           H V+V+I  T +C +D +        G F    P +LGHE +GI+  +G  V  +K GD 
Sbjct: 31  HWVKVQIKATGICGSDVH-FYKYGSIGDFVVKSPMVLGHESSGIIAEVGSAVKTLKVGDR 89

Query: 90  VIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGT-TRFHNKKGEDILHFMGCSTF 148
           V        +  +   SG  NLC  +          DGT T+++    + +       ++
Sbjct: 90  VALEPGYPSRYTEATMSGHYNLCPFMHFAATPPC--DGTLTKYYLTPFDFVYKLPDNVSY 147

Query: 149 SQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLS 208
            +  +L  +SV                 GV      A K A  + GD V VFGAG VGL 
Sbjct: 148 EEGALLEPLSV-----------------GVH-----ANKQAGTRFGDKVVVFGAGPVGLL 185

Query: 209 VVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGL- 267
               AKV GA +++ +D+ D+K + A  FGAT  +N SK   + +  + + ++   GG+ 
Sbjct: 186 NGAVAKVFGALQVVFIDVVDEKLERAKHFGATAVINSSKLRINDEFELAVAIKEKLGGVD 245

Query: 268 -DYTFDCTGNTDVMRSALEACHKG 290
            D   +CTG    +R+ + A   G
Sbjct: 246 PDIVLECTGAEPCIRAGIRALKTG 269

>TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 351

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 116/270 (42%), Gaps = 32/270 (11%)

Query: 1   MSEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP-E 59
           M+   P T  A V    G  L  ++I V  P+ +E+ + + Y+ VCHTD +   G  P  
Sbjct: 1   MTTQIPKTQKAVVFDTNGGELQYKDIPVPEPQPNELLINVKYSGVCHTDLHAWKGDWPLP 60

Query: 60  GAFPSILGHEGAGIVESIGEGV-TNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRA 117
              P + GHEGAGIV + G  V    + GD   I      C  C++C+    + C     
Sbjct: 61  TKLPLVGGHEGAGIVVAKGSMVXXGWEIGDLAGIKWLNGSCMSCEYCEKANESNCPQA-- 118

Query: 118 TQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCG 177
                               D+  +    +F QY     V    +     L +   + C 
Sbjct: 119 --------------------DLSGYTHDGSFQQYATADAVQAARVPKGTDLAEVAPILCA 158

Query: 178 VTTGYGAAVKTANVQKGDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANE 236
             T Y  A+K+AN++ G+ VA+ GA G +G   VQ AK  G  R++ +D  D+K +   +
Sbjct: 159 GITVY-KALKSANLRAGEWVAISGASGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKLFKQ 216

Query: 237 FGATDFVNPSKDLKDGKTIVDMLVEMTDGG 266
            G   F+    D    K ++  +++ TDGG
Sbjct: 217 LGGEYFI----DFTKSKDVIAEVIKATDGG 242

>KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2
           YAL061W
          Length = 385

 Score = 80.9 bits (198), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 83/347 (23%), Positives = 142/347 (40%), Gaps = 64/347 (18%)

Query: 10  LAAVAYEAGKPLTIEEIVVDP--PKAHEVRVKIAYTAVCHTDAYT--------------- 52
           + A+AY A   +   + +V+P      E+ ++I Y  +C TD +                
Sbjct: 1   MRALAYFAKGDIHFTKDLVEPKISTPDELILEINYCGICGTDLHEYIDGPIFFPEDGETN 60

Query: 53  -LSGVDPEGAFPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKE----------- 100
            LSG       P  +GHE AG V  IG  VT  K GDHV+      CK+           
Sbjct: 61  ELSG----SGLPQAMGHEIAGTVVKIGPKVTKFKVGDHVVVQPNGTCKDRYRWPHSPHVN 116

Query: 101 ---CKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADV 157
              C  CK G  N+C ++    G GV   G                     ++   + + 
Sbjct: 117 KPWCSACKKGHYNVCSNL-GLIGNGVQSGGC--------------------AERMCINES 155

Query: 158 SVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRG 217
               +    P+D   L+     + +  A+K A  ++G +V V G G +GL  +   +  G
Sbjct: 156 HCFKVPKDMPMDIAALIQPIAVSWH--AIKVARFKRGGSVLVIGGGPIGLCTLLALQGHG 213

Query: 218 ASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG-GLDYTFDCTGN 276
            S I+V +    +++ A   GAT + +PS+   + K I ++   +  G G DY FD +G 
Sbjct: 214 CSDIVVSEPAKVRRELAERMGATTY-DPSQHNTE-KNIQNLRKMILGGDGFDYVFDNSGT 271

Query: 277 TDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVT-GRVWKGS 322
            + + +A+E C    G ++ + +    K +   P  +    +++ GS
Sbjct: 272 PETLETAIE-CLTVRGTAVNVAMWPPHKRVEFSPMAVTKEEKIYTGS 317

>YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative
           medium-chain alcohol dehydrogenase with similarity to
           BDH1; transcription induced by constitutively active
           PDR1 and PDR3
          Length = 417

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 112/279 (40%), Gaps = 54/279 (19%)

Query: 35  EVRVKIAYTAVCHTDAYTLSG---VDPE---------GAFPSILGHEGAGIVESIGEGVT 82
           E+ + I +  +C TD +  +      PE            P  +GHE AG V  +G GV 
Sbjct: 28  ELVIDIEWCGICGTDLHEYTDGPIFFPEDGHTHEISHNPLPQAMGHEMAGTVLEVGPGVK 87

Query: 83  NVKPGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGT 128
           N+K GD V+   T  C++              C  CK G  N+C S     G GV   G 
Sbjct: 88  NLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWCAACKKGYYNIC-SYLGLCGAGVQSGG- 145

Query: 129 TRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
                              F++  V+ +     +    PLD   L+       +  A++ 
Sbjct: 146 -------------------FAERVVMNESHCYKVPDFVPLDVAALIQPLAVCWH--AIRV 184

Query: 189 ANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKD 248
              + G T  + GAG +GL  +      G   I+V +    +++ A + GA  + +P+  
Sbjct: 185 CEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPAKVRRELAEKMGARVY-DPTAH 243

Query: 249 LKDGKTIVDMLVEMTDG--GLDYTFDCTGNTDVMRSALE 285
               K  +D L  + DG  G DYTFDC+G    + +A++
Sbjct: 244 A--AKESIDYLRSIADGGDGFDYTFDCSGLEVTLNAAIQ 280

>NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa]
           {ON} 
          Length = 439

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 116/280 (41%), Gaps = 56/280 (20%)

Query: 35  EVRVKIAYTAVCHTDAYTLSG-------------VDPEGAFPSILGHEGAGIVESIGEGV 81
           E+ + +++  +C TD +                 +  EG  P  +GHE AG +   G GV
Sbjct: 67  EMIIDVSWCGICGTDLHEFQDGPIFFPHDGCCHEISGEG-LPQAMGHEIAGTIIECGPGV 125

Query: 82  TNVKPGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDG 127
           T  K GD V+   T  CK+              C  CK G  N+C ++    G GV   G
Sbjct: 126 TKFKVGDRVVVEPTGTCKDRYRWPNSPNVDKEPCAACKKGLYNICSNL-GLVGAGVQSGG 184

Query: 128 TTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVK 187
                               F++  V+ +     +     +D   L+     + +  AV+
Sbjct: 185 --------------------FAERLVMNERQCYKVPDHMSMDVAALIQPIAVSWH--AVR 222

Query: 188 TANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSK 247
            +  +KG +V + GAG +GL  +      G S ++V +    ++ +A + GA  + +PS 
Sbjct: 223 VSKFKKGASVLIVGAGPIGLGTILALNGHGVSEVVVSEPAKIRRDFAEKMGAIVY-DPSA 281

Query: 248 DLKDGKTIVDMLVEMTDG--GLDYTFDCTGNTDVMRSALE 285
             KD    +  L  +  G  G DY FDC+GN   +++A+E
Sbjct: 282 --KDHDESIKYLRSIAPGGDGFDYAFDCSGNPATLKAAIE 319

>Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 113/279 (40%), Gaps = 54/279 (19%)

Query: 35  EVRVKIAYTAVCHTDAYTLSG---VDPE---------GAFPSILGHEGAGIVESIGEGVT 82
           E+ + IA+  +C TD +  +      PE            P  +GHE AG V  +G GV 
Sbjct: 28  ELVIDIAWCGICGTDLHEYTDGPIFFPEDGHTHEISHNPLPQAMGHEMAGTVLEVGPGVA 87

Query: 83  NVKPGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGT 128
           ++K GD V+   T  C++              C  CK G  N+C S     G GV   G 
Sbjct: 88  HLKVGDKVVVEPTGTCRDRYRWPNSPNVSKEWCAACKKGYYNIC-SYLGLCGAGVQSGG- 145

Query: 129 TRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
                              F++  V+ +     +    PLD   L+       +  A+  
Sbjct: 146 -------------------FAERVVMNESHCYKVPDFVPLDVAALIQPLAVCWH--AISV 184

Query: 189 ANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKD 248
              + G T  + GAG +GL  +      G   I+V +    +++ A + GA  + +P++ 
Sbjct: 185 CEFKAGSTALIIGAGPIGLGTILALDAAGCKDIVVSEPAKLRRELAEKMGARVY-DPTE- 242

Query: 249 LKDGKTIVDMLVEMTDG--GLDYTFDCTGNTDVMRSALE 285
               K  +D L  + +G  G DYTFDC+G    + +A++
Sbjct: 243 -HAAKESIDYLRSIAEGGDGFDYTFDCSGLEITLNAAIQ 280

>Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 105/269 (39%), Gaps = 54/269 (20%)

Query: 35  EVRVKIAYTAVCHTDAYTLSG---VDPE---------GAFPSILGHEGAGIVESIGEGVT 82
           E+ + IA+  +C TD +  +      PE            P  +GHE AG V  +G GVT
Sbjct: 28  ELVLDIAWCGICGTDLHEYTDGPIFFPEDGHTNEISHNPLPQAMGHEMAGTVAKVGPGVT 87

Query: 83  NVKPGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGT 128
             K GD V+   T  C++              C  CK G  N+C S     G GV   G 
Sbjct: 88  QFKVGDKVVVEPTGTCRDRYRWPTSPNVDKEWCAACKRGLYNIC-SYLGLCGAGVQSGG- 145

Query: 129 TRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
                              F++  V+ +     +    PLD   L+       +  A+  
Sbjct: 146 -------------------FAERVVINESHCYKVPEFVPLDVAALIQPLAVCWH--AISV 184

Query: 189 ANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKD 248
            + + G T  + GAG +GL  +      G S I V +    +++ A + GA  F   +  
Sbjct: 185 CDFKAGSTALIIGAGPIGLGTILALNAAGCSDIAVSEPAKVRRELAEKMGARVFDPTAHA 244

Query: 249 LKDGKTIVDMLVEMTDG--GLDYTFDCTG 275
            KD    +D L  +  G  G DYTFDC+G
Sbjct: 245 AKDS---IDYLRSVAPGGDGYDYTFDCSG 270

>Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 113/279 (40%), Gaps = 54/279 (19%)

Query: 35  EVRVKIAYTAVCHTDAYTLSG---VDPE---------GAFPSILGHEGAGIVESIGEGVT 82
           E+ + IA+  +C TD +  +      PE            P  +GHE AG V  +G GV 
Sbjct: 28  ELVIDIAWCGICGTDLHEYTDGPIFFPEDGHTHEISHNPLPQAMGHEMAGTVLEVGPGVA 87

Query: 83  NVKPGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGT 128
           ++K GD V+   T  C++              C  CK G  N+C S     G GV   G 
Sbjct: 88  HLKVGDKVVVEPTGTCRDRYRWPESPNVDKEWCAACKKGYYNIC-SYLGLCGAGVQSGG- 145

Query: 129 TRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
                              F++  V+ +     +    PLD   L+       +  A+  
Sbjct: 146 -------------------FAERVVMNESHCYKVPDFVPLDVAALIQPLAVCWH--AISV 184

Query: 189 ANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKD 248
              + G T  + GAG +GL  +      G   I+V +    +++ A + GA  + +P++ 
Sbjct: 185 CEFKAGSTALIIGAGPIGLGTILALNAAGCRDIVVSEPAKLRRELAEKMGARVY-DPTEH 243

Query: 249 LKDGKTIVDMLVEMTDG--GLDYTFDCTGNTDVMRSALE 285
               +  +D L  + +G  G DYTFDC+G    + +A++
Sbjct: 244 A--ARESIDYLRSVAEGGDGFDYTFDCSGLEVTLNAAIQ 280

>KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 74.3 bits (181), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 72/272 (26%), Positives = 116/272 (42%), Gaps = 35/272 (12%)

Query: 35  EVRVKIAYTAVCHTDAYTLS------------GVDPEGAFPSILGHEGAGIVESIGEGVT 82
           E+ V +A+  +C TD +  +             V    + P  +GHE +G V  +G  VT
Sbjct: 28  ELIVDVAFCGICGTDLHEYTDGPIFMPKDGEKNVLSNKSIPQAMGHEFSGYVAKVGPKVT 87

Query: 83  NVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHF 142
            VK GD V+   T  C +       K     +  A + +    D    +          F
Sbjct: 88  KVKVGDRVVVEATCSCVDLHRWPESKHYKTPACNACKDRC---DNCCEYAG--------F 136

Query: 143 MGCST----FSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVA 198
           MG       F++  V  +  VV +    P+D   L+   ++  + AA + +    G +  
Sbjct: 137 MGLGVVGGAFAERIVTIEHHVVKLPDGFPMDVAALIE-PLSVAWHAA-RVSKFPPGKSAL 194

Query: 199 VFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDM 258
           V GAG +GL+++   K +GAS+IIV +    +++ A+      F +PS     G   V M
Sbjct: 195 VLGAGPIGLAMILVLKAQGASKIIVSEPATMRRELADRMHVETF-DPS---THGDKSVAM 250

Query: 259 LVEMT-DG-GLDYTFDCTGNTDVMRSALEACH 288
           L   T DG G D+ FDC+G      + L+A H
Sbjct: 251 LRSKTFDGKGFDFAFDCSGVPATFNTGLQAAH 282

>NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa]
           {ON} 
          Length = 386

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 120/282 (42%), Gaps = 55/282 (19%)

Query: 35  EVRVKIAYTAVCHTDAYT-LSG---VDPEGA--------FPSILGHEGAGIVESIGEGVT 82
           E+ + +A+  +C +D +  L G   +  +G+         P  +GHE  G V++IG  VT
Sbjct: 28  EILIDVAWCGICGSDLHEYLDGPIFMPQDGSTHPLSNQPLPQPMGHEFCGFVKAIGNKVT 87

Query: 83  NVKPGDHVIALYTAECK--------------ECKFCKSGKTNLCGSVRATQGKGVMPDGT 128
            V  GD V+      CK              +C  C+ G  N C     T G GV+    
Sbjct: 88  KVAVGDKVVVEAGCGCKDVHRWPQSHVYGKEQCTACRKGFDNCCTHAGFT-GLGVV---- 142

Query: 129 TRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
                              F++  V+ +  VV +  + P D   L+       +  AVK 
Sbjct: 143 ----------------GGAFAEQVVVGERHVVKLPEEVPTDVGALVEPLSVAWH--AVKV 184

Query: 189 ANVQKGD--TVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPS 246
           A  +KG      V GAG +GL+ +   K  GAS+I+V ++   +++ A + G   F +PS
Sbjct: 185 AGFEKGSGKNALVLGAGPIGLATILALKAHGASKIVVSELAAIRRELALKMGVEVF-DPS 243

Query: 247 K--DLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEA 286
           K  D K G   +  + E  D G D+ FDC+G      +AL +
Sbjct: 244 KHGDEKQGIKKLREIPEDHD-GFDFAFDCSGVETTFNTALHS 284

>KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {ON}
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 96/358 (26%), Positives = 154/358 (43%), Gaps = 47/358 (13%)

Query: 33  AHEVRVKIAYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGIVESIGEGVTNVKP 86
           +H V++ +  T +C +D   YT   +   G F    P +LGHE +G+V  +G+ VT V+ 
Sbjct: 29  SHYVKIHVKKTGICGSDIHYYTHGSI---GEFVVKKPMVLGHESSGVVVEVGKDVTLVQV 85

Query: 87  GDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCS 146
           GD V        +     KSG  NLC  +          DGT   +    ED L      
Sbjct: 86  GDRVAIEPGVPSRYSDETKSGHYNLCPHMAFAATPPY--DGTLVKYYLAPEDFL------ 137

Query: 147 TFSQYTVLADVSVVAIDPKAPLDKTCL--LGCGVTTGYGAAVKTANVQKGDTVAVFGAGT 204
                       V   D  +  +  C   L  GV      A + A    G  V VFGAG 
Sbjct: 138 ------------VKLPDHVSFEEGACAEPLAVGV-----HANRLAETSFGKNVVVFGAGP 180

Query: 205 VGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTD 264
           VGL     A   GAS ++ VD+ + K + + +FGAT+ +N +K   + +    +  E+  
Sbjct: 181 VGLVTGAVAAAFGASAVVYVDVFENKLERSKDFGATNTINSTKYKSEDELTEVIKSELKG 240

Query: 265 GGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWK--GS 322
              +   DC+G    +R+A++   K  G  + +G+   GK+    P  ++  +  +  GS
Sbjct: 241 EQPEIAIDCSGAEICIRTAIKVL-KAGGSYVQVGM---GKDNINFPIAMIGAKELRVLGS 296

Query: 323 AFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFE-DLHHG-DCLRTVLD 378
                        LIS   +GK+ V + ITH   F +   A+  +L HG + ++T++D
Sbjct: 297 FRYYFNDYKIAVKLIS---EGKVNVKKMITHTFKFEEAIDAYNFNLEHGSEVVKTMID 351

>YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}
           ZTA1NADPH-dependent quinone reductase, GFP-tagged
           protein localizes to the cytoplasm and nucleus; has
           similarity to E. coli quinone oxidoreductase and to
           human zeta-crystallin
          Length = 334

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 132/324 (40%), Gaps = 74/324 (22%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTNVKPGDHVIAL 93
            E+ +K  YT V + ++Y   G+ P    P +LG E +G V + G+GVTN + GD V   
Sbjct: 36  EELLIKNKYTGVNYIESYFRKGIYPCEK-PYVLGREASGTVVAKGKGVTNFEVGDQV--- 91

Query: 94  YTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTV 153
                                                           ++  STF+QY+ 
Sbjct: 92  -----------------------------------------------AYISNSTFAQYSK 104

Query: 154 LADVSVVAIDPKAPLDKTCLLGCG----VTTGYGAAVKTANVQKGDTVAVFGA-GTVGLS 208
           ++    V   PK   D+   L       V T      +  +V+KGD V +F A G VGL 
Sbjct: 105 ISSQGPVMKLPKGTSDEELKLYAAGLLQVLTALSFTNEAYHVKKGDYVLLFAAAGGVGLI 164

Query: 209 VVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG-GL 267
           + Q  K++GA  I V    D+K + A E+GA   +N SK+      I+  +++ T+G G+
Sbjct: 165 LNQLLKMKGAHTIAVAS-TDEKLKIAKEYGAEYLINASKE-----DILRQVLKFTNGKGV 218

Query: 268 DYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGI 327
           D +FD  G  D    +L A  +   + + +    A   I   PF +      + S     
Sbjct: 219 DASFDSVGK-DTFEISLAALKR---KGVFVSFGNASGLIP--PFSIT-----RLSPKNIT 267

Query: 328 KGRSEMGGLISDYMDGKLKVDEFI 351
             R ++ G I+D  + K   DEF 
Sbjct: 268 LVRPQLYGYIADPEEWKYYSDEFF 291

>TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {ON}
           Anc_7.3 YAL060W
          Length = 392

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 121/281 (43%), Gaps = 54/281 (19%)

Query: 35  EVRVKIAYTAVCHTD--AYTLSGV--DPEGA--------FPSILGHEGAGIVESIGEGVT 82
           E+ + ++Y  +C TD   YT   +   P+G          P  +GHE +G+VE +G+G  
Sbjct: 28  ELIIAVSYCGICGTDLKEYTEGAIFFPPDGGHNEISGNGLPQAMGHEISGVVEKVGKGCK 87

Query: 83  NVKPGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGT 128
             K GDHV+   T  CK+              C  C  G TN+C  + A  G G+   G 
Sbjct: 88  TFKVGDHVVVEPTGTCKDRYRWPESQNANKPMCSACSIGMTNICAHL-ALCGAGLESGG- 145

Query: 129 TRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
                              F++  V+ +  V  I    PLD   L+       +  AVK 
Sbjct: 146 -------------------FAERLVINEAHVHKIPDHMPLDIGALIQPISVCWH--AVKV 184

Query: 189 ANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKD 248
           A+ +KG +  + G G +GL  +   K  G   I++ +    ++++A + GA  + +P+  
Sbjct: 185 AHYKKGGSALIIGGGPIGLGTILALKGFGCEYIVLSEPATIRREYAGKMGAKVY-DPTGV 243

Query: 249 LKDGKTIVDMLVEM--TDGGLDYTFDCTGNTDVMRSALEAC 287
             D    V  L EM     G DYTFDC+G    + +A+E C
Sbjct: 244 PFDES--VKTLREMGPNGDGFDYTFDCSGLPITLNAAIECC 282

>KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3
           YAL060W
          Length = 381

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 82/308 (26%), Positives = 140/308 (45%), Gaps = 35/308 (11%)

Query: 35  EVRVKIAYTAVCHTDAYT-LSGV-----DPEG------AFPSILGHEGAGIVESIGEGVT 82
           E+ + ++Y  +C +D +  L G      D E       + P  +GHE +GIV  +G+ VT
Sbjct: 28  EIIIDVSYCGICGSDLHEYLEGPIFMPKDNETNEISNLSLPLAMGHEMSGIVREVGKNVT 87

Query: 83  NVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHN---KKGEDI 139
            VK GD V+   ++ C +     +GK           G+   P+    + N     G   
Sbjct: 88  KVKKGDKVVVEASSACSDVHRFATGK---------HYGEEKCPNCARGYDNCCAYAGFTG 138

Query: 140 LHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAV 199
           L F+G   F++  ++ +  +V I  + PLD   L+     T + A  K     KG T  +
Sbjct: 139 LGFIG-GGFAEQILVGEQHIVRIPDEIPLDVAALVEPLSVTWHAA--KVGKFVKGSTALI 195

Query: 200 FGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDML 259
            G+G +GL+++   K  GAS+I+V ++   +++ A +     F +PS   K+    + +L
Sbjct: 196 LGSGPIGLAMILVLKALGASKIVVSEVAQVRRKLAEKMKVEVF-DPSVHGKNTSNELRLL 254

Query: 260 VEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVW 319
            E  D G D+ FDC+G    M +A+   H       I+ VA  G   ST  F ++   + 
Sbjct: 255 TENKD-GFDFAFDCSGLEVTMNTAI---HATKCRGTIVNVAVWG---STMEFNMMDITLQ 307

Query: 320 KGSAFGGI 327
           + +  G I
Sbjct: 308 EKTLIGSI 315

>Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {ON}
           YBR046C (ZTA1) - 1:1 [contig 184] FULL
          Length = 346

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 107/262 (40%), Gaps = 64/262 (24%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTNVKPGDHVIAL 93
           +E+ +K  YT +   ++Y   G+ P    P +LG E +G V + G+ V+           
Sbjct: 47  NEILIKNKYTGINFIESYFRKGIYPSQK-PYVLGREASGTVVAKGKAVS----------- 94

Query: 94  YTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTV 153
                         K NL                          D + ++   TF+QYT 
Sbjct: 95  --------------KFNLA-------------------------DKVAYLSAGTFAQYTK 115

Query: 154 LADVSVVAIDPKAPLDKTCLLGCG----VTTGYGAAVKTANVQKGDTVAVFGA-GTVGLS 208
           +A+   ++  P+   DK   L       V T    A +   V+KGD V ++ A G VGL+
Sbjct: 116 IAETGHISKLPENTTDKQLELYAASLVQVLTALTFAKEAYTVKKGDFVLLYAAAGGVGLA 175

Query: 209 VVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG-GL 267
             Q  K  GA  I V    D+K Q A EFGA   VN SK+      ++  ++E+T G G+
Sbjct: 176 FNQILKRLGAHTIAVAS-TDEKLQLAKEFGAEYLVNSSKE-----DVLARVLEITQGQGV 229

Query: 268 DYTFDCTGNTDVMRSALEACHK 289
           D  +D  G  D   + L A  +
Sbjct: 230 DVAYDSIGK-DTFETTLSALRR 250

>KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON}
           similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 381

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 133/318 (41%), Gaps = 56/318 (17%)

Query: 10  LAAVAYEAGKPLTIEEIVVDP--PKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFP---- 63
           + A+AY   + +     + +P   K  +V + I +  +C TD + L  +D    FP    
Sbjct: 1   MRALAYFGTRDIRFTTDLPEPVIEKPDDVLIDIVWCGICGTDLHEL--LDGPNFFPKDGE 58

Query: 64  ----------SILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKE----------CKF 103
                       +GHE AG+V  +G  VT  +PGDHV+   T  C++          CK 
Sbjct: 59  THEISGRGLPQAMGHEMAGVVSQVGSSVTKFQPGDHVVVEPTGTCQDRERYNTKGETCKA 118

Query: 104 CKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAID 163
           CK G  N+C  +    G GV   G                    F++  V+ +     + 
Sbjct: 119 CKRGMHNVCVHL-GLCGCGVQSGG--------------------FAEKVVIGEKHCFKVP 157

Query: 164 PKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIV 223
              PLD   L+       +  AVK   V++G +  + G G +GL ++   +  G + I+V
Sbjct: 158 SWIPLDVAALIQPLAVCWH--AVKLGAVKEGQSALILGGGPIGLGIIMALQHFGCTDIVV 215

Query: 224 VDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG--GLDYTFDCTGNTDVMR 281
            +    ++  A + GA   V+   D K  +  +  L  ++    G D+TFDC+G +    
Sbjct: 216 SEPAKIRRDLAEKMGA--IVSNPMDFKTNEENIKNLCSLSPNGEGYDFTFDCSGISVTFE 273

Query: 282 SALEACHKGWGESIIIGV 299
           S+++ C    G +I + V
Sbjct: 274 SSIK-CLTFRGTAINVAV 290

>NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 92/343 (26%), Positives = 139/343 (40%), Gaps = 38/343 (11%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTNVKPGDHV-IA 92
           ++V VKI    VC +D +T SG   E   P ++GHE  G V  IG     +K GD V I 
Sbjct: 38  YDVEVKIECCGVCGSDIHTASGHWGETKKPLVVGHEIIGTVTQIGSQCNELKVGDRVGIG 97

Query: 93  LYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYT 152
                C EC  CKS     C     T  K    D T  +++K G           ++ Y 
Sbjct: 98  AQVFSCLECDRCKSDNEPYCPKTVNTYRK----DYTDGYNSKGG-----------YADYI 142

Query: 153 VLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQG 212
            L +   V I    P      L CG  T +   ++      G  V + G G +G   +  
Sbjct: 143 RLHEHFAVPIPENIPSHLAAPLMCGGVTAFSPLLRNG-CGPGKKVGIMGIGGIGHMGLIF 201

Query: 213 AKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKT----IVDMLVEMTDGGLD 268
           AK  GA     +  +  KK+ A + GA  F+  +K+  D  T      D++V  ++   D
Sbjct: 202 AKAMGA-ETFAISRSSAKKEDAIKMGADHFI-ATKEEPDWATKYFDTFDLIVVCSNSLTD 259

Query: 269 YTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIK 328
             F+    T           K  G+ + I V    + ++ +PF L+ G     SA GGI 
Sbjct: 260 IDFNVVPRT----------MKVGGKIVSICVPEQHEVMNLKPFGLI-GVSISNSALGGIN 308

Query: 329 GRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
              +M  L+S   + K+ V+      +G  ++   FE +  GD
Sbjct: 309 EIKQMLDLVSK-KNLKIWVETIPISEKGVKEV---FERMEKGD 347

>Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 135/323 (41%), Gaps = 74/323 (22%)

Query: 35  EVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTNVKPGDHVIALY 94
           ++ +K  YT V + ++Y   G+ P    P ILG E AG + + G+ VTN + GD V    
Sbjct: 37  DLLIKNKYTGVNYIESYFRKGLYPCEK-PYILGREAAGTIVAKGKDVTNFEIGDKV---- 91

Query: 95  TAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVL 154
                                                          ++  STF+QYT  
Sbjct: 92  ----------------------------------------------AYISNSTFAQYTKF 105

Query: 155 -ADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT---ANVQKGDTVAVF-GAGTVGLSV 209
            ++ +V+ +  +   ++  L   G+     A   T    +V+KGD + +F  AG VGL +
Sbjct: 106 PSEGTVMKLSKETNDEELKLYAAGLLQALTALSFTNEAYHVRKGDYILLFAAAGGVGLIL 165

Query: 210 VQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG-GLD 268
            Q  +++GA  I V    D+K + A E+GA   +N SK+      I+  ++E+T+G G+D
Sbjct: 166 NQLLRMKGAHAIAVAS-TDEKLEIAKEYGAEYLINSSKE-----DILKKVLEITNGEGVD 219

Query: 269 YTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIK 328
            +FD  G  D     L A  +   + + +    A   I   PF      + + S      
Sbjct: 220 ASFDSVGK-DTFEITLAALKR---KGVFVSFGNASGLIP--PFS-----INRLSPKNITL 268

Query: 329 GRSEMGGLISDYMDGKLKVDEFI 351
            R ++ G I+D  + K   DEF+
Sbjct: 269 VRPQLYGYIADLKEWKSYTDEFV 291

>KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 77/317 (24%), Positives = 130/317 (41%), Gaps = 56/317 (17%)

Query: 35  EVRVKIAYTAVCHTDAYTLSG------VDPE------GAFPSILGHEGAGIVESIGEGVT 82
           E+ V I Y  +C TD + L+       +D E         P  +GHE AGIV ++G GV 
Sbjct: 28  ELLVDIVYCGICGTDLHELTDGPIFFPLDNERNEISGNGLPQAMGHEMAGIVTAVGSGVK 87

Query: 83  NVKPGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGT 128
             + GDHV    T  C++              C  C+ G  N C  +    G GV   G 
Sbjct: 88  KFQVGDHVAIEPTGTCRDRYRWPDAPDAKKPVCTSCQRGMYNCCDYL-GLIGNGVQSGG- 145

Query: 129 TRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
             F  +   +  H   C     + V A +  +A+         C            A+  
Sbjct: 146 --FAERIVVNESHCYKCPDNLPWEVAALIQPIAV---------CW----------HAINI 184

Query: 189 ANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKD 248
           A  + G +V + G G +GL  +      G + IIV +    ++ +A + GA  + +P + 
Sbjct: 185 AQFKPGSSVLILGGGPIGLGTILALNGHGCTEIIVSEPVKLRRDYAEKMGAVVY-DPLQC 243

Query: 249 LKDGKTIVDMLVEMTDG--GLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEI 306
             +    +  L +M  G  G DY FDC+G    +++++E C    G ++ + + A  K +
Sbjct: 244 SHEQS--IPNLRKMAPGADGFDYCFDCSGTPATLKASIE-CLTFRGTAVNVAMWATNKAV 300

Query: 307 STRPFQLVTG-RVWKGS 322
           +  P  +    +++ GS
Sbjct: 301 NFYPMDITKQEKIYTGS 317

>KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 83/340 (24%), Positives = 138/340 (40%), Gaps = 33/340 (9%)

Query: 35  EVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTN-VKPGDHV-IA 92
           ++ VKI    VC +D +  SG   + A P I+GHE  G V  +G   T+ VK GD V + 
Sbjct: 35  DIDVKIECCGVCGSDVHCASGHWGDIAKPLIVGHEIVGHVVKVGPNCTSGVKVGDRVGLG 94

Query: 93  LYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYT 152
                C +CK C +G  + C +   T         +T + +        ++    ++ Y 
Sbjct: 95  AQALSCMKCKRCLNGNESYCPNAIQTY--------STPYEDG-------YVSKGGYADYV 139

Query: 153 VLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQG 212
            + +   V I    P      L CG  T +   ++      G  VA+ G G +G   V  
Sbjct: 140 RVHEQFTVPIPENIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVAILGIGGIGHMGVLL 198

Query: 213 AKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFD 272
           AK  GA  +  +     KK+ A + GA  F+   ++    +   D         LD    
Sbjct: 199 AKAMGA-EVYAISRTSSKKEDAMKLGADHFIATKEEPDWHEKYFDE--------LDLVVV 249

Query: 273 CTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRS 331
           C G+ TD+  + L       G  + I +    + +  +PF LV G     S  G ++   
Sbjct: 250 CAGSVTDIDFNTLPKIIAVGGRIVSIAIPEMSEVLELKPFGLV-GVSIANSLLGSMEELK 308

Query: 332 EMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
           ++  L+S+  D K+ V+      +G   ++  FE +  GD
Sbjct: 309 QLLKLVSE-KDIKIWVETVPISEKG---VHEVFERMDKGD 344

>KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.253
           YBR046C
          Length = 334

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 84/335 (25%), Positives = 132/335 (39%), Gaps = 78/335 (23%)

Query: 35  EVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTNVKPGDHVIALY 94
           EV +K  YT V + ++Y   G+ P    P +LG E  G V +IG+ V ++K GD V    
Sbjct: 37  EVIIKNRYTGVNYIESYFRKGIYP-AELPYVLGREAVGTVVAIGKSVRDLKVGDKV---- 91

Query: 95  TAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVL 154
                                                          ++  +TF+Q+T +
Sbjct: 92  ----------------------------------------------SYIAGATFAQFTKV 105

Query: 155 ADVS-VVAIDPKAPLDKTCLLGCGVTTGYGAAV---KTANVQKGDTVAVFGA-GTVGLSV 209
            + + V  +      ++  L   G+  G  A     +  +V+KGD V ++ A G VGL  
Sbjct: 106 PNSTHVFKLPDTTSTEQLKLYAAGMIQGLTALTFVNEAYDVKKGDYVLLYAAAGGVGLIF 165

Query: 210 VQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG-GLD 268
            Q  ++RGA  I V   N +K   A E GA   +N  +D      I++ + ++T G G+D
Sbjct: 166 NQLLRMRGAHTIAVASTN-EKLSLAKENGAEFLINSKED-----NILEKVQQITKGNGVD 219

Query: 269 YTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLV-----TGRVWKGSA 323
             FD  G  D   + L +C K  G  +  G A+        PF L        R+ +   
Sbjct: 220 VAFDSVGK-DTFETTL-SCLKRKGTFVSYGNASG----PVPPFPLSRLSPKNIRLLRPQL 273

Query: 324 FGGIKGRSEMG----GLISDYMDGKLKVDEFITHR 354
           FG +    E       LIS    GKL +  F  ++
Sbjct: 274 FGYVAQADEFRHYTEELISLIDSGKLNIKLFKIYQ 308

>NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 93/358 (25%), Positives = 145/358 (40%), Gaps = 43/358 (12%)

Query: 24  EEIVVDPPKA--HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGV 81
           +++  DP K   H++ +K+    VC +D +  SG   +   P ++GHE  G V  +GE  
Sbjct: 24  KKVQFDPRKLYDHDIEIKVECCGVCGSDIHAASGNWGDLTKPLVVGHEIIGTVVRLGENC 83

Query: 82  TN-VKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDI 139
            + +K GD V +      C +C+ CK+     C     T G+   PDG   + +K G   
Sbjct: 84  NSGLKLGDRVGVGAQVFSCLDCERCKNDNEPYCEGFVTTYGQD-YPDG---YSSKGG--- 136

Query: 140 LHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT--ANVQKGDTV 197
                   ++ Y  + +   V I    P      L CG  T Y   V+      +K   V
Sbjct: 137 --------YADYFRVHEHFAVPIPENIPSHLAAPLMCGGLTVYSPLVRNGCGPNKKVGIV 188

Query: 198 AVFGAGTVGLSVVQ--GAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTI 255
            + G G  GL   +  GA+V   SR         KK+ A + GA  F+   ++   G   
Sbjct: 189 GIGGIGHQGLLFAKAMGAEVYAISR------TSAKKEDAMKLGADHFIATKEEPDWGTKY 242

Query: 256 VDMLVEMTDGGLDYTFDCTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLV 314
            D          D    C  + TDV  + +    K  G  + I V    + +S +PF L 
Sbjct: 243 FDT--------FDLIVVCASSLTDVDFNTVPNTMKIGGSIVSISVPEQNETLSLKPFGL- 293

Query: 315 TGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGDC 372
            G     SA G I    ++  L+S+  + KL V+      +G   +  AFE +  GDC
Sbjct: 294 KGVSISNSALGSISEMRDLLKLVSE-NNIKLWVETIPIGEKG---VKEAFERMDKGDC 347

>TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.253
           YBR046C
          Length = 335

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 105/260 (40%), Gaps = 65/260 (25%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTNVKPGDHVIAL 93
           +E+ +K  Y  +   +AY   G+ P    P ILG E  G+V + G+ V N   GD V   
Sbjct: 37  NELLIKNKYAGINFIEAYFRKGIYPV-QLPQILGREATGVVVAKGQSVKNFDIGDKV--- 92

Query: 94  YTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTV 153
                                                           +M  STF+QYT 
Sbjct: 93  -----------------------------------------------AYMSSSTFAQYTK 105

Query: 154 LADVSVVAIDPKAPLDKTC-LLGCGVTTGYGAAV---KTANVQKGDTVAVFGA-GTVGLS 208
            +   +++  P    D    +    +  G  A     +   V++GD + ++ A G VGL 
Sbjct: 106 YSSSGLISKLPSETTDDQLKVYAAALIQGLTALTFLDEAYKVKEGDYILLYAAAGGVGLL 165

Query: 209 VVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMT-DGGL 267
           + Q  K RGA  I VV   ++K++ A +FGA   +N SK+      I+   +E+T D G+
Sbjct: 166 MDQLLKERGAHAIAVVS-TEEKEELAKKFGAEYVINSSKE-----DILKRALEITNDKGV 219

Query: 268 DYTFDCTGNT--DVMRSALE 285
           D  FD  G    D+  +AL+
Sbjct: 220 DAVFDSVGKDTFDISLNALK 239

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/277 (23%), Positives = 111/277 (40%), Gaps = 50/277 (18%)

Query: 35  EVRVKIAYTAVCHTDAYTLSG---VDPEGA---------FPSILGHEGAGIVESIGEGVT 82
           E+ + I++  +C TD +         PE            P  +GHE AGIV  IG  V 
Sbjct: 28  ELIIDISWCGICGTDLHEFQDGPIFFPENGCCHEISGEGLPQAMGHEIAGIVSEIGPKVK 87

Query: 83  NVKPGDHVIALYTAECK--------------ECKFCKSGKTNLCGSVRATQGKGVMPDGT 128
             + GD V+   T  CK              EC  CK G  N+C ++    G GV   G 
Sbjct: 88  KFQVGDRVVVEPTGTCKDRYRWPDAPNANQEECAACKKGLYNICSNL-GLVGCGVQSGG- 145

Query: 129 TRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
                              F++  V+ +     I     +D   L+     + +  AV+ 
Sbjct: 146 -------------------FAERMVMNEAKCYKIPEHLTMDVAALIQPIAVSWH--AVRV 184

Query: 189 ANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKD 248
           +  + G +V + G G +GL  +      G + ++V +    ++  A + GA  +   ++D
Sbjct: 185 SKFKPGSSVLIIGGGPIGLGTILALNGHGVTEVVVSEPAKIRRDLAEKMGAVVYDPMTRD 244

Query: 249 LKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALE 285
             +    +  +    D G DYTFDC+GN   +++A+E
Sbjct: 245 HDESIKYLRSIAPGGD-GFDYTFDCSGNPATLKAAIE 280

>KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 353

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 75/158 (47%), Gaps = 13/158 (8%)

Query: 138 DILHFMGCSTFSQYTVLADVSVVAIDPK-APLDKTCLLGCGVTTGYGAAV---KTANVQK 193
           D + ++  STF+Q+T       +   PK    +K  ++   +  G        +  NVQK
Sbjct: 108 DKVAYLSASTFAQFTKYPQNGHLIKLPKDISAEKEKIIAGSLVQGLTPLTFIDEAYNVQK 167

Query: 194 GDTVAVFGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDG 252
           GD + V+ A G VGL   Q  K RGA R I V   D+K Q A E+GA   +N +KD    
Sbjct: 168 GDFILVYAAAGGVGLIFDQLLKARGA-RTIAVASTDEKLQLAKEYGAEFLINSTKD---- 222

Query: 253 KTIVDMLVEMTDG-GLDYTFDCTGNTDVMRSALEACHK 289
             IV+ + E T+G G+   FD  G  D   + L+   +
Sbjct: 223 -DIVEKVKEFTNGEGVAAAFDSIGK-DTFETTLQVVKR 258

>KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38230 Saccharomyces cerevisiae YBR046C ZTA1
           Zeta-crystallin homolog
          Length = 358

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 73/347 (21%), Positives = 132/347 (38%), Gaps = 74/347 (21%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTNVKPGDHVIAL 93
           +E+ +K  Y  + + ++Y   G+ P    P +LG E +G+V + G               
Sbjct: 59  NEILIKNKYAGINYIESYFRKGIYPSKK-PYVLGREASGVVVAKG--------------- 102

Query: 94  YTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTV 153
                                           D  T+F      D + ++  +TF+QYT 
Sbjct: 103 --------------------------------DAVTKFD---VNDKVAYLSSNTFAQYTK 127

Query: 154 LADVSVVAIDPKAPLDKTCLLGCG----VTTGYGAAVKTANVQKGDTVAVFGAGTVGLSV 209
           +++   V+  P+   D+   L  G      T      +   V+KGD + ++ A       
Sbjct: 128 ISEAGTVSKVPQDSTDEQLKLYAGSLVQALTSLAFVREAYPVKKGDYILLYAAAGGAGLA 187

Query: 210 VQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG-GLD 268
                 +  +  I V   D+K Q A E+GA   +N SKD      ++  ++E+T+G G++
Sbjct: 188 FNQFLKKAGAHTIAVASTDEKLQLAKEYGAEFLINSSKD-----DVLARVLEITNGQGVE 242

Query: 269 YTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTG---RVWKGSAFG 325
             FD  G  D   ++L+A  +   +  ++    A   +      ++T    ++ + S FG
Sbjct: 243 AAFDSVGK-DTFETSLKALKR---KGTLVSFGNASGPVPPVAINILTPKNIKLLRPSLFG 298

Query: 326 GIKGRSEMGGLISDYMD----GKLKVDEFITHRRGFTDINSAFEDLH 368
            I    E     S+  D    G LK+   I+      + N A E L 
Sbjct: 299 YIATHEEWESYSSELFDLLHSGALKI--LISKTYPLEEYNQAAEQLE 343

>NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa]
           {ON} 
          Length = 361

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 89/344 (25%), Positives = 139/344 (40%), Gaps = 39/344 (11%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTN-VKPGDHV-I 91
           H++ +KI    VC +D +T SG   +   P ++GHE  G V  +G+  T+ +K GD V +
Sbjct: 35  HDIDIKIECCGVCGSDIHTASGHWGDITKPLVVGHEIIGTVVRLGDKCTSGLKLGDRVGV 94

Query: 92  ALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQY 151
                 C EC  CKS     C     T       DG    +N KG           ++ Y
Sbjct: 95  GAQAFSCLECGRCKSDNEPYCTKSVWTYSTN-YEDG----YNSKG----------GYADY 139

Query: 152 TVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQ 211
             L +   + I    P      L CG  T +   ++     +G  V + G G +G   + 
Sbjct: 140 IRLHEHFAIPIPENIPSHLAAPLMCGGITAFSPLLRNG-CGRGKKVGIMGIGGIGHMALI 198

Query: 212 GAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKT----IVDMLVEMTDGGL 267
            AK  GA  +  +     KK  + + GA  F+  +K+  D  T      D++V  ++   
Sbjct: 199 FAKAMGA-EVYAISRTSAKKDDSIKMGADHFI-ATKEEPDWATKYFDTFDLIVVCSNSLT 256

Query: 268 DYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGI 327
           D  FD    T           K  G+ + I      + I+ +PF L+ G     SA GGI
Sbjct: 257 DINFDVVPRT----------MKVGGKIVSICAPEQNEVINLKPFGLL-GVSISNSALGGI 305

Query: 328 KGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
               +M  L+S   D K+ V+      +G  ++   FE +  GD
Sbjct: 306 NEIKQMLDLVSK-KDLKIWVETVPISEKGVKEV---FERMDMGD 345

>Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 106/262 (40%), Gaps = 64/262 (24%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTNVKPGDHVIAL 93
            ++ +K  Y  V + ++Y   G+ P    P +LG E  G V + G+ V N + GD V   
Sbjct: 36  EDLLIKNKYAGVNYIESYFRKGLYPCEK-PYVLGREATGTVVAKGKDVNNFQIGDQV--- 91

Query: 94  YTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTV 153
                                                           ++  STF+QYT 
Sbjct: 92  -----------------------------------------------AYISHSTFAQYTK 104

Query: 154 LADVSVVAIDPKAPLD-KTCLLGCGVTTGYGAAVKT---ANVQKGDTVAVFGA-GTVGLS 208
            +    V   PK   D K  L   G+     A   T    +V+KGD + V+ A G VGL 
Sbjct: 105 FSSKGNVMRLPKCTSDEKMKLYAAGLLQALTALSFTNEAYHVKKGDYILVYAAAGGVGLI 164

Query: 209 VVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG-GL 267
           + Q  K++GA  I V    D+K   A + GA   +N SK+      +++ ++E+T+G G+
Sbjct: 165 LNQLLKMKGAHAIAVAS-TDEKLDIAKKNGAEYLINSSKE-----DVLERVLEITNGEGV 218

Query: 268 DYTFDCTGNTDVMRSALEACHK 289
           D +FD  G  D   + L A  +
Sbjct: 219 DSSFDSIGK-DTFETTLAALKR 239

>NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON}
           Anc_3.253
          Length = 349

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 99/256 (38%), Gaps = 57/256 (22%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTNVKPGDHVIAL 93
           +++ +K  Y  V + ++Y   G+ P  A P+ILG E +G+V   G  + N + GD V   
Sbjct: 52  NDIIIKNKYAGVNYIESYFRKGIYP-CALPAILGREASGVVVDKGTNIKNFEIGDKV--A 108

Query: 94  YTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTV 153
           Y   C   +F K   + +           +  D T          IL  +   +F     
Sbjct: 109 YIGNCSMAQFTKIDNSMIM---------KLSSDSTNEDLKLYAAGILQGLTALSF----- 154

Query: 154 LADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVF-GAGTVGLSVVQG 212
                                   VT  Y        V+KGD + V+  AG  GL   Q 
Sbjct: 155 ------------------------VTEAY-------EVKKGDYILVYAAAGGAGLIFDQL 183

Query: 213 AKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG-GLDYTF 271
            K RGA  +I V  +D+K Q A E GA   +N   D      I+  ++E+TD  G+   F
Sbjct: 184 IKARGA-HVIAVCSSDEKLQLAKENGAEYLINSKTD-----DILTKVMEITDNKGVQAAF 237

Query: 272 DCTGNTDVMRSALEAC 287
           D  G  D   + L A 
Sbjct: 238 DSVGK-DTFHTTLAAL 252

>Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318C
           (ADH6) - NADPH-dependent alcohol dehydrogenase [contig
           207] FULL
          Length = 373

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 116/302 (38%), Gaps = 48/302 (15%)

Query: 31  PKA---HEVRVKIAYTAVCHTDAYTLS---GVDPEGAFPS-------ILGHEGAGIVESI 77
           PKA   H+V +++    +C ++ + L    G  P     S       ++GHE  G V ++
Sbjct: 28  PKAFGPHDVDIEVECCGICASELFALKNEWGHAPLACLSSKYGPKTQVVGHEVVGKVVAV 87

Query: 78  GEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKG 136
           G  V+    GD V +    + C +C  C SG    C +  +T  K   PDG         
Sbjct: 88  GPQVSLCNVGDRVGLGAQASACMQCSRCNSGNEQYCPNAISTYCK-PYPDG--------- 137

Query: 137 EDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDT 196
                ++    ++ +    +     I P+ P +    L CG  T +    +    +    
Sbjct: 138 -----YVSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFSPIKRNLQGKHDPK 192

Query: 197 VAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIV 256
           VAV G G +G   +  A+  GA  +        K+  A + GA  FV             
Sbjct: 193 VAVIGIGGLGHMAIMIARALGA-EVYAFSRGHSKRDDALKMGAHHFVATGD--------A 243

Query: 257 DMLVEMTDGGLDYTFD----CTGNTDVM-RSALEACHKGWGESIIIGVAAAGKEISTRPF 311
           D      + GLD TFD    C  +T  +  +A+  C K     + +G+    +E+S +PF
Sbjct: 244 DW-----NAGLDDTFDLILNCASSTSSLDLNAMLPCLKVNCNFVSVGLPHIDEELSVKPF 298

Query: 312 QL 313
             
Sbjct: 299 SF 300

>SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 348

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 104/272 (38%), Gaps = 64/272 (23%)

Query: 24  EEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTN 83
           E+  V    A EV +K  ++ +   ++Y   G+ P    P +LG E AG V + G+ V+ 
Sbjct: 40  EDFPVPNINADEVLIKNKFSGINFIESYFRKGLYPSQK-PYVLGREAAGTVVAKGDAVSK 98

Query: 84  VKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFM 143
              GD V                                                   ++
Sbjct: 99  FNIGDKV--------------------------------------------------AYL 108

Query: 144 GCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAN----VQKGDTVAV 199
              TF+QYT   +   +   PK   D+      G       A+   N    V+KGD + +
Sbjct: 109 SPGTFAQYTKYPENGKILKLPKETTDEQLKFYAGSLVQGLTALTFVNDAYDVKKGDYILL 168

Query: 200 FGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDM 258
           + A G  GL   Q  K++GA  I V    D+K + A E+GA   +N SKD       +  
Sbjct: 169 YAAAGGAGLIFNQLLKLKGAHTIAVAS-TDEKLKLAREYGAEYVINSSKD-----DTLSK 222

Query: 259 LVEMTDG-GLDYTFDCTGNTDVMRSALEACHK 289
           ++E+T+G G+   FD  G  D    +L+A  +
Sbjct: 223 VLEITNGEGVAAAFDSIGK-DTFEISLQAIKR 253

>NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 84/350 (24%), Positives = 137/350 (39%), Gaps = 33/350 (9%)

Query: 25  EIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTN- 83
           E    P   +++ +KI    VC +D +  +G   +   P ++GHE  G V  +GE   + 
Sbjct: 28  EFEPKPFYPNDIDIKIECCGVCGSDIHAAAGHWGDLEKPLVVGHEVIGTVVRLGENCNSG 87

Query: 84  VKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHF 142
           +K GD V +      C +C+ CKS     C S   T G+    DG   + +K G      
Sbjct: 88  LKLGDRVGVGAQVFSCLDCERCKSNNEPYCPSFVTTYGQSYK-DG---YSSKGG------ 137

Query: 143 MGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGA 202
                ++ Y  + +   V I    P      L CG  T +   ++           V   
Sbjct: 138 -----YADYIRVHEHFAVPIPENIPSHLAAPLMCGGITVFSPLLRNGCGPGKKVGIVGIG 192

Query: 203 GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEM 262
           G   + ++  AK  GA  +  +     KK+ A + GA  F+   ++   G    D     
Sbjct: 193 GIGHMGLIF-AKAMGA-EVYAISRTSAKKEDAMKLGADHFIATKEEPDWGTKYFDT---- 246

Query: 263 TDGGLDYTFDCTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKG 321
                D    C  + TDV  + +    K  G  + I V    + ++ +PF L+ G     
Sbjct: 247 ----FDLIVVCANSLTDVDFNVVPKAMKVGGNIVSICVPEQNEVLNLKPFGLL-GVSISN 301

Query: 322 SAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
           SA GG+K   E+  L+S   + K+ V+       G   +  AFE +  GD
Sbjct: 302 SALGGVKEIKELLDLVSK-NNLKIWVETLPIGEEG---VKQAFERMDKGD 347

>Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 107/257 (41%), Gaps = 56/257 (21%)

Query: 35  EVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTNVKPGDHVIALY 94
           ++ +K  YT V + ++Y   G+ P    P +LG E  G++ + G+ VTN + GD V    
Sbjct: 37  DILIKNKYTGVNYIESYFRKGLYPCEK-PYVLGREATGVIVAKGKDVTNFETGDQV---- 91

Query: 95  TAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVL 154
            A      F +  K    G++        +P GT+                         
Sbjct: 92  -AYISNSTFAQYTKFPSEGTIMK------LPSGTS------------------------- 119

Query: 155 ADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVF-GAGTVGLSVVQGA 213
                   D K  L    LL     T      +  +V+KGD + V+  AG VGL + Q  
Sbjct: 120 --------DEKMKLYAAGLLQA--LTALSFTNEAYHVKKGDYILVYAAAGGVGLILNQLL 169

Query: 214 KVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG-GLDYTFD 272
           +++ A  I V     +K + A ++GA   ++ SK+      I+  ++E+TDG G+D +FD
Sbjct: 170 RMKDAHAIAVASTY-EKLETAKDYGAEFLIDSSKE-----DILTRVLEITDGKGVDASFD 223

Query: 273 CTGNTDVMRSALEACHK 289
             G  D   + L A  +
Sbjct: 224 SVGK-DTFDTTLAALKR 239

>ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C ZTA1 Zeta-crystallin homolog
          Length = 349

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 80/327 (24%), Positives = 126/327 (38%), Gaps = 73/327 (22%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTNVKPGDHVIAL 93
           +E+ VK  Y+ +   ++Y   G+ P    P ILG E +G V + G  V +   GD V   
Sbjct: 52  NELLVKNKYSGINFIESYFRKGIYPSEK-PLILGRESSGTVVAKGNSVKDFDIGDKV--- 107

Query: 94  YTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTV 153
                                                           ++  S F+QYT 
Sbjct: 108 -----------------------------------------------AYLSGSAFAQYTK 120

Query: 154 LADVSVVAIDPKAPLDKTC-LLGCGVTTGYGAAV---KTANVQKGDTVAVFGA-GTVGLS 208
           +     V   PK   D+T  L   G+     A     +  NV+KGD +  + A G VGL 
Sbjct: 121 VDAAGKVVKLPKDANDETLKLYAAGLLQSLTALTFIDEAYNVKKGDFILNYAAAGGVGLI 180

Query: 209 VVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG-GL 267
           + Q  K RGA  I VV   ++K + A + GA   +  SK+      IV  + E+T+  G+
Sbjct: 181 LDQLLKERGAHTIAVVS-TEEKLELAKKHGAEYGIISSKE-----DIVTRVKEITNNQGV 234

Query: 268 DYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTG--RVWKGSAFG 325
           D  FD  G  D   + + A  +   +   +    A   +S  P   +TG  ++ + S F 
Sbjct: 235 DAAFDSIGK-DTFETTISALKR---KGTFVSYGNASGPVSPFPLTKLTGNIKILRPSLFS 290

Query: 326 GIKGRSEMGGLISDYM----DGKLKVD 348
            I    E      +++     GKLK++
Sbjct: 291 YIATSEEWKHYSREFVSLVSSGKLKIN 317

>NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 80/348 (22%), Positives = 136/348 (39%), Gaps = 47/348 (13%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTN-VKPGDHV-I 91
           H++++K+    VC +D +  SG       P ++GHE  G V  +G+   N +K GD V +
Sbjct: 34  HDIQIKVECCGVCGSDIHAASGHWGNIPTPLVVGHEIVGRVVKVGDRCDNGLKVGDRVGV 93

Query: 92  ALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQY 151
                 C EC  CK+   + C    AT G G  PDG              ++    ++ +
Sbjct: 94  GAQVFSCLECNRCKTDNESYCPKWVATYG-GEYPDG--------------YISKGGYADF 138

Query: 152 TVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT----ANVQKGDTVAVFGAGTVGL 207
             + +  VV I    P +    L CG  T +   ++             +   G   V  
Sbjct: 139 VRVHEHFVVPIPENIPSEYAAPLLCGGLTVFSPLLRNGCGPGKKVGIVGIGGIGHQGVIF 198

Query: 208 SVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKT----IVDMLVEMT 263
           +   GA+V   SR        +KK  A + GA  F+  +K+  D  T      D++V   
Sbjct: 199 ANAMGAEVYAISR------TSKKKDDAFKLGAHHFI-ATKEEPDWGTKYYDTFDLIVVCA 251

Query: 264 DGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSA 323
           +   D  FD   +T           K  G  + I +    + +  +PF L  G     S 
Sbjct: 252 NSLTDIDFDVVPHT----------MKIGGRIVSISIPEMSQVLKLKPFGL-KGVSISNSH 300

Query: 324 FGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
            G IK    +  L+S+  + ++ ++      +G   ++ AF+ +  GD
Sbjct: 301 LGSIKELKTLLKLVSE-KNLRIWIETIPIGEKG---VHEAFDRMDKGD 344

>KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} similar
           to uniprot|P25377 Saccharomyces cerevisiae YCR105W ADH7
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis
          Length = 374

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/255 (22%), Positives = 97/255 (38%), Gaps = 35/255 (13%)

Query: 65  ILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           ++GHE  G V ++G  V+  K GD V +    + C +C  C+S     C     T     
Sbjct: 75  VVGHEVVGKVVAVGPEVSLCKVGDRVGLGAQASACMQCSRCQSSNEQYCAQSIGTYCNP- 133

Query: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PDG              ++    ++ +    +     I P+ P +    L CG  T + 
Sbjct: 134 YPDG--------------YVSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFS 179

Query: 184 AAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFV 243
              +    +K   VA+ G G +G   +  +K  GA  +  V     K+  A + GA  F+
Sbjct: 180 PIKRNIQGKKNPRVAIIGIGGLGHMAIMISKALGA-EVSAVSRGYSKRDDALKMGADHFI 238

Query: 244 NPSKDLKDGKTIVDMLVEMTDGGLDYTFD----CTGNTDVM-RSALEACHKGWGESIIIG 298
             S+                + GLD TFD    C  +T  +  +AL  C K     + +G
Sbjct: 239 ATSE-------------PNWNAGLDDTFDLILNCASSTSSLDLNALLPCLKVNCNFVSVG 285

Query: 299 VAAAGKEISTRPFQL 313
           +    ++   +PF  
Sbjct: 286 LPHIDEDFKVKPFSF 300

>CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c
          Length = 360

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 80/350 (22%), Positives = 135/350 (38%), Gaps = 33/350 (9%)

Query: 25  EIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGV-TN 83
           E    P   H++ +KI    VC +D +  +G   +   P ++GHE  G V  IG    T 
Sbjct: 25  EFPAKPFYDHDIDIKIDACGVCGSDIHCAAGNWGKKQTPLVVGHEIIGKVVKIGPKCNTG 84

Query: 84  VKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHF 142
           +K GD V +      C EC  CK+     C     T             +++  ED   +
Sbjct: 85  LKVGDRVGVGAQVFSCLECDRCKNDNEPYCPKFVTT-------------YSQPYED--GY 129

Query: 143 MGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGA 202
           +    ++ Y  + +   V I    P      L CG  T Y   ++           V   
Sbjct: 130 VSQGGYANYVRVHEHFAVKIPENIPDHLAAPLLCGGITVYSPLLRNGCGPGKKVGIVGIG 189

Query: 203 GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEM 262
           G   + ++  AK  GA  +  +  ++ KK+ + + GA  ++   ++   G+   D     
Sbjct: 190 GIGHMGLL-FAKAMGA-EVYAISRSNAKKEDSLKLGADHYIATKEEPNWGEKYFDT---- 243

Query: 263 TDGGLDYTFDCTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKG 321
                D    C  + TDV    +    K  G  + I +    + ++ +PF L+ G     
Sbjct: 244 ----FDLIVVCASSLTDVDFDVMPKAMKVGGRIVSISIPDEDQTLTMKPFGLL-GVSIAN 298

Query: 322 SAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
           SA G IK   ++  L+S+  D K+ V+       G   +  AFE +  GD
Sbjct: 299 SALGSIKEIEQLLKLVSE-KDIKIWVETLPVGEAG---VKEAFERMDKGD 344

>KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa]
           {ON} 
          Length = 360

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 84/341 (24%), Positives = 134/341 (39%), Gaps = 33/341 (9%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTN-VKPGDHV-I 91
           +++ +KI    VC +D +  SG   +   P ++GHE  G V  +G   T+ +K GD V +
Sbjct: 34  NDIDIKIEACGVCGSDVHMASGNWGDVKKPLVVGHEIVGTVVKVGSKCTSGMKVGDRVGV 93

Query: 92  ALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQY 151
                 C  C  C +     C +V  T G    PDG    +N KG           ++ Y
Sbjct: 94  GAQVHSCLTCDRCNNDNEQYCPNVVFTYGFD-YPDG----YNGKG----------GYANY 138

Query: 152 TVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQ 211
             + +   V I    P      L CG  T Y   ++      G  V + G G +G   + 
Sbjct: 139 IRVHEHFAVPIPENIPTHLAAPLLCGGITVYSPLLRNG-CGPGKKVGILGIGGIGHMGII 197

Query: 212 GAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTF 271
            AK  GA  +  +  +D KK+ A + GA  F+    +   GK   D         LD   
Sbjct: 198 FAKSMGA-EVYAISRSDAKKEDAFKLGADHFIATKDEPDWGKKYFDT--------LDLIV 248

Query: 272 DCTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGR 330
            C G+  DV    L       G+ + I +  A +++    F L  G     S+ G +   
Sbjct: 249 ICAGSLKDVDFDNLPKAMTVGGKVVSISIPEASEKLEFSAFGL-AGISIGNSSLGSMVEL 307

Query: 331 SEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
            ++  L+S+  D ++ V+       G   +   FE +  GD
Sbjct: 308 KQLLKLVSE-QDLRVWVETVPISEDG---VRQVFERMEKGD 344

>SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 68/312 (21%), Positives = 114/312 (36%), Gaps = 53/312 (16%)

Query: 32  KAHEVRVKIAYTAVCHTDAYTLSGV---DPEGAFPS-------ILGHEGAGIVESIGEGV 81
           +AH+V +++    +C ++ ++L      +P     S       ++GHE  G V ++G  V
Sbjct: 34  EAHDVDIEVECCGICASELFSLKNEWKHEPLACLSSSYGPKSQVVGHEVVGKVVAVGSNV 93

Query: 82  TNVKPGDHV-IALYTAECKECKFCKSGKTNLC----GSVRATQGKGVMPDGTTRFHNKKG 136
           T    GD V +      C +C  C SG    C    G+  +    G +  G    H +  
Sbjct: 94  TLCNIGDRVGLGAQAFSCMKCSRCNSGNEQYCPQAVGTYCSRYADGYISQGGYASHVRAH 153

Query: 137 EDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDT 196
           E             + +  D+    + P         L CG  T Y    +     K   
Sbjct: 154 EQFC----------FPIPDDIPSELVAP---------LQCGGLTVYSPIKRNIEGVKDPK 194

Query: 197 VAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIV 256
           VA+ G G +G   +  +K  GA  +        KK+ A + GA  F+   +         
Sbjct: 195 VAIIGIGGLGHMAIMISKALGA-EVTAFSRGYSKKEDALKMGAHHFIATGE--------- 244

Query: 257 DMLVEMTDGGLDYTFDCTGN-----TDVMRSALEACHKGWGESIIIGVAAAGKEISTRPF 311
               E  + GL+ TFD   N     T +  + L  C K     I +G+    ++   +PF
Sbjct: 245 ----EGWESGLNDTFDLILNCASSTTSLDLNKLLPCLKINRNFISVGLPHVDEDFKVKPF 300

Query: 312 QLVTGRVWKGSA 323
              +     GS+
Sbjct: 301 SFFSNGCCIGSS 312

>SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]
           {ON} similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 378

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 106/286 (37%), Gaps = 38/286 (13%)

Query: 60  GAFPSILGHEGAGIVESIGEGVTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRAT 118
           G    ++GHE  G V ++G  VT    G+ V +      C +C  C +G    C     T
Sbjct: 74  GPKSQVVGHEIVGHVVNVGNKVTKFHKGERVAMGAQCGSCMKCNRCINGYEQFCTGCIET 133

Query: 119 QGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGV 178
                 PDG              ++    ++ +    +  +V + P+        L CG 
Sbjct: 134 YCSE-YPDG--------------YVSQGGYASHVRAHEHYIVHVPPQLDSKHVAPLQCGG 178

Query: 179 TTGYGAAVKTAN--VQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANE 236
            T Y    +       K   VA+ G G +G   +  +K      +  +  +D KK+ A +
Sbjct: 179 LTVYSPIKRALKDVTDKKPRVAIIGIGGLGHMAIMISKALDC-EVWALSTSDSKKEDAKK 237

Query: 237 FGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTF----DCT-GNTDVMRSALEACHKGW 291
            GA  FVN ++  KD             GGL  TF     CT   T +   +L       
Sbjct: 238 MGADHFVNTTE--KD-----------VWGGLQDTFHLILSCTISYTKLPFESLLGTLVAT 284

Query: 292 GESIIIGVAAAGKEISTRPFQLVT-GRVWKGSAFGGIKGRSEMGGL 336
           G+ I +G+ +  + +   P QL   G  +  S  G IK   E+  L
Sbjct: 285 GKFISVGLPSKDQPLEIHPMQLAAHGVSFSASHLGSIKELEELLAL 330

>KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 360

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 85/349 (24%), Positives = 134/349 (38%), Gaps = 49/349 (14%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGV-TNVKPGDHV-I 91
           ++V V+I    +C +D +  SG     + P ++GHE  G V  +G    T VK GD V +
Sbjct: 34  YDVDVEIEACGICGSDTHCASGNWGPKSLPLVVGHEVIGRVVRVGPKCHTGVKVGDRVGV 93

Query: 92  ALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQY 151
               + C +C  C S     C     T  +   PDG              ++    ++ +
Sbjct: 94  GAQVSSCLDCDRCNSDFEPYCAEFITTYSQP-YPDG--------------YVSQGGYASH 138

Query: 152 TVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT--ANVQKGDTVAVFGAGTVGLSV 209
               +  V+ I  K P      L CG  T +   +       +K   V + G G +GL  
Sbjct: 139 IRAHEHFVIPIPEKIPTHLAAPLLCGGITVFSPLINNDCGPNKKVGIVGIGGIGHMGLIF 198

Query: 210 VQ--GAKVRGASRIIVVDINDQKKQWANEFGATDFV----NPSKDLKDGKTIVDMLVEMT 263
            +  GA+V   SR      +  KK+ A + GA  F+     P  + K   T         
Sbjct: 199 AKALGAEVYAISR------SSAKKEDAMKLGADHFIATKEEPDWEKKYAST--------- 243

Query: 264 DGGLDYTFDCTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGS 322
              LD    C  + T++    L    +  G  I I V    +E++ +PFQL +G     S
Sbjct: 244 ---LDLVIVCASSLTEINLEQLIKTMRIKGRIISICVPKETEELNLKPFQL-SGITIGNS 299

Query: 323 AFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
             G  K   ++  L++D  D K+ V+          D   AF  +  GD
Sbjct: 300 QLGSRKELIQLLQLVAD-KDLKIWVETLPISEESVHD---AFVRMEKGD 344

>CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa]
           {ON} highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c or uniprot|P25377 Saccharomyces
           cerevisiae YCR105w
          Length = 359

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 83/365 (22%), Positives = 143/365 (39%), Gaps = 33/365 (9%)

Query: 10  LAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHE 69
           +A V ++  K     E    P   ++V +KI    VC +D +  +G   +   P ++GHE
Sbjct: 9   IAVVDHKDWKNPKKVEFPAKPFYDNDVDIKIEACGVCGSDIHCAAGNWGQKQTPLVVGHE 68

Query: 70  GAGIVESIGEGV-TNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDG 127
             G V  +G    T +K GD V +      C EC+ CK+     C     T         
Sbjct: 69  IIGKVVKVGPKCKTGLKIGDRVGVGAQVFSCLECERCKNDNEPYCARFVTT--------- 119

Query: 128 TTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVK 187
               +++  ED   ++    ++ Y  + +   V I    P +    L CG  T Y   ++
Sbjct: 120 ----YSQPYED--GYVSQGGYANYVRVHEHFAVPIPENIPSEYAAPLLCGGLTVYSPLLR 173

Query: 188 TANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSK 247
                 G  V + G G +G   +  AK  GA  +  +  ++ KK+ + + GA  ++   +
Sbjct: 174 NG-CGPGKKVGILGIGGIGHMGILFAKAMGA-EVYAISRSNAKKEDSLKLGADHYIATKE 231

Query: 248 DLKDGKTIVDMLVEMTDGGLDYTFDCTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEI 306
           +   G    D          D    C  + TDV    +    K  G  + I V    + +
Sbjct: 232 EPDWGTKYFDT--------FDLIVVCASSLTDVDFDVMPKAMKVGGRIVSISVPEQDEVL 283

Query: 307 STRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFED 366
           + +PF L+ G     S  G I    ++  L+S+  + K+ V+       G   +  AFE 
Sbjct: 284 TMKPFGLI-GVSIANSILGSIAEMKQLLKLVSE-NNIKIWVETLPVGEAG---VKEAFER 338

Query: 367 LHHGD 371
           +  GD
Sbjct: 339 MDKGD 343

>YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON}
           ADH6NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 360

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 79/347 (22%), Positives = 141/347 (40%), Gaps = 37/347 (10%)

Query: 30  PPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIG-EGVTNVKPGD 88
           P   H++ +KI    VC +D +  +G       P ++GHE  G V  +G +  + +K G 
Sbjct: 30  PFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQ 89

Query: 89  HV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCST 147
            V +      C EC  CK+     C     T             +++  ED   ++    
Sbjct: 90  RVGVGAQVFSCLECDRCKNDNEPYCTKFVTT-------------YSQPYED--GYVSQGG 134

Query: 148 FSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT--ANVQKGDTVAVFGAGTV 205
           ++ Y  + +  VV I    P      L CG  T Y   V+      +K   V + G G++
Sbjct: 135 YANYVRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSM 194

Query: 206 GLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG 265
           G  +   +K  GA    V+  + +K++ A + GA  ++   ++   G+   D        
Sbjct: 195 GTLI---SKAMGA-ETYVISRSSRKREDAMKMGADHYIATLEEGDWGEKYFDT------- 243

Query: 266 GLDYTFDCTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAF 324
             D    C  + TD+  + +    K  G  + I +    + +S +P+ L    +   SA 
Sbjct: 244 -FDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLSLKPYGLKAVSI-SYSAL 301

Query: 325 GGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
           G IK  +++  L+S+  D K+ V+       G   ++ AFE +  GD
Sbjct: 302 GSIKELNQLLKLVSE-KDIKIWVETLPVGEAG---VHEAFERMEKGD 344

>Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}
           similar to Saccharomyces cerevisiae YMR318C ADH6 /
           YCR105W ADH7
          Length = 383

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 78/319 (24%), Positives = 129/319 (40%), Gaps = 34/319 (10%)

Query: 1   MSEGKPITCLAAVAYEAGKPLTIEEIVVDPPK---AHEVRVKIAYTAVCHTDAYTLSGVD 57
           M E K IT +A V    G   T  + V   PK   A ++ +K+    VC +D +  +G  
Sbjct: 24  MGELKEITGIAVVE---GTEWTSPKKVSFKPKTVYARDIVLKVEACGVCGSDIHCAAGHW 80

Query: 58  PEGAFPSILGHEGAGIVESIGEGVTN-VKPGDHV-IALYTAECKECKFCKSGKTNLCGSV 115
                P ++GHE  G V  +G G    +K GD V +      C EC  C+S     C ++
Sbjct: 81  GPRNNPLVVGHEIIGRVIEVGSGCKEGLKVGDRVGVGAQALSCLECSRCESENEQYCSNM 140

Query: 116 RATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLG 175
             T      PDG              ++    ++ + ++ +   + I    P      L 
Sbjct: 141 TGTYNFP-YPDG--------------YISQGGYASHVIVHEHFAIPIPDNIPSHLAAPLM 185

Query: 176 CGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWAN 235
           CG  T +   +++ NV  G +V V G G +G   V  AK  GA+ +  +     KK  A 
Sbjct: 186 CGGITAFSPLLRS-NVGPGTSVGVVGIGGIGHMAVIFAKALGAN-VTAISRRSNKKDDAL 243

Query: 236 EFGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGN-TDVMRSALEACHKGWGES 294
           + GA  ++   +D    KT  +         LD    C+ + T++    + +  K  G+ 
Sbjct: 244 KLGADVYIAAVEDKDWHKTYANT--------LDLIVVCSSSLTELDFDRIPSLLKVGGKV 295

Query: 295 IIIGVAAAGKEISTRPFQL 313
           + I +  A + +  RP  L
Sbjct: 296 LSIAIPEASERLVLRPLLL 314

>Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 81/351 (23%), Positives = 142/351 (40%), Gaps = 45/351 (12%)

Query: 30  PPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIG-EGVTNVKPGD 88
           P   H+V +KI    VC +D +  +G   +   P ++GHE  G V  +G +  + ++ G 
Sbjct: 30  PFYDHDVDIKIEACGVCGSDIHCAAGNWGKKKMPLVVGHEIVGTVVKLGSKSNSGLQVGQ 89

Query: 89  HV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCST 147
            V +      C EC  CKS     C     T G+    DG              ++    
Sbjct: 90  RVGMGAQVFSCLECDRCKSDNEPYCTKFVTTYGQP-YEDG--------------YVSQGG 134

Query: 148 FSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT--ANVQKGDTVAVFGAGTV 205
           ++ Y  + +  VV I    P      L CG  T Y   V+      +K   V   G G++
Sbjct: 135 YADYVRVHEHFVVPIPENIPSHLAAPLLCGGLTAYSPLVRNGCGPGKKVGIVGFGGIGSM 194

Query: 206 GLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVD-----MLV 260
           G  +   AK  GA    V+  + +K++ A + GA  ++   ++   G+   D     ++ 
Sbjct: 195 GTLI---AKAMGA-ETYVISRSSKKREDAMKMGADHYIATLEEENWGEKYFDTFDLIVVC 250

Query: 261 EMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWK 320
             +  G+D+        DVM  A+    K  G  + I +    + ++ +P+ L    +  
Sbjct: 251 ASSLTGIDF--------DVMPKAM----KVGGRIVSISIPEQHEVLTLKPYGLKAVSI-S 297

Query: 321 GSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
            SA G IK   ++  L+S+  + K+ V+       G   ++ A E +  GD
Sbjct: 298 YSALGSIKELKQLLKLVSE-KNVKIWVETLPVGEAG---VHEALERMEKGD 344

>ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR046C (ZTA1)
          Length = 334

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 101/272 (37%), Gaps = 64/272 (23%)

Query: 24  EEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTN 83
           E+  V   +  ++ +K  Y  V   + Y  +G+ P    P +LG E  G+V +IG  V  
Sbjct: 26  EDYPVPEVRGSDILIKNRYAGVNFIETYFRTGLYP-CEKPYVLGREAVGVVAAIGADVRR 84

Query: 84  VKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFM 143
            K GD V  L                                                  
Sbjct: 85  FKVGDRVACL-------------------------------------------------- 94

Query: 144 GCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCG-VTTGYGAAV---KTANVQKGDTVAV 199
              TF+QYT +++ S V   P    D       G +  G  A     +    Q G+ V V
Sbjct: 95  SSGTFAQYTAVSEKSNVLKLPDDIQDGELQAVAGSLVNGLTALTLVDEAYKPQVGEIVLV 154

Query: 200 FGA-GTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDM 258
           + A G VG  ++Q    R   R+I V   D+K Q A   GA   +N S++      IV  
Sbjct: 155 YAAAGGVGQLLIQLLHARSV-RVIAVASTDEKLQIAKSRGAEFLINSSRE-----DIVAK 208

Query: 259 LVEMTDG-GLDYTFDCTGNTDVMRSALEACHK 289
           ++E TDG G+  ++D  G  D   + L++  +
Sbjct: 209 VLEFTDGEGVGASYDSVGK-DTFETTLQSVKR 239

>TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 81/348 (23%), Positives = 138/348 (39%), Gaps = 46/348 (13%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVT-NVKPGDHV-I 91
            +V +K+    VC +D +  +G         ++GHE  G V  +G   T  VK GD V +
Sbjct: 34  RDVDIKVIACGVCGSDVHCAAGRHLPLFEDCVVGHEIIGEVVKVGPKCTAGVKVGDRVGV 93

Query: 92  ALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTR-----FHNKKGEDILHFMGCS 146
              +  C EC+ C +G    C          + PDG+        H +  E  +H     
Sbjct: 94  GAQSLSCLECESCIAGNEQYCKKNTVYTIASIYPDGSKAQGGFGSHVRTHEYFVH----- 148

Query: 147 TFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVG 206
                 +  ++  V   P         L CG  T +   ++   V  G TV + G G +G
Sbjct: 149 -----PIPKELDTVNAAP---------LLCGGITAFSPLLR-GQVGPGKTVGIVGIGGIG 193

Query: 207 LSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGG 266
              +  AK  GA ++I +  +  KK+   + GA +++  ++         D   +   G 
Sbjct: 194 HIAILFAKAMGA-KVIAISRSASKKEDCLKLGADEYIASAEG--------DDWKQKFAGS 244

Query: 267 LDYTFDCTGNTDVMRSALEACH---KGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSA 323
           +D+   C  N+   +S  ++     K  GE   IG+      +S  P  L+ G  +  SA
Sbjct: 245 IDFMLLC--NSSFSKSNFDSLFSLIKLGGEVCSIGIPDMSYRLSISPLSLL-GIKFGFSA 301

Query: 324 FGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
            G      +M  L+    + KL V+      +G   ++ AFE + +GD
Sbjct: 302 LGSRNEFQKMFELVKK-NNIKLWVETLPIGEKG---LHEAFERVENGD 345

>Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 78/347 (22%), Positives = 139/347 (40%), Gaps = 37/347 (10%)

Query: 30  PPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTN-VKPGD 88
           P   H+V +KI    VC +D +  +G       P ++GHE  G V  +G+   + +K G 
Sbjct: 30  PFYDHDVDIKIEACGVCGSDVHCAAGHWGNMKMPLVVGHEIVGKVVRLGDKSNSGLKVGQ 89

Query: 89  HV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCST 147
            V +      C EC  CKS     C     T             +++  ED   ++    
Sbjct: 90  RVGVGAQVFSCLECDRCKSDNEPYCTKFVTT-------------YSQPYED--GYISQGG 134

Query: 148 FSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT--ANVQKGDTVAVFGAGTV 205
           ++ Y  + +  +V I    P      L CG  T Y   V+      +K   V + G G++
Sbjct: 135 YANYVRVHEHFIVPIPENVPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSM 194

Query: 206 GLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG 265
           G  +   +K  GA    V+  + +KK+ A + GA  ++   ++   G+   D        
Sbjct: 195 GTLI---SKAMGA-ETYVISRSSKKKEDAIKMGADHYIATLEEGDWGEKYFDT------- 243

Query: 266 GLDYTFDCTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAF 324
             D    C  + TD+  + +    K  G  + I +    + ++ +P+ L    +   SA 
Sbjct: 244 -FDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLTLKPYGLKAVSI-SYSAL 301

Query: 325 GGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
           G IK   ++  L+S+  + K+ V+       G   ++ A E +  GD
Sbjct: 302 GSIKELKQLLALVSE-KNIKVWVETLPVGEAG---VHEALERMERGD 344

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/265 (22%), Positives = 105/265 (39%), Gaps = 52/265 (19%)

Query: 32  KAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTNVKPGDHVI 91
           K +E+ +K  Y  + H D  +        +FP + G E +GIV   GE V          
Sbjct: 72  KPYEILIKNKYIGLNHVDWKSKKYRFSIYSFPWVNGRESSGIVVRRGEKVD--------- 122

Query: 92  ALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQY 151
                   E KF   G+  +                +T + +         +  STF +Y
Sbjct: 123 --------EEKFPLGGEVFI---------------ASTTYRD---------LRTSTFQEY 150

Query: 152 TVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANV----QKGDTVAVFGAGT-VG 206
           TV     V  +  +  LD    +G  + T   A     NV    ++  ++ ++G  T VG
Sbjct: 151 TVFDSRLVWRVPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEEKKSIVIWGGSTGVG 210

Query: 207 LSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGG 266
           + VVQ AK  G ++II +  + + +Q+    GAT  ++  +  +D   IV+ + ++   G
Sbjct: 211 IFVVQLAKSLGFTKIITIT-SKKHEQYLLSLGATHIIHREEKTED---IVNEIKKICPNG 266

Query: 267 LDYTFDCTGN--TDVMRSALEACHK 289
           + +  D       + + S L A  K
Sbjct: 267 VSHGVDLISKKTAETLSSILSAESK 291

>Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 78/343 (22%), Positives = 137/343 (39%), Gaps = 37/343 (10%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIG-EGVTNVKPGDHV-I 91
           H+V +KI    VC +D +  +G       P ++GHE  G V  +G +  + +K G  V +
Sbjct: 34  HDVDIKIEACGVCGSDVHCAAGHWGNKQLPLVVGHEIVGKVVKLGPKSNSGLKIGQRVGV 93

Query: 92  ALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQY 151
                 C EC  CKS     C     T             +++  ED   ++    ++ Y
Sbjct: 94  GAQVFSCLECNRCKSDNEPYCTKFVTT-------------YSQPYED--GYVSQGGYANY 138

Query: 152 TVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT--ANVQKGDTVAVFGAGTVGLSV 209
             + +  VV +    P      L CG  T Y   ++      +K   V   G G++G  +
Sbjct: 139 VRVHEHFVVPVPKNIPSHLAAPLLCGGLTVYSPLIRNGCGPGKKVGIVGFGGIGSMGSLI 198

Query: 210 VQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDY 269
              AK  GA    V+  + +KK+ A + GA  ++   ++   G+   D          D 
Sbjct: 199 ---AKAMGA-ETYVISRSSKKKEDAMKMGADHYIATLEEEDWGEKYFDT--------FDL 246

Query: 270 TFDCTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIK 328
              C  + T +  + +    K  G  + I +    + ++ +P+ L    +   SA G IK
Sbjct: 247 IVVCASSLTGIDFNVMPKAMKVGGRIVSISIPEQHEMLTLKPYGLKAVSI-SYSALGSIK 305

Query: 329 GRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
              ++  L+S+  D K+ V+   T   G   ++ A E +  GD
Sbjct: 306 ELKQLLKLVSE-NDIKIWVE---TLPIGEAGVHEALERMEKGD 344

>SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III, shows
           a high affinity for alcohols with a double bond
           conjugated to the alcohol group
          Length = 428

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 95/372 (25%), Positives = 142/372 (38%), Gaps = 65/372 (17%)

Query: 16  EAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFPS----ILGHEGA 71
           E  K   +E   V   K H+  +KI    +CH+D   L     +G FP+     +GHE  
Sbjct: 93  ENNKLEYLENYRVQSLKPHQGLLKIKAVGLCHSDLTIL-----KGGFPASQRYAMGHEIC 147

Query: 72  G-IVESIGEGVTNVKPGDHVIALYT----AECKECKFCKSGKTNLCGSVRAT-----QGK 121
           G +V++  +     +P   V  LYT    A C  C  CK G  + C +         Q  
Sbjct: 148 GELVQTYAD-----EPKYAVGELYTVVGNAPCGGCDSCKKGWESCCTANGEKACGLGQCY 202

Query: 122 GVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTG 181
           G+  DG   +      D+ H +      +     ++  VA D              V T 
Sbjct: 203 GIGRDGG--YAEYIAIDLRHLVKVP--KELVNKPEICAVATD-------------AVLTP 245

Query: 182 YGAAVKTANVQKGD--TVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGA 239
           Y A        K       V G G +GL+ +Q A   G SR+I VD  D + Q A E GA
Sbjct: 246 YHAIKNIPGFAKTPDYCTLVIGLGGLGLNGMQVANALG-SRVICVDFKDSQLQKATEMGA 304

Query: 240 TDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGV 299
                        + +   L      G+D   D  G+T  + SA+    K  G   ++G+
Sbjct: 305 -------------EQVFKQLPTDASLGVDAVVDFVGHTSTIASAMFHL-KPHGFLALVGI 350

Query: 300 AAAGKEISTRPFQLVTGRVWKG--SAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGF 357
           +AAG EI       + G+      S +G    + E+  LI+       KV   +T    F
Sbjct: 351 SAAGYEIRFPALSYMLGKEISMIYSFWGTTSDQKEVLDLIA-----AGKVMPQVTSYSLF 405

Query: 358 TDINSAFEDLHH 369
           TD+ S  E++  
Sbjct: 406 TDLPSKIEEMRE 417

>NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253
          Length = 349

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/263 (22%), Positives = 104/263 (39%), Gaps = 57/263 (21%)

Query: 15  YEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIV 74
           Y+  K  TI+   V+   ++E+ +K +Y+ +   +AY   G+ P    P + G E +GIV
Sbjct: 36  YDVIKYKTIQTPTVE--NSNEMVIKNSYSGINFIEAYFRKGIYP-CELPYLPGREASGIV 92

Query: 75  ESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNK 134
             +G+ V N + GD V  L+     E  F K  +T                D   +    
Sbjct: 93  AEVGKDVKNFQIGDKVAYLHGETMAE--FTKIKET----------------DPIIKLSKD 134

Query: 135 KGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKG 194
             ++ L           T +  ++                            +   V+KG
Sbjct: 135 ASDENLKLYAAGLLQSLTAITLIN----------------------------EAHEVKKG 166

Query: 195 DTVAVF-GAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGK 253
           + V V+  AG VGL + Q  K++GA  I V     +K + A   GA   +N  ++     
Sbjct: 167 EYVLVYAAAGGVGLLLDQLLKMKGAHTIAVCS-TKEKLELAKANGAEFSINSKEE----- 220

Query: 254 TIVDMLVEMTDG-GLDYTFDCTG 275
            +V  ++E+T+  G+D  +D  G
Sbjct: 221 NVVQRVMEITNNKGVDVAYDSIG 243

>NDAI0H02940 Chr8 complement(717073..718158) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 73/316 (23%), Positives = 124/316 (39%), Gaps = 32/316 (10%)

Query: 30  PPKA---HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTN-VK 85
           PPK     +V +KI    VC +D +  SG   +   P I+GHE  G V  +G    N +K
Sbjct: 28  PPKPFHDRDVDIKIECCGVCGSDIHAASGHWGDIEKPLIVGHEIIGTVVKLGSKCENGLK 87

Query: 86  PGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMG 144
            GD V +      C +C  C +   + C     T G    PDG   + +K G        
Sbjct: 88  LGDRVGMGAQCYSCLKCDRCLNNNESYCQHFVTTYGMN-YPDG---YASKGG-------- 135

Query: 145 CSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGT 204
              ++++  + +  V+ I    P      L CG  T +    +      G  V + G G 
Sbjct: 136 ---YAEFVRVHEHFVIPIPENIPSHLAAPLMCGGNTIFSPLTRNG-CGPGKKVGIMGIGG 191

Query: 205 VGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTD 264
           +G   +  A   GA  +  +    +K++ A + GA  F+   ++   G    D       
Sbjct: 192 IGHMGLIFANALGA-EVYAISRTSKKREDAKKLGAHHFIATKEEPDWGTKYFDT------ 244

Query: 265 GGLDYTFDCTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSA 323
              D    C  + +D+  + +    K  G+ + I V    + ++ +PF L+ G     S 
Sbjct: 245 --FDLIVVCASSLSDIDFNVVPKTMKIGGKIVSICVPDENEVLALKPFGLL-GVSISNSH 301

Query: 324 FGGIKGRSEMGGLISD 339
            G +    +M  L+S+
Sbjct: 302 LGSVAEIKQMLKLVSE 317

>KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {ON}
           
          Length = 359

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 64/284 (22%), Positives = 105/284 (36%), Gaps = 28/284 (9%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTN-VKPGDHV-I 91
           H++ +KI    VC +D +  SG   +   P ++GHE  G +  +G    +  K GD V +
Sbjct: 34  HDIDIKIEACGVCGSDVHCASGNWGDTPKPLVVGHEIIGTIVKMGPKCNSGYKIGDRVGM 93

Query: 92  ALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQY 151
                 C EC  C +     C  V  T         ++R                 ++ Y
Sbjct: 94  GAQAMSCLECDRCINDNEPYCAKVVCTYANPYEDGYSSR---------------GGYANY 138

Query: 152 TVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQ 211
             + +   V I    P      L CG  T + + +K      G  V + G G +G   + 
Sbjct: 139 VRVHEHFAVPIPESIPSHLAAPLMCGGLTVF-SPLKRNGCGPGKKVGIIGIGGIGHMGII 197

Query: 212 GAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTF 271
            AK  GA  +  +    +K+  A + GA  F+   ++    K   D         LD   
Sbjct: 198 LAKAMGA-EVYAISRTSKKRDDAMKLGADHFIAIKEEPDWHKEYFDK--------LDLVV 248

Query: 272 DCTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLV 314
            C G+ TD+  + L       G  + I +    + +  +PF LV
Sbjct: 249 ICAGSLTDIDFNTLPNILTVGGRIVSIAIPEQHEVLKMKPFGLV 292

>KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON} 
          Length = 358

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 76/346 (21%), Positives = 125/346 (36%), Gaps = 43/346 (12%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGV-TNVKPGDHV-I 91
           H++ +++    VC +D +  SG   E   P ++GHE  GIV   G    + +K  D V +
Sbjct: 34  HDIDIRVLACGVCGSDIHCASGHWGEIPKPLVVGHEIIGIVVKTGPRCDSGLKVEDRVGV 93

Query: 92  ALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQY 151
                 C +C  C       C +  +T  K    DG              ++    ++ Y
Sbjct: 94  GAQALSCLDCDRCTHDNEPYCPNRVSTYAKSYR-DG--------------YVSQGGYADY 138

Query: 152 TVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTA-----NVQKGDTVAVFGAGTVG 206
             + +   V I    P      L CG  T +   ++        V       +   G + 
Sbjct: 139 VRVHEHFAVLIPESIPSHLAAPLMCGGLTVFSPLLRNGCGPGKKVGILGIGGIGHMGVL- 197

Query: 207 LSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGG 266
           L+   GA+V   SR         KK  A + G   F+   ++    +   D         
Sbjct: 198 LAKAMGAEVYAISR------TSSKKADAVKLGTDHFIATKEEPDWHEKYFDT-------- 243

Query: 267 LDYTFDCTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAFG 325
           LD    C G+ TDV    L       G  + I +    + +  +PF LV G     S  G
Sbjct: 244 LDLLVICAGSLTDVDFDTLPKIMTVGGRVVSIAIPEQHEILKLKPFGLV-GVSIANSLLG 302

Query: 326 GIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
            +K   E+  L++   + K+ V+      +G   +N AF  +  GD
Sbjct: 303 SMKELKELLELVAK-NNIKIWVETIPIGEKG---VNEAFTRMEKGD 344

>CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {ON}
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046c ZTA1
          Length = 333

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 119/310 (38%), Gaps = 76/310 (24%)

Query: 35  EVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTNVKPGDHVIALY 94
           +V VK  Y  V   +AY   G  P    P +LG E +G V  +G  V + K GD V    
Sbjct: 36  DVLVKNKYAGVNFIEAYFRKGYYP-CELPYVLGREASGEVVQVGSEVKDFKIGDKVA--- 91

Query: 95  TAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVL 154
                                                          ++G STF+QYT  
Sbjct: 92  -----------------------------------------------YLGGSTFAQYTKK 104

Query: 155 A-DVSVVAIDPKAPLDKTCLLGCGVT---TGYGAAVKTANVQKGDTVAVFGA-GTVGLSV 209
           + +  ++ +    P +   L G  +    T      +   V +GD + V+ A G VG  +
Sbjct: 105 STENHIMNLGQSCPDEDLKLYGSSLVQCLTAISFIDEAYKVMEGDYILVYAASGGVGSIL 164

Query: 210 VQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDG-GLD 268
            Q    R A  +I V  + +K   A E GA   +N ++D      I++ +++ T+G G+ 
Sbjct: 165 CQLISQRKA-HVIAVASSAEKLAMAKENGAEFLINYAED-----DILEKVMQYTNGKGVH 218

Query: 269 YTFDCTGNTDVMRSALEACHKGWGESIIIGVAA------AGKEISTRPFQLVTGRVWKGS 322
             FD  G  D   + L A  +  G  +  G A+      A  ++S +  +L+  +V+   
Sbjct: 219 AAFDSIGK-DTFETDLAALRRK-GTLVSFGNASGMVPPFAINKLSPKNLKLLRPQVY--- 273

Query: 323 AFGGIKGRSE 332
             G +  RSE
Sbjct: 274 --GYLGTRSE 281

>TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 83/365 (22%), Positives = 132/365 (36%), Gaps = 57/365 (15%)

Query: 24  EEIVVDPPKA--HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGV 81
           ++I  DP K   ++V +KI    VC +D +  S          ++GHE  G V  +G   
Sbjct: 22  KKISYDPKKFDDYDVDIKIEACGVCGSDVHRASSNWGPVKANQVVGHEIVGRVVKLGPKC 81

Query: 82  T-NVKPGDHV-IALYTAECKECKFCKSGKTNLC------GSVRATQGKGVMPDGTTRFHN 133
              +K GD V +      C  CK CKS     C      G+   T   G +  G    H 
Sbjct: 82  KLGLKVGDRVGVGAQAKSCLNCKRCKSDNEPYCKSKDRVGTYSGTYSDGYVSQGGYASHV 141

Query: 134 KKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT----A 189
           +  E   HF                V  I    P +    L CG  T +   ++      
Sbjct: 142 RTHE---HF----------------VFKIPDNIPTELAAPLLCGGVTVFSPLLRNGCGPG 182

Query: 190 NVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDL 249
                  +   G   +  +   GA+V   SR      +  KK+ + + GA  ++   ++ 
Sbjct: 183 KKVGVVGIGGIGHMGILFAKAMGAEVYAISR------SSSKKEDSLKLGADYYIATQEEK 236

Query: 250 KDGKTIVDMLVEMTDGGLDYTFDCTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEIST 308
               T  D         LD    C  + +D+    L A     G+ + I +  A ++++ 
Sbjct: 237 DWATTYADT--------LDLIVLCASSLSDINIDDLVATMTIGGKIVSIAIPDASQQLTL 288

Query: 309 RPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLK--VDEFITHRRGFTDINSAFED 366
           +PF L+ G     SA G    R E+  L+    + K+K  V        G   +N  FE 
Sbjct: 289 KPFGLL-GVYISNSALG---SRKEIIQLLDLVSEKKIKPWVQTVPISEAG---VNEVFER 341

Query: 367 LHHGD 371
           +  GD
Sbjct: 342 MEKGD 346

>KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 366

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 46/108 (42%), Gaps = 5/108 (4%)

Query: 25  EIVVDPPK---AHEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGV 81
           E VV P K     +V ++I    VC +D +   G   E   P ++GHE  G V  +G+  
Sbjct: 23  EKVVYPAKQFNPRDVDIEIEACGVCGSDVHCAKGNWGEMKLPLVVGHEIIGKVVRLGDKC 82

Query: 82  -TNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDG 127
            T +K GD V +    + C +C  C +     C     T  +    DG
Sbjct: 83  DTGLKVGDRVGVGAQVSACLDCNRCNNDNEQYCPKFVTTYSQPYFEDG 130

>SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 359

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 79/349 (22%), Positives = 128/349 (36%), Gaps = 41/349 (11%)

Query: 30  PPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGV-TNVKPGD 88
           P   ++V ++I    VC +D +  +G   +   P ++GHE  G V  +G    T VK GD
Sbjct: 30  PFYDNDVDIEIDACGVCGSDVHCAAGHWGDTQKPLVVGHEVIGRVVRVGPKCHTGVKIGD 89

Query: 89  HV-IALYTAECKECKFCKSGKTNLCGSVRATQGK----GVMPDGTTRFHNKKGEDILHFM 143
            V +      C +C  CKS     C     T  +    G +  G    H +  E   HF 
Sbjct: 90  RVGVGAQVYSCLKCDRCKSDNEPYCPKFVTTYSQPYEDGYVSQGGYASHIRCHE---HF- 145

Query: 144 GCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAG 203
                          V+ I    P      L CG  T Y    +           V   G
Sbjct: 146 ---------------VIPIPENIPTHLAAPLLCGGITVYSPLSRNGCGPGKKVGIVGIGG 190

Query: 204 TVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMT 263
              + ++  AK  GA  +  +  +  KK+ A++ GA  F+   ++    +   D      
Sbjct: 191 IGHMGLI-FAKAMGA-EVYAISRSSAKKEDASKLGADHFIATKEEENWSQKYFDT----- 243

Query: 264 DGGLDYTFDCTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGS 322
               D    C  + TDV    +    K  G+ + I V    + +  +P  L+ G     S
Sbjct: 244 ---FDLVVVCASSLTDVDFDKMSRVMKIGGKIVSISVPEQSERLVLKPLGLL-GVSISNS 299

Query: 323 AFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
             G  K   ++  L+S+  + K+ V+      +G   +  AFE +  GD
Sbjct: 300 GLGSRKEIIQLLQLVSE-KNLKIWVETLPVGEKG---VREAFERMDKGD 344

>Skud_3.175 Chr3 (288164..289249) [1086 bp, 361 aa] {ON} YCR105W
           (REAL)
          Length = 361

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 79/350 (22%), Positives = 130/350 (37%), Gaps = 50/350 (14%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFP--SILGHEGAGIVESIGEGV-TNVKPGDHV 90
           H+V ++I    +C +D +  +G    G  P   +LGHE  G V  +G    T +K GD V
Sbjct: 34  HDVDIEIEACGICGSDFHIAAG--NWGPVPKNQVLGHEIIGRVVKVGPKCHTGIKLGDRV 91

Query: 91  -IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFS 149
            +      C EC+ CKS     C             DG              ++    F+
Sbjct: 92  GVGAQALACLECERCKSDNEQYCTIDHVLTMWTPYKDG--------------YIAQGGFA 137

Query: 150 QYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT----ANVQKGDTVAVFGAGTV 205
            +  L +   + I    P      L CG  T +   ++             +   G   +
Sbjct: 138 SHVRLHEHFAIPIPENIPSPLAAPLLCGGITVFSPLLRNGCGPGKKVGIVGIGGIGHMGI 197

Query: 206 GLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGK----TIVDMLVE 261
            L+   GA+V   SR         KK+ +   GA  ++   +D KD      T +D+LV 
Sbjct: 198 LLAKAMGAEVYAFSR------GHSKKEDSMRLGADHYIATLED-KDWTEKYFTTLDLLVV 250

Query: 262 MTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKG 321
            +    +  FD      VM+          G  + I     G+++  +P  L+ G     
Sbjct: 251 CSSSLSEVNFDSV--IKVMKIG--------GSIVSIAAPEHGEKLVLQPLGLM-GVSISS 299

Query: 322 SAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
           SA G  K   ++  L+S+  + K+ V+E      G   ++ AF  +  GD
Sbjct: 300 SAIGSRKEIEQLLKLVSE-KNVKIWVEELPISGAG---VHQAFTRMEKGD 345

>Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159W
           (REAL)
          Length = 89

 Score = 35.4 bits (80), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 219 SRIIVVDINDQKKQWANEFGATDFVNPSK-DLKDGKTIVDMLVEMTDG-GLDYTFDCTG 275
           S +I VD+ D K Q A +FGAT   N SK  + + + + D L ++  G   D  F+C+G
Sbjct: 1   SDVIFVDVFDNKLQRAKDFGATGTFNSSKFSVDEAQQLADELEKLLGGHQADVVFECSG 59

>Kpol_1057.24 s1057 (53467..54549) [1083 bp, 360 aa] {ON}
           (53467..54549) [1083 nt, 361 aa]
          Length = 360

 Score = 37.4 bits (85), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 87/347 (25%), Positives = 136/347 (39%), Gaps = 47/347 (13%)

Query: 35  EVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIG-EGVTNVKPGDHV-IA 92
           +V +KI    VC +D +  +      A   ++GHE  G V  +G +  T +K GD V + 
Sbjct: 35  DVDIKIEACGVCGSDVHCAASHWGPVAEKQVVGHEIIGRVLKVGPKCTTGIKVGDRVGVG 94

Query: 93  LYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYT 152
                C EC  CKS   + C     T     + DG              ++    ++ + 
Sbjct: 95  AQAWSCLECSRCKSDNESYCPKSVWTYSIPYI-DG--------------YVSQGGYASHI 139

Query: 153 VLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT--ANVQKGDTVAVFGAGTVGLSVV 210
            L +   + I  K   +    L CG  T Y   ++      +K   V + G G +GL   
Sbjct: 140 RLHEHFAIPIPDKLSNELAAPLLCGGITVYSPLLRNGCGPGKKVGIVGIGGIGHMGLLFA 199

Query: 211 Q--GAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKT----IVDMLVEMTD 264
           +  GA+V   SR         K+  A + GA  F+   +D KD  T     +D+LV    
Sbjct: 200 KGMGAEVYAFSR------THSKEADAKKLGADHFIATLED-KDWTTKYFDTLDLLVICAS 252

Query: 265 GGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAF 324
              D  FD    T +M+   +         I I   AA + ++ +PF L+ G     SA 
Sbjct: 253 SLTDINFDEL--TKIMKVNTKI--------ISISAPAADEVLTLKPFGLI-GVTIGNSAI 301

Query: 325 GGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
           G    R E+  L++   +  +K     T   G   +N AFE +  GD
Sbjct: 302 G---SRREIEHLLNFVAEKDIK-PWVETLPVGEAGVNEAFERMDKGD 344

>Smik_3.203 Chr3 (301227..301247,301251..301589) [360 bp, 120 aa]
           {ON} YCR105W (REAL)
          Length = 120

 Score = 35.0 bits (79), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 6/87 (6%)

Query: 30  PPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFP--SILGHEGAGIVESIGEGV-TNVKP 86
           P   H++ ++I    +C +D +  +G    G  P   +LGHE  G V  +G    T +K 
Sbjct: 29  PFADHDIDIEIEDCGICGSDFHIAAG--NWGPVPKNQVLGHEIIGRVVKVGPKCHTGIKI 86

Query: 87  GDHV-IALYTAECKECKFCKSGKTNLC 112
           GD V +      C EC+ CKS     C
Sbjct: 87  GDRVGVGAQALACLECERCKSDNEQYC 113

>Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON}
           (51360..52445) [1086 nt, 362 aa]
          Length = 361

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 63/158 (39%), Gaps = 17/158 (10%)

Query: 32  KAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIG-EGVTNVKPGDHV 90
           K  +V ++I    VC +D +  SG   E     ++GHE  G V  +G E  T +K GD V
Sbjct: 32  KECDVDIEIEACGVCGSDIHCASGDWGERRDKLVVGHEVIGRVIKLGPECHTGLKIGDRV 91

Query: 91  -IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFS 149
            +    A C +C+ C+      C     T  +   PDG              ++    ++
Sbjct: 92  GVGAQVASCLDCERCEHDNEPYCPKFVTTYNQA-YPDG--------------YISQGGYA 136

Query: 150 QYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVK 187
            +  + +  V+ +  K P      L CG  T Y   V+
Sbjct: 137 SHIRVHEHFVIPVPEKIPTHLAAPLLCGGITVYSPLVR 174

>YCR105W Chr3 (309070..310155) [1086 bp, 361 aa] {ON}
           ADH7NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 361

 Score = 36.6 bits (83), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 38/83 (45%), Gaps = 6/83 (7%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFP--SILGHEGAGIVESIGEGV-TNVKPGDHV 90
           H+V V+I    +C +D +    V   G  P   ILGHE  G V  +G    T VK GD V
Sbjct: 34  HDVDVEIEACGICGSDFHI--AVGNWGPVPENQILGHEIIGRVVKVGSKCHTGVKIGDRV 91

Query: 91  -IALYTAECKECKFCKSGKTNLC 112
            +      C EC+ CKS     C
Sbjct: 92  GVGAQALACFECERCKSDNEQYC 114

>Kpol_257.4 s257 complement(12348..13430) [1083 bp, 360 aa] {ON}
           complement(12348..13430) [1083 nt, 361 aa]
          Length = 360

 Score = 36.6 bits (83), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 78/344 (22%), Positives = 133/344 (38%), Gaps = 41/344 (11%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIG-EGVTNVKPGDHV-I 91
            +V VKI    VC +D +  +          ++GHE  G V  +G +  T +K GD V +
Sbjct: 34  QDVDVKIEACGVCGSDIHCAASHWGPVVKNQVVGHEIVGRVVKVGPKCTTGIKIGDRVGV 93

Query: 92  ALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQY 151
               A C +C  C++     C  V  T G+   PDG              ++    ++ +
Sbjct: 94  GAQVASCLDCSRCQNDNEPYCPRVVTTYGQA-YPDG--------------YVSQGGYASH 138

Query: 152 TVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVV- 210
             + +   + +  + PL     L CG  T Y   ++           V   G   + ++ 
Sbjct: 139 VRVHEHFAIPVPEELPLHLAAPLLCGGITVYSPLLRGGCGPGKKVGIVGIGGIGHMGILF 198

Query: 211 ---QGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGL 267
               GA+V   SR      +  K++ A E GA  ++   +D    +   D         L
Sbjct: 199 AKAMGAEVYAFSR------SHSKEKDAKELGADHYIATLEDKDWTEKYFDT--------L 244

Query: 268 DYTFDCTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGG 326
           D    C  + TDV    L    K   + + I V +  + ++ +PF L+ G     SA G 
Sbjct: 245 DLIVVCASSLTDVNFDELIKVMKVNTKILSISVPSIDETLTLKPFGLL-GVTIGNSALGS 303

Query: 327 IKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHG 370
            K   ++  L+ D  D K+ V++    + G   +  AFE +  G
Sbjct: 304 RKEIEQLLKLVVD-KDIKIWVEQL---QVGEAGVAEAFERMDKG 343

>KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 49/222 (22%), Positives = 89/222 (40%), Gaps = 30/222 (13%)

Query: 31  PKA---HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIG-EGVTNVKP 86
           PKA   H+V ++I    VC +D +T +    E     ++GHE  G +  +G E  + +K 
Sbjct: 34  PKAFGPHDVDIEIECCGVCGSDIHTAASHWRELRDKMVVGHEIVGRIVKLGPECDSGLKI 93

Query: 87  GDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGC 145
           GD V +   +  C EC  CK      C    +T             +N+  +D   ++  
Sbjct: 94  GDRVGVGAQSFSCLECDRCKENNEPYCPKFVST-------------YNRPYDD--GYISQ 138

Query: 146 STFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT---ANVQKGDTV-AVFG 201
             ++ +  L +   + +  + P +    L CG  T +   ++     N +   +V  V G
Sbjct: 139 GGYASHVRLHEHFAIPVPDEIPSELAAPLMCGGITVFSPLLRNGCGPNKKLASSVLVVLG 198

Query: 202 AGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFV 243
                L    GA+V   SR       + K++ +   GA  ++
Sbjct: 199 IWAYCLLRQVGAEVYAFSR------TNSKREDSVNLGADHYI 234

>Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON}
           YJR159W (REAL)
          Length = 68

 Score = 32.7 bits (73), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 185 AVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFV 243
           AV+   V+ GD V V     +GL V    +  G  +++++   D KKQ + +FG T F+
Sbjct: 11  AVRLPQVKYGDCVVVISVRAIGLLVDAVFREFGVDKVVLMSTQDSKKQ-SEQFGGTGFI 68

>Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)
          Length = 125

 Score = 34.3 bits (77), Expect = 0.17,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 2/80 (2%)

Query: 35  EVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTNVKPGDHVIAL- 93
           +V +K+    VC +D +  +G       P + GHE  G +  +G   ++    D  + + 
Sbjct: 35  DVEIKVEACGVCGSDIHCAAGHWGPRNDPLVAGHEIVGRIVRMGSRCSSQLKVDMRVGMG 94

Query: 94  -YTAECKECKFCKSGKTNLC 112
             T  C +C  CK G+ N C
Sbjct: 95  AITFSCLKCSGCKKGEENYC 114

>Kpol_529.30 s529 (89344..90426) [1083 bp, 360 aa] {ON}
           (89344..90426) [1083 nt, 361 aa]
          Length = 360

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 79/356 (22%), Positives = 138/356 (38%), Gaps = 43/356 (12%)

Query: 24  EEIVVDPPKA--HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIG-EG 80
           +++  +P K    +V +KI    VC +D +  +          ++GHE  G V  +G + 
Sbjct: 22  KKVTYEPKKFDDQDVDIKIEACGVCGSDIHCAASHWGPVVKNQVVGHEIVGRVVKVGPKC 81

Query: 81  VTNVKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDI 139
            T +K GD V +    A C EC  C++     C     T G+   PDG            
Sbjct: 82  TTGIKIGDRVGVGAQVASCLECSRCQNDNEPYCPRFVTTYGQP-YPDG------------ 128

Query: 140 LHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAV 199
             ++    ++ +  + +   + +  + PL     L CG  T Y   ++           V
Sbjct: 129 --YVSQGGYASHVRVHEHFAIPVPEELPLHLAAPLLCGGITVYSPLLRGGCGPGKKVGIV 186

Query: 200 FGAGTVGLSVV----QGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTI 255
              G   + ++     GA+V   SR      +  K++ A E GA  ++   +D    +  
Sbjct: 187 GIGGIGHMGILFAKAMGAEVYAFSR------SHSKEKDAKELGADHYIATLEDKDWTEKY 240

Query: 256 VDMLVEMTDGGLDYTFDCTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLV 314
            D         LD    C  + TDV    L    K   + + I V +  + ++ +PF L+
Sbjct: 241 FDT--------LDLIVVCASSLTDVNFDELIKVMKVNTKILSISVPSIDETLTLKPFGLL 292

Query: 315 TGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHG 370
            G     SA G  K   ++  L+ D  D K+ V++    + G   +  AFE +  G
Sbjct: 293 -GVTIGNSALGSRKEIEQLLKLVVD-KDIKIWVEQL---QVGEAGVAEAFERMDKG 343

>KAFR0C01550 Chr3 complement(318350..319429) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 80/353 (22%), Positives = 126/353 (35%), Gaps = 49/353 (13%)

Query: 30  PPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIG-EGVTNVKPGD 88
           P  +H+V ++I    VC +D +  +    E     ++GHE  G V  +G E  T +K GD
Sbjct: 30  PFDSHDVDIEIECCGVCGSDIHCAASHWSEVREDLVVGHEVIGRVVKVGPECNTGLKLGD 89

Query: 89  HV-IALYTAECKECKFCKSGKTNLCGSVRATQGK----GVMPDGTTRFHNKKGEDILHFM 143
            V +      C EC  CK      C     T  +    G +  G    H +  E   HF 
Sbjct: 90  RVGVGAQVFSCLECDRCKEDNEPYCQKFVTTYNQPYANGYISQGGYASHIRVHE---HF- 145

Query: 144 GCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT---ANVQKGDTVAVF 200
                          VV I  + P +    L CG  T +   ++     N + G      
Sbjct: 146 ---------------VVPIPDEIPSELAAPLMCGGITVFSPLLRNGCGPNKKVGIVGIGG 190

Query: 201 GAGTVGL-SVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDML 259
                 L +   GA+V   SR      +D KK+ + + GA  ++    D        +  
Sbjct: 191 IGHMGVLFAKAMGAEVYAFSR------SDSKKEDSLKLGADHYIATKDD--------EGW 236

Query: 260 VEMTDGGLDYTFDCTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRV 318
            E     LD    C  + TD+         +  G  I I      ++++  P  L+  ++
Sbjct: 237 EEKYYNTLDLVVVCASSLTDIQLDKFVKVMRIGGTIISITAPDKTEKLTLSPLGLLGVKI 296

Query: 319 WKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
              S  G I     M  L+    + K+ V+      RG   +N  FE +  GD
Sbjct: 297 -GNSGLGSIVEIKTMLDLVVK-KNVKIWVETVPISERG---VNEVFERMVKGD 344

>TBLA0A06640 Chr1 (1621352..1622437) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 67/308 (21%), Positives = 115/308 (37%), Gaps = 49/308 (15%)

Query: 21  LTIEEIVVDPPK--AHEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIG 78
           L  +++  DP      ++ ++I    VC +D +T +          ++GHE  G V  IG
Sbjct: 19  LNPKKVSYDPKTFGEQDIDIEIMACGVCGSDTHTAASRWGPCPNSQVVGHEIIGKVVKIG 78

Query: 79  EGVTN-VKPGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKG 136
               + +K G  V +      C EC+ CK+     C +   T   G+ P+G         
Sbjct: 79  SKCEDGLKIGQRVGVGAQVFSCLECQRCKNNNEQYCTNFVTTY-TGIYPNG--------- 128

Query: 137 EDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKG-- 194
                ++    ++ +  + +  V+ I  + P +    L CG     GA V T  ++ G  
Sbjct: 129 -----YIAQGGYASHIRVHEHFVIPIPDEIPTELAAPLMCG-----GATVFTPLLRNGCG 178

Query: 195 -------DTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSK 247
                    +   G   + L+   GA+V   SR       + K+  A + GA  +     
Sbjct: 179 PNKKVGIIGIGGIGHMGILLAKAMGAEVYAFSR------GENKRADAMDLGADHYYATGT 232

Query: 248 DLKDGKTIVDMLVEMTDGGLDYTFDCTGN-TDVMRSALEACHKGWGESIIIGVAAAGKEI 306
           +  D     D+        LD    C  + TD+         K  G    I V    +++
Sbjct: 233 EGWDK----DLF-----NTLDLAVICASSLTDINLDQYIKIMKIGGSIQSISVPDVTEKL 283

Query: 307 STRPFQLV 314
           + RPFQLV
Sbjct: 284 TLRPFQLV 291

>Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR105W
           - Hypothetical ORF [contig 68] FULL
          Length = 364

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 5/94 (5%)

Query: 24  EEIVVDPPK--AHEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGV 81
           E+    PP     ++ ++I    VC +D + ++G       P  +GHE  G + ++GE V
Sbjct: 22  EKFSYSPPLLGPEDIELEIEACGVCGSDIHAVAGDWGRLYKPFAVGHEIVGKISAMGEQV 81

Query: 82  TNVK--PGDHV-IALYTAECKECKFCKSGKTNLC 112
              K   GD V +      C +C  C  G+   C
Sbjct: 82  NKEKFHLGDRVGVGAQIDSCGKCTRCSRGRQQNC 115

>Suva_7.5 Chr7 (12884..13522) [639 bp, 212 aa] {ON} YLR460C (REAL)
          Length = 212

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 47/107 (43%), Gaps = 9/107 (8%)

Query: 192 QKGDTVAVFGAGT-VGLSVVQGA-KVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDL 249
           Q+   V ++G  T VG  V+Q A K+ G ++IIVV     +KQ   E+GA +      D 
Sbjct: 9   QRDHPVLIWGGATAVGQHVIQLAKKLNGFTKIIVVASQKHEKQ-LKEYGADELF----DY 63

Query: 250 KDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESII 296
            D   +    ++     + Y  DC  N D ++   +        +II
Sbjct: 64  HDADVVEQ--IKKKYKNIPYLVDCVANVDTLQQVYKCAADELDATII 108

>TPHA0F02090 Chr6 (465913..466995) [1083 bp, 360 aa] {ON} 
          Length = 360

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 57/143 (39%), Gaps = 13/143 (9%)

Query: 10  LAAVAYEAGKPLTIEEIVVDPPKA---HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSIL 66
              +A   GK  T  + +  PPK     +V ++I    VC +D +  +          ++
Sbjct: 7   FQGIAVTDGKDWTHPKKISFPPKKFDDRDVDIEIEACGVCGSDVHCAASHWGPVKDNQVV 66

Query: 67  GHEGAGIVESIGEGV-TNVKPGDHV-IALYTAECKECKFCKSGKTNLC-GSVR----ATQ 119
           GHE  G V  +G    T +K GD V +      C +C  CK    N C G++      T 
Sbjct: 67  GHEIIGKVVKVGPKCNTGIKVGDRVGVGAQALACLDCNRCKEDHENYCFGNIWTYGGPTY 126

Query: 120 GKGVMPDGTTRFHNKKGEDILHF 142
             G +P G    H +  E   HF
Sbjct: 127 ADGYIPQGGYASHIRVHE---HF 146

>TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON} 
          Length = 405

 Score = 33.9 bits (76), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 101/263 (38%), Gaps = 67/263 (25%)

Query: 32  KAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGIVESIGEGVTNVKPGDHVI 91
           K +E+ V+  Y  + H D  +        +FP I G E +GIV   G  V          
Sbjct: 71  KEYEILVQNKYVGLNHVDWKSKKYRFNIYSFPWINGRESSGIVIRRGSKVDT-------- 122

Query: 92  ALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQY 151
                     KF  S +  L                +T + +         +  STF +Y
Sbjct: 123 ---------QKFPISAEVFLA---------------STSYRD---------LETSTFQEY 149

Query: 152 TVLADVSVVAIDPKAPLDKTCL-----------LGCGVTTGYGAAVKT---------ANV 191
           TV  D  +V   P+  L    L           +G G+ T  G+A+ +         A+ 
Sbjct: 150 TVF-DSRLVWKLPQYRLPNGRLHKRFDLEFAAGVGVGLVTA-GSAISSLVDLSLRDQADH 207

Query: 192 QK-GDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLK 250
           QK G+ V   G+ +VGL V+Q AK       IVV    + K++  E GA+  ++  +  +
Sbjct: 208 QKLGNIVIWGGSSSVGLYVIQLAKASKMFEKIVVVSASKHKEYLLELGASCIIDRHQSEE 267

Query: 251 DGKTIVDMLVEMTDGGLDYTFDC 273
           +   I+D ++     G+D+  D 
Sbjct: 268 E---ILDDILSHCPEGIDFGIDV 287

>KLLA0B02673g Chr2 (235478..236803) [1326 bp, 441 aa] {ON} similar
           to uniprot|P08432 Saccharomyces cerevisiae YKL184W SPE1
           Rate limiting step of polyamine biosynthesis pathway
           Ornithine decarboxylase
          Length = 441

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 62/143 (43%), Gaps = 20/143 (13%)

Query: 238 GATDFVNPSKDLKDGKTIVDM-------LVEMTDGGLDYTFD-CTGNTDVMRSALEACHK 289
           GA+DF   ++ +KDG+ + DM        ++M D G  Y FD  T   DV+ +AL+    
Sbjct: 229 GASDFSTVTQAVKDGRKVFDMAESRGLPALKMLDVGGGYQFDTITEVADVLNAALDYFFP 288

Query: 290 GWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAF---------GGIKGRSEMGGLISDY 340
               S +  +A  G+      F L    + K +            G+ G   M  ++ D+
Sbjct: 289 QETHSDVSFIAEPGRYFVATAFTLAATVIGKRNNSDSESMIYINDGVYGN--MNCILFDH 346

Query: 341 MDGKLKVDEFITHRRGFTDINSA 363
            +   +V  +  +R  + DINS+
Sbjct: 347 QEPSPRV-LYHKNRFHYMDINSS 368

>TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 37/90 (41%), Gaps = 11/90 (12%)

Query: 34  HEVRVKIAYTAVCHTDAYTLSG----------VDPEGAFPSILGHEGAGIVESIGEGVTN 83
           H++ +++    +C ++ ++L                G    ++GHE  G V  +GE VT 
Sbjct: 38  HDIDIEVECCGICASELFSLKNEWSNAPLACLSSSYGPKSQVVGHEVIGKVVKVGEKVTL 97

Query: 84  VKPGDHV-IALYTAECKECKFCKSGKTNLC 112
            K G  V +    + C +C  C S     C
Sbjct: 98  AKLGQRVGLGAQASSCMQCGRCSSNNEQYC 127

>ZYRO0G00330g Chr7 complement(22695..26561) [3867 bp, 1288 aa] {ON}
            highly similar to uniprot|P28273 YKL215C Saccharomyces
            cerevisiae Hypothetical ORF
          Length = 1288

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 51/113 (45%), Gaps = 5/113 (4%)

Query: 226  INDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALE 285
            I    KQ A  FG T+F    +DL D  T++ + V++     +Y FD  G +  +   + 
Sbjct: 980  IKKMLKQLAQHFGQTEF--SGEDLMDDGTLIKLKVKLDIEKEEYVFDFDGTSPQVYGNIN 1037

Query: 286  ACHKGWGESIIIGVA-AAGKEISTRP--FQLVTGRVWKGSAFGGIKGRSEMGG 335
            A       +I+  +    G++I       + +T ++ KGS    I G + +GG
Sbjct: 1038 APEAITNSAILYCLRCLVGEDIPLNQGCLKPITVKIPKGSVLSPINGIAVVGG 1090

>ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 33.5 bits (75), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 38/92 (41%), Gaps = 11/92 (11%)

Query: 33  AHEVRVKIAYTAVCHTDAYTLSG----------VDPEGAFPSILGHEGAGIVESIGEGVT 82
           AH+V +++    +C ++ ++L                G    ++GHE  G V ++G+ V+
Sbjct: 35  AHDVDIEVECCGICASELFSLKNEWSSEPLTCMTSSYGPKSQVVGHEVVGKVVAVGDKVS 94

Query: 83  NVKPGDHV-IALYTAECKECKFCKSGKTNLCG 113
             K GD + +    + C  C  C       C 
Sbjct: 95  LCKVGDRIGLGAQASSCMSCPRCHGNNEQYCA 126

>KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {ON}
           conserved hypothetical protein
          Length = 273

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 69/156 (44%), Gaps = 32/156 (20%)

Query: 149 SQYTVLADVSVVAIDPK-APLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGA-GTVG 206
           ++Y V+++   VA+ PK     +   LG  +TT    A++ A V+  D V+V GA G+VG
Sbjct: 51  AEYCVVSE-DAVALKPKNVTFAQAACLGVPLTTA-SLALQRAAVEPSDCVSVIGASGSVG 108

Query: 207 LSVVQ-----GAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVE 261
             VVQ     G +V  A+R    D+   + +   EF A                   L  
Sbjct: 109 SYVVQLAQSMGCRVLRAARQSPTDVCIAEDE---EFSA-------------------LTS 146

Query: 262 MTDG-GLDYTFDCTGNTDVMRSALEACHKGWGESII 296
           +T G G+D   D  G   +M++A E    G   ++I
Sbjct: 147 LTQGRGVDVVIDTVGMPALMKAAAEKLAHGGRMAVI 182

>YNL134C Chr14 complement(372451..373581) [1131 bp, 376 aa] {ON}
           Putative protein of unknown function with similarity to
           dehydrogenases from other model organisms; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and nucleus and is induced by the
           DNA-damaging agent MMS
          Length = 376

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 69/305 (22%), Positives = 116/305 (38%), Gaps = 70/305 (22%)

Query: 1   MSEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLS-GVDPE 59
           MS   P T + AV  E GK +  ++I +   +   V +K    A   TD   +   + P+
Sbjct: 1   MSASIPET-MKAVVIENGKAVVKQDIPIPELEEGFVLIKTVAVAGNPTDWKHIDFKIGPQ 59

Query: 60  GAFPSILGHEGAGIVESIGEGVTNVK------------------PGDHVIALYTAECKEC 101
           GA   +LG + AG +  +G  V   +                  P +   A Y+A   E 
Sbjct: 60  GA---LLGCDAAGQIVKLGPNVDAARFAIGDYIYGVIHGASVRFPSNGAFAEYSAISSET 116

Query: 102 KFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVA 161
            +  + +  LCG       K  +P+G  +                     ++   VS+  
Sbjct: 117 AYKPAREFRLCG-------KDKLPEGPVK---------------------SLEGAVSL-- 146

Query: 162 IDPKAPLDKTCLLGCGVTTGYGAAV--KTANVQKGDTVAVFGAGT-VGLSVVQGA-KVRG 217
                P+  T   G  +T  +G  +  K +  Q+   +  +G  T VG  ++Q A K+ G
Sbjct: 147 -----PVSLTTA-GMILTHSFGLDMTWKPSKAQRDQPILFWGGATAVGQMLIQLAKKLNG 200

Query: 218 ASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNT 277
            S+IIVV     +K    E+GA +      D  D   I    ++     + Y  DC  NT
Sbjct: 201 FSKIIVVASRKHEK-LLKEYGADELF----DYHDADVIEQ--IKKKYNNIPYLVDCVSNT 253

Query: 278 DVMRS 282
           + ++ 
Sbjct: 254 ETIQQ 258

>AFR625C Chr6 complement(1570346..1571452) [1107 bp, 368 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR035C
           (RRP43)
          Length = 368

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 3/88 (3%)

Query: 220 RIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDV 279
           R IV+D+N     +A+ FG TD  N S+ L+ G+   DM VE+ +  L    +       
Sbjct: 262 RSIVLDLNKNNIAYASGFGVTDLDNESR-LEPGED--DMAVEVPEKILLVDLEGEAEEAS 318

Query: 280 MRSALEACHKGWGESIIIGVAAAGKEIS 307
           ++S L       G+   I +   G  I+
Sbjct: 319 IKSTLSLVTSPGGQLTTISLIGGGSRIT 346

>KLLA0C18975g Chr3 complement(1684573..1688433) [3861 bp, 1286 aa]
            {ON} highly similar to uniprot|P28273 YKL215C
            Saccharomyces cerevisiae Hypothetical ORF
          Length = 1286

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 50/113 (44%), Gaps = 5/113 (4%)

Query: 226  INDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALE 285
            I    ++ AN F  T+F    +DL D  + + + V +     +YTFD  G +  +   L 
Sbjct: 980  IKSMLRKMANHFNTTEF--SGEDLMDDGSTIKLKVNLDVENEEYTFDFEGTSPQIYGNLN 1037

Query: 286  ACHKGWGESIIIGVA-AAGKEISTRP--FQLVTGRVWKGSAFGGIKGRSEMGG 335
            A       +I+  +    G++I       + +T ++ KGS     KG + +GG
Sbjct: 1038 APEAITNSAILYCLRCLVGEDIPLNQGCLKPLTIKIPKGSILSPTKGMAVVGG 1090

>YLR460C Chr12 complement(1059757..1060887) [1131 bp, 376 aa] {ON}
           Member of the quinone oxidoreductase family,
           up-regulated in response to the fungicide mancozeb;
           possibly up-regulated by iodine
          Length = 376

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 12/94 (12%)

Query: 192 QKGDTVAVFGAGTVGLSVVQGA-KVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLK 250
           +KG  +   GA  VG S++Q A K+ G ++IIVV     +K    E+GA +      D  
Sbjct: 174 RKGPILLWGGATAVGQSLIQLANKLNGFTKIIVVASRKHEK-LLKEYGADELF----DYH 228

Query: 251 DGKTIVDMLVEMTD--GGLDYTFDCTGNTDVMRS 282
           D    +D++ ++      + Y  DC  N D ++ 
Sbjct: 229 D----IDVVEQIKHKYNNISYLVDCVANQDTLQQ 258

>TDEL0D00250 Chr4 (40555..44409) [3855 bp, 1284 aa] {ON} 
          Length = 1284

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 5/113 (4%)

Query: 226  INDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALE 285
            I    KQ    F AT F   S+DL D  T++ + V +     +Y FD  G +  +   L 
Sbjct: 977  IKKMLKQMTFHFNATKF--SSEDLMDDGTVIKLNVSLDVEKEEYIFDFEGTSPQVYGNLN 1034

Query: 286  ACHKGWGESIIIGVAAAGKE---ISTRPFQLVTGRVWKGSAFGGIKGRSEMGG 335
            A       +I+  +     E   ++    + +T ++ KGS    I G + +GG
Sbjct: 1035 APEAITNSAILYCLRCLVNEDIPLNQGCLKPITVKIPKGSILSPIDGIAVVGG 1087

>KLTH0B10032g Chr2 (835039..838875) [3837 bp, 1278 aa] {ON} highly
            similar to uniprot|P28273 YKL215C Saccharomyces
            cerevisiae Hypothetical ORF
          Length = 1278

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 47/108 (43%), Gaps = 5/108 (4%)

Query: 231  KQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKG 290
            K+    FGAT+F    +D  D  T++ + V +     +Y FD  G +  +   L A    
Sbjct: 977  KRMTEHFGATEFAG--EDYMDDGTVIKLRVTLDTKKEEYVFDFEGTSPQVYGNLNAPEAI 1034

Query: 291  WGESIIIGVA-AAGKEISTRP--FQLVTGRVWKGSAFGGIKGRSEMGG 335
               +I+  +     +EI       + +T ++ KGS     KG + +GG
Sbjct: 1035 TNSAILYCLRCLVNEEIPLNQGCLKPITVKIPKGSILSPTKGVAVVGG 1082

>KLTH0E00484g Chr5 complement(47160..50996) [3837 bp, 1278 aa] {ON}
            highly similar to uniprot|P28273 YKL215C Saccharomyces
            cerevisiae Hypothetical ORF
          Length = 1278

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 47/108 (43%), Gaps = 5/108 (4%)

Query: 231  KQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKG 290
            K+    FGAT+F    +D  D  T++ + V +     +Y FD  G +  +   L A    
Sbjct: 977  KRMTEHFGATEFAG--EDYMDDGTVIKLRVTLDTKKEEYVFDFEGTSPQVYGNLNAPEAI 1034

Query: 291  WGESIIIGVA-AAGKEISTRP--FQLVTGRVWKGSAFGGIKGRSEMGG 335
               +I+  +     +EI       + +T ++ KGS     KG + +GG
Sbjct: 1035 TNSAILYCLRCLVNEEIPLNQGCLKPITVKIPKGSILSPTKGVAVVGG 1082

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,766,049
Number of extensions: 1662941
Number of successful extensions: 4075
Number of sequences better than 10.0: 211
Number of HSP's gapped: 3889
Number of HSP's successfully gapped: 234
Length of query: 381
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 270
Effective length of database: 40,753,473
Effective search space: 11003437710
Effective search space used: 11003437710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)