Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.246287.345ON97973583e-45
KLTH0H01364g7.345ON97971856e-19
Suva_3.401.430ON31926650.85
NCAS0A03390singletonON22051596.0
NOTE: 15 genes in the same pillar as Kwal_56.24628 were not hit in these BLAST results
LIST: Kpol_2001.72 Zrou_YGOB_Anc_7.345 KAFR0L01475 Skud_12.267 CAGL0A03883g Smik_12.262 YLR204W Suva_10.298 ACL153C Ecym_4728 TPHA0D04575 KLLA0D12452g KNAG0B02635 NDAI0E04490 SAKL0F11264g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.24628
         (97 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.24628 s56 complement(1079666..1079959) [294 bp, 97 aa] {...   142   3e-45
KLTH0H01364g Chr8 (127939..128232) [294 bp, 97 aa] {ON} conserve...    76   6e-19
Suva_3.40 Chr3 complement(54962..55921) [960 bp, 319 aa] {ON} YC...    30   0.85 
NCAS0A03390 Chr1 complement(673193..673855) [663 bp, 220 aa] {ON}      27   6.0  

>Kwal_56.24628 s56 complement(1079666..1079959) [294 bp, 97 aa]
          {ON} YLR204W (QRI5) - Product of gene unknown [contig
          161] FULL
          Length = 97

 Score =  142 bits (358), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 72/97 (74%)

Query: 1  MLGAFRHAFTSLIKPRLSIARYSSGLQSYHGFDLSTKFLEPIPLLRPAASIEPAPTQLEE 60
          MLGAFRHAFTSLIKPRLSIARYSSGLQSYHGFDLSTKFLEPIPLLRPAASIEPAPTQLEE
Sbjct: 1  MLGAFRHAFTSLIKPRLSIARYSSGLQSYHGFDLSTKFLEPIPLLRPAASIEPAPTQLEE 60

Query: 61 LFADSVMXXXXXXXXXXXXXXXXXXXXXXXXXQSQGK 97
          LFADSVM                         QSQGK
Sbjct: 61 LFADSVMRKRRLKMKKHKLRKRRKRQKAEKRKQSQGK 97

>KLTH0H01364g Chr8 (127939..128232) [294 bp, 97 aa] {ON} conserved
          hypothetical protein
          Length = 97

 Score = 75.9 bits (185), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 53/97 (54%)

Query: 1  MLGAFRHAFTSLIKPRLSIARYSSGLQSYHGFDLSTKFLEPIPLLRPAASIEPAPTQLEE 60
          MLGAF  AF+SL+K R   AR SS L ++ GF+L  + +EP+ LLRP A +E APT +EE
Sbjct: 1  MLGAFTRAFSSLVKTRAPAARLSSTLHAFRGFELPLRCMEPLMLLRPLAPVERAPTAMEE 60

Query: 61 LFADSVMXXXXXXXXXXXXXXXXXXXXXXXXXQSQGK 97
          + ADSVM                         QSQGK
Sbjct: 61 MLADSVMRKRRLKMKKHKLRKRRKRQKAEKRKQSQGK 97

>Suva_3.40 Chr3 complement(54962..55921) [960 bp, 319 aa] {ON}
          YCR015C (REAL)
          Length = 319

 Score = 29.6 bits (65), Expect = 0.85,   Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 17/26 (65%)

Query: 41 PIPLLRPAASIEPAPTQLEELFADSV 66
          P+PLL P A +  +P+  +ELF D +
Sbjct: 58 PLPLLSPNAPLIISPSNFDELFKDEL 83

>NCAS0A03390 Chr1 complement(673193..673855) [663 bp, 220 aa] {ON}
          
          Length = 220

 Score = 27.3 bits (59), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 22/51 (43%)

Query: 13 IKPRLSIARYSSGLQSYHGFDLSTKFLEPIPLLRPAASIEPAPTQLEELFA 63
          I PR  I  +    +    F+   KF    PLLR  + I P  TQ+ E  A
Sbjct: 16 IIPRALIEHFQLNFKVVDIFENEGKFSNEFPLLRSPSLITPDGTQITEAMA 66

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,728,809
Number of extensions: 210773
Number of successful extensions: 430
Number of sequences better than 10.0: 5
Number of HSP's gapped: 430
Number of HSP's successfully gapped: 5
Length of query: 97
Length of database: 53,481,399
Length adjustment: 68
Effective length of query: 29
Effective length of database: 45,684,111
Effective search space: 1324839219
Effective search space used: 1324839219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)