Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.246167.343ON71571536570.0
KLTH0H01408g7.343ON72372729430.0
SAKL0F10912g7.343ON69370925410.0
ZYRO0F11572g7.343ON73172424010.0
TDEL0C020407.343ON70570923930.0
NCAS0A141107.343ON75372923670.0
CAGL0I03410g7.343ON72470723590.0
NDAI0A019407.343ON76572323360.0
Smik_4.747.343ON84572323340.0
YDL164C (CDC9)7.343ON75572023260.0
Skud_4.937.343ON75571723230.0
Kpol_2001.717.343ON72671923190.0
Suva_4.827.343ON75572823150.0
ACL155W7.343ON69770623080.0
KNAG0C037407.343ON72771723040.0
KAFR0B008307.343ON71070622970.0
KLLA0D12496g7.343ON70068022460.0
TPHA0D045707.343ON73673620760.0
TBLA0E020507.343ON72071020570.0
TPHA0M002606.18ON9664252809e-25
ZYRO0C07854g6.18ON9443822665e-23
TDEL0G045106.18ON9694092647e-23
ACR008W6.18ON9814162648e-23
Kwal_56.224146.18ON9632592639e-23
Smik_15.1746.18ON9454032567e-22
NCAS0D026506.18ON9502862522e-21
KLLA0D01089g6.18ON9074012485e-21
NDAI0I022606.18ON9672992433e-20
KNAG0F028706.18ON9542932433e-20
KLTH0C11286g6.18ON9513912405e-20
CAGL0E02695g6.18ON9463882405e-20
YOR005C (DNL4)6.18ON9444592405e-20
Skud_15.1666.18ON9472352352e-19
KAFR0A050506.18ON9484532334e-19
Suva_15.1806.18ON9482862263e-18
TBLA0G010406.18ON9722352192e-17
Kpol_1032.76.18ON9652092182e-17
KLTH0G10120g2.275ON214101860.054
KLTH0E11352g8.488ON98597724.7
NCAS0G034101.506ON1056189724.8
Kpol_1042.136.68ON117162724.9
Smik_8.2884.369ON30961714.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.24616
         (715 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...  1413   0.0  
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...  1138   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   983   0.0  
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...   929   0.0  
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   926   0.0  
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...   916   0.0  
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   913   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   904   0.0  
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   903   0.0  
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   900   0.0  
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   899   0.0  
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   897   0.0  
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   896   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   893   0.0  
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...   892   0.0  
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   889   0.0  
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   869   0.0  
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   804   0.0  
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   796   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   112   9e-25
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   107   5e-23
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...   106   7e-23
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   106   8e-23
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...   105   9e-23
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   103   7e-22
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...   101   2e-21
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   100   5e-21
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...    98   3e-20
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...    98   3e-20
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...    97   5e-20
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...    97   5e-20
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...    97   5e-20
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...    95   2e-19
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...    94   4e-19
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...    92   3e-18
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...    89   2e-17
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...    89   2e-17
KLTH0G10120g Chr7 complement(857050..857694) [645 bp, 214 aa] {O...    38   0.054
KLTH0E11352g Chr5 (1014490..1017447) [2958 bp, 985 aa] {ON} simi...    32   4.7  
NCAS0G03410 Chr7 (624153..627323) [3171 bp, 1056 aa] {ON} Anc_1....    32   4.8  
Kpol_1042.13 s1042 complement(25499..29014) [3516 bp, 1171 aa] {...    32   4.9  
Smik_8.288 Chr8 complement(472376..473305) [930 bp, 309 aa] {ON}...    32   4.9  

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score = 1413 bits (3657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/715 (96%), Positives = 689/715 (96%)

Query: 1   MIRTVRLSMSSAKKQATLAKFFSSKKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPN 60
           MIRTVRLSMSSAKKQATLAKFFSSKKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPN
Sbjct: 1   MIRTVRLSMSSAKKQATLAKFFSSKKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPN 60

Query: 61  VDETNHETLQKPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSNVMYSEMCSV 120
           VDETNHETLQKPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSNVMYSEMCSV
Sbjct: 61  VDETNHETLQKPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSNVMYSEMCSV 120

Query: 121 FNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPXXXXXXXXXXX 180
           FNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQP           
Sbjct: 121 FNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPGLELGLGEGLL 180

Query: 181 MKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARA 240
           MKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARA
Sbjct: 181 MKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARA 240

Query: 241 QGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHGG 300
           QGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHGG
Sbjct: 241 QGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHGG 300

Query: 301 KEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAKPS 360
           KEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAKPS
Sbjct: 301 KEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAKPS 360

Query: 361 KSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISDFVA 420
           KSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISDFVA
Sbjct: 361 KSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISDFVA 420

Query: 421 HPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCYNDE 480
           HPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCYNDE
Sbjct: 421 HPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCYNDE 480

Query: 481 PLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLD 540
           PLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLD
Sbjct: 481 PLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLD 540

Query: 541 GEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDT 600
           GEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL               FLLGCYNQDT
Sbjct: 541 GEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDT 600

Query: 601 GEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEVLTA 660
           GEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEVLTA
Sbjct: 601 GEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEVLTA 660

Query: 661 DLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHIN 715
           DLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHIN
Sbjct: 661 DLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHIN 715

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score = 1138 bits (2943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/727 (77%), Positives = 608/727 (83%), Gaps = 16/727 (2%)

Query: 1   MIRTVRLSMSSAKKQATLAKFFSSKKRSNDEKEGPQESAKKSQLNAID------------ 48
           M+R VR  MSS KKQATLAKFFSSKKRS +E E   E AKK   + I             
Sbjct: 1   MLRLVRAEMSSIKKQATLAKFFSSKKRSVEE-EKSHEPAKKLHSDPIGAGSGSPSSSPPL 59

Query: 49  AKPESSKGSQPNVDETNHETLQKPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPK 108
           A   S  GS   V      T       A  P    +  PAK AV  + GD AK+G SAPK
Sbjct: 60  ATGSSDAGS---VKVETSATSTGENTKAGTPTLPDSDEPAKRAVAATKGDPAKLGASAPK 116

Query: 109 DSNVMYSEMCSVFNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQ 168
           DS ++Y+EMC+VFNEIEGTSSRLQIVKLC DFLYSVL K RKD+VPITYLLINKLGPDYQ
Sbjct: 117 DSKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQ 176

Query: 169 PXXXXXXXXXXXMKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTG 228
           P           MKTISESCGKSLQQ+KARYRELGDLGRIAQEAR+VQPTMFKPKPLTTG
Sbjct: 177 PGLELGLGEGLLMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTG 236

Query: 229 MVFANLQDIARAQGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVA 288
            VF+NLQ IAR+QGKDSQLRKVQLIK+MLTAC+G+EAKFLIRSLESKLRIGLAEKSVLVA
Sbjct: 237 EVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVA 296

Query: 289 LSKAILTHEHGGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTP 348
           LSKA+LT+EH GKEPSS+LVD AEQKIRDAFCQVPNY+IVI  ALEHGIMEL+KHCVLTP
Sbjct: 297 LSKALLTYEHNGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTP 356

Query: 349 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTE 408
           GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTE
Sbjct: 357 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTE 416

Query: 409 RYPEINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVC 468
           RYPEI ISDF+A P  THTLILDCEAVAWDK+KN ILPFQVLSTRKRKGV  EDVKVRVC
Sbjct: 417 RYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVC 476

Query: 469 LFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVK 528
           LFAFDILCYNDEPLI + LAERR  LER L PVPGELQLASEVTTMSLDE+Q YLDQ+V+
Sbjct: 477 LFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVR 536

Query: 529 DCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXX 588
           DCCEGLMVK+L+GEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL             
Sbjct: 537 DCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTY 596

Query: 589 XXFLLGCYNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVW 648
             FLLGCYNQD+GE+ETCCKIGTGFS+EMLQ L+++LSPT IP PKAFYV+SESA PDVW
Sbjct: 597 GGFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVW 656

Query: 649 LEPSMLFEVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFY 708
            EP++LFEVLTADLSLSPVYKAG SSYGKGISLRFPRFIR+RDDK+ E+ATSSEQV+EFY
Sbjct: 657 FEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFY 716

Query: 709 ESQSHIN 715
           ESQSH++
Sbjct: 717 ESQSHVS 723

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  983 bits (2541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/709 (66%), Positives = 568/709 (80%), Gaps = 24/709 (3%)

Query: 7   LSMSSAKKQATLAKFFSSKKRSNDEKEGPQESAKKSQLN-AIDAKPESSKGSQPNVDETN 65
           L + S KKQ TLA+FFSS K+  ++++  +  AK+++++ A  ++  +++    +V    
Sbjct: 6   LRIMSTKKQVTLARFFSSAKKGGNKEDKLEPQAKRAKVDPANTSELITNEAVARSVSPPT 65

Query: 66  HETLQKPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSNVMYSEMCSVFNEIE 125
                 P +S + P     M P                      S + YS++C++F+EIE
Sbjct: 66  PVVPVAPIISTSTP----VMAPVH-------------------HSKIPYSDVCNIFSEIE 102

Query: 126 GTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPXXXXXXXXXXXMKTIS 185
            TSSRL IVK+CS+F YSVL +   +LVPITYL IN+LGPDY+P           MKTI+
Sbjct: 103 STSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFINRLGPDYEPGLELGLGEGLLMKTIA 162

Query: 186 ESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARAQGKDS 245
           ESCGKSLQQV+A+YRE+GDLG +AQEAR+VQPTMFKPKPLT G VF NL+ IA++QGKDS
Sbjct: 163 ESCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDS 222

Query: 246 QLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHGGKEPSS 305
           Q RK+QLIK+MLTAC+GVEAKFLIRSLESKLRIGLAEK+VL++LSKA+L++EH G+EPSS
Sbjct: 223 QTRKIQLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLSYEHDGEEPSS 282

Query: 306 DLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAKPSKSISE 365
           +LV+ AEQ++RDAFCQVPNYEIVIN  LEHGIME+ KHCVL PGIPLKPMLAKPSKSI+E
Sbjct: 283 ELVENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITE 342

Query: 366 VLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISDFVAHPDET 425
           VLDRF G++FTCEYKYDGERAQVHLLPDGSM IYSRNGENMTERYPE++I D++A P+ T
Sbjct: 343 VLDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYLADPETT 402

Query: 426 HTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCYNDEPLINK 485
           H+LILDCEAVAWD ++  ILPFQ+LSTRKRKGV A+DVKVRVCLFAFD+LCYN + LIN 
Sbjct: 403 HSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINN 462

Query: 486 SLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLDGEESH 545
           SL ERR YL+R+LKPV G+ Q A+E+ + +L+++Q YL+QSVKD CEGLMVKVL+GEESH
Sbjct: 463 SLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESH 522

Query: 546 YEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFET 605
           YEPSKRSRNWLKLKKDYLQGVGDSLDLCVL               FLLGCYNQDTGEFET
Sbjct: 523 YEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFET 582

Query: 606 CCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEVLTADLSLS 665
           CCKIGTGFSDEML +LYEKL P+ + +PKAFYVY  SA+PDVW EP+MLFEVLTADLSLS
Sbjct: 583 CCKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLS 642

Query: 666 PVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHI 714
           P+YKAG S+YGKGISLRFPRFIRIRDDK VEDATSSEQ++E YESQ ++
Sbjct: 643 PIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVELYESQVNL 691

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/724 (63%), Positives = 552/724 (76%), Gaps = 15/724 (2%)

Query: 2   IRTVRLSMSSAK-----KQATLAKFFSSKKRSNDEKEGPQESAKKSQLNAIDAKPESS-- 54
           +R   ++ SS++     KQATLAKFFSS K  N   +     A  +  N     P  S  
Sbjct: 13  VRRFGMATSSSQPKKQAKQATLAKFFSSVKDRNSPTKKNATPAFPTTTNVKRESPVRSNS 72

Query: 55  --KGSQPNVDETNHETLQKPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSNV 112
             K S P  D++N  +      S+A  + E A  P KL +E      +K        S V
Sbjct: 73  NEKESSPMFDDSNGRS---SACSSAGLEMESAPAPKKLKMESDSNSTSKNN-QDDHFSTV 128

Query: 113 MYSEMCSVFNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPXXX 172
            Y+++C++F EIE TSSRL I+K+CSDF   ++ +  ++LVP TYL INKLGPDY+P   
Sbjct: 129 PYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPGME 188

Query: 173 XXXXXXXXMKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFA 232
                   MKTISESCGKSL QVK RYRE+GDLG+IA EAR+VQPTMFKPKPLT G VF 
Sbjct: 189 LGLGEGLLMKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFV 248

Query: 233 NLQDIARAQGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKA 292
           NL++IA AQGKDSQ +K++LIK+MLTAC+GVEAKFLIRSLESKLRIGLAEK+VL++LS A
Sbjct: 249 NLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNA 308

Query: 293 ILTHEHG-GKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIP 351
           +L HE G   EPS + VD AEQ IRDAFCQVPNYEIVIN  LEHGI +L KHC LTPGIP
Sbjct: 309 LLRHEQGLDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIP 368

Query: 352 LKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYP 411
           LKPMLAKP+K+I+EVLDRFQGQ F  EYKYDGERAQ+HLLPDG+MRIYSRNGENMTERYP
Sbjct: 369 LKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERYP 428

Query: 412 EINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFA 471
           EI+I DF++ P  T +LILDCEAVAWDK++  ILPFQVLSTRKRK V A+DVKVRVCLFA
Sbjct: 429 EIDIRDFLSDP-STESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVKVRVCLFA 487

Query: 472 FDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCC 531
           FD+LC+N EPLINKSL ER+  L+++ KPV GE + A+++ T +++E+Q +LDQSVKD C
Sbjct: 488 FDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSC 547

Query: 532 EGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXF 591
           EGLMVK+LDG ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL               F
Sbjct: 548 EGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKRTGTYGGF 607

Query: 592 LLGCYNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEP 651
           LLGCYNQDTGE+ETCCKIGTGFS+E+LQ LY++L PT +  P AFYVY  + QPDVW EP
Sbjct: 608 LLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFEP 667

Query: 652 SMLFEVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQ 711
           ++LFEVL ADLSLSPVYKAG + Y KGISLRFPRF+RIRDDKSVE+ATSSEQV++ YE+Q
Sbjct: 668 TLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQ 727

Query: 712 SHIN 715
           +H++
Sbjct: 728 AHLS 731

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  926 bits (2393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/709 (66%), Positives = 548/709 (77%), Gaps = 25/709 (3%)

Query: 9   MSSAKKQATLAKFFSSKKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPNVDETNHET 68
           MSS KKQATLA+FFS+ ++ +D KE         ++N  D K   S+ +Q   DE     
Sbjct: 18  MSSGKKQATLARFFSAVQK-DDTKE---------KVNG-DVKIIESRDNQ---DE----- 58

Query: 69  LQKPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPK--DSNVMYSEMCSVFNEIEG 126
              P     +  +   +  + L+  KS G  +     +P    S V YS++C+VF EIEG
Sbjct: 59  ---PVTKKFKSSSPVKLQTSSLSPVKSAGVESGDKPVSPDLYYSKVPYSDVCNVFQEIEG 115

Query: 127 TSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPXXXXXXXXXXXMKTISE 186
           TSSRL I+K+CS+F   ++    ++L+P TYL IN+LGPDY+P           MKTISE
Sbjct: 116 TSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPGLELGLGEGLLMKTISE 175

Query: 187 SCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARAQGKDSQ 246
           +CGKSL QVK RYRE+GDLG+IA EAR+VQPTMFKPKPLT G VF NL+ IA +QGKDSQ
Sbjct: 176 ACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKDSQ 235

Query: 247 LRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHE-HGGKEPSS 305
            RK++LIK+MLTACEGVEAKFLIRSLESKLRIGLAEK+VL++LSKA+LT+E   GKEPS 
Sbjct: 236 TRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGETGKEPSM 295

Query: 306 DLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAKPSKSISE 365
           +LV+ AE KIRDAFCQVPNYEIVINA L++GIMEL+KHC L PGIPLKPMLAKP+KSI+E
Sbjct: 296 ELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITE 355

Query: 366 VLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISDFVAHPDET 425
           VLDRFQGQ FT EYKYDGERAQVHLL DG+MRIYSRNGENMTERYPEI+I DFVA  + T
Sbjct: 356 VLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFVADLEHT 415

Query: 426 HTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCYNDEPLINK 485
            TLILDCEAVAWDK +  ILPFQVLSTRKRK V A+DVKVRVCLFAFDI+C+N E  INK
Sbjct: 416 KTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGERQINK 475

Query: 486 SLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLDGEESH 545
           SL ERR  L ++ KPV GE Q A E+TT S++E+Q +LDQSVKD CEGLMVK+LDG ESH
Sbjct: 476 SLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESH 535

Query: 546 YEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFET 605
           YEPSKRSRNWLKLKKDYL GVGDSLDLCVL               FLLGCYNQD+GEFET
Sbjct: 536 YEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSGEFET 595

Query: 606 CCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEVLTADLSLS 665
           CCKIGTGFSDEMLQ LYE+ S T +  PKA YV+  SA+PDVW EP+ LFEVLTADLSLS
Sbjct: 596 CCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLS 655

Query: 666 PVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHI 714
           PVYKAG S+Y KG+SLRFPRF+R+RDDKSVEDATSS Q++E Y+ QSH+
Sbjct: 656 PVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHV 704

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score =  916 bits (2367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/729 (62%), Positives = 556/729 (76%), Gaps = 34/729 (4%)

Query: 13  KKQATLAKFFSSKKRSND-EKEGPQESAKKSQLNAIDAKPESSKGSQPNVDETNHETLQK 71
           +KQATLAKFFSS K     +K+ P++S   +       KP  S  +  N  +T  E L +
Sbjct: 29  QKQATLAKFFSSMKNEKPADKKDPEDSTTTTT-----EKPSLSPYTA-NSKKTFEEILNR 82

Query: 72  PQ---LSAAEPKTEFAMNPA--KLAVEKSHG-DVAKIGI--------------------S 105
           P     S+++  ++ A  P+   ++ ++S G D+ K  +                    +
Sbjct: 83  PASNLASSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKEPTIENVTQDST 142

Query: 106 APKDSNVMYSEMCSVFNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGP 165
            P  S++ Y E+C++F EIE TSSRL I+KLCSDF   ++ +  ++L+P+TYL INKLGP
Sbjct: 143 KPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFINKLGP 202

Query: 166 DYQPXXXXXXXXXXXMKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPL 225
           DY+P           MKTISESCGKSL QV+ +YRELGDLG+IA +AR+VQPTMFKPKPL
Sbjct: 203 DYEPGLELGLGEGLLMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMFKPKPL 262

Query: 226 TTGMVFANLQDIARAQGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSV 285
           T G VF NL+ IA+++GKDSQ RK++LIK+MLTACEG EAKFLIRSLESKLRIGLAEK+V
Sbjct: 263 TVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGLAEKTV 322

Query: 286 LVALSKAILTHE-HGGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHC 344
           L++LSKA+L HE    K+   +L++ AEQKIRDAFCQVPNYEIVIN+ L++GIMELE HC
Sbjct: 323 LISLSKALLVHECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIMELETHC 382

Query: 345 VLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGE 404
            L PGIPLKPMLAKP+K+I+E+LDRFQG+ FT EYKYDGERAQVHLL DG+MRIYSRNGE
Sbjct: 383 SLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIYSRNGE 442

Query: 405 NMTERYPEINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVK 464
           NMTERYPEI+I DF+A P  T TLILDCEAVAWD ++N ILPFQVLSTRKRK V  +DVK
Sbjct: 443 NMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDVDLKDVK 502

Query: 465 VRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLD 524
           V+VCLFAFDILC+NDE LINKSL ERR  L+ + K V GE Q A+E+T+ +LDE+Q +LD
Sbjct: 503 VKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLD 562

Query: 525 QSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXX 584
           QSV D CEGLMVK+LDG ESHYEPSKRSRNWLKLKKDYL+G+GDSLDLCV+         
Sbjct: 563 QSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGKR 622

Query: 585 XXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQ 644
                 FLLGCYNQDTGEFETCCKIGTGFSDEMLQ LY +L+PT +  PKA +VY  SA+
Sbjct: 623 TGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVYDSSAE 682

Query: 645 PDVWLEPSMLFEVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQV 704
           PDVW EP++LFEVLTADLSLSP+YKAG S+Y KGISLRFPRFIR R+DK VEDATSSEQ+
Sbjct: 683 PDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATSSEQI 742

Query: 705 IEFYESQSH 713
           IE YE+Q+H
Sbjct: 743 IELYENQAH 751

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/707 (64%), Positives = 549/707 (77%), Gaps = 17/707 (2%)

Query: 13  KKQATLAKFFSS-KKRSNDEKEGPQESAKKS--QLNAIDAKPESSKGSQPNVDETNHETL 69
           K+QATLA+FFSS KK ++ +K+G Q   K +   LN+ +     S   +  ++ T   T 
Sbjct: 28  KRQATLARFFSSVKKDADGDKKGEQADVKTAAVDLNSHEVDANKSPLKKMKLESTGSLTA 87

Query: 70  QKPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSNVMYSEMCSVFNEIEGTSS 129
            K   +  + K E    P  +A      D +K     P      YS++C++F EIEGTSS
Sbjct: 88  TK---NGNQGKEEHEGTP--IASTPRQVD-SKFFCKVP------YSDLCNLFEEIEGTSS 135

Query: 130 RLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPXXXXXXXXXXXMKTISESCG 189
           RL I+KLCSDF   ++ +  ++L+P+TYL INKLGPDY+P           MKTISESCG
Sbjct: 136 RLAIIKLCSDFFIKIMKEDPQNLIPVTYLFINKLGPDYEPGLELGLGENLLMKTISESCG 195

Query: 190 KSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARAQGKDSQLRK 249
           KS+QQ+K +YRE+GDLG+IA EAR+VQPTMFKPKPL  G VF NL+ IA++QGKDSQ +K
Sbjct: 196 KSMQQIKNQYREIGDLGQIALEARNVQPTMFKPKPLVVGEVFENLKTIAKSQGKDSQTKK 255

Query: 250 VQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHE--HGGKEPSSDL 307
           ++LIK+MLTAC+G EAKFLIRSLESKLRIGLAEK+VL+ALSKA+L H+  +  KEPS D+
Sbjct: 256 MKLIKRMLTACQGTEAKFLIRSLESKLRIGLAEKTVLIALSKALLIHDEKYSNKEPSMDV 315

Query: 308 VDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAKPSKSISEVL 367
           V+ AEQKIRDAFCQVPNYE+VINA L++GIM+L++HC + PGIPLKPMLAKP+K+I+EVL
Sbjct: 316 VEQAEQKIRDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTKAINEVL 375

Query: 368 DRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISDFVAHPDETHT 427
           DRFQGQ FT EYKYDGERAQVHLL DG+MRIYSRNGENMTERYPEI I DF+A P  T +
Sbjct: 376 DRFQGQTFTSEYKYDGERAQVHLLKDGTMRIYSRNGENMTERYPEIQIKDFLADPASTTS 435

Query: 428 LILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCYNDEPLINKSL 487
           LILDCEAVAWDK++N ILPFQVL+TRKRK V   +VKVRVCLFAFDIL +ND  LIN+ L
Sbjct: 436 LILDCEAVAWDKEQNKILPFQVLTTRKRKDVNINEVKVRVCLFAFDILLHNDMRLINEPL 495

Query: 488 AERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLDGEESHYE 547
           ++RR  L  + KPV GE Q A+++TT +LDE+Q +LD+SVK+ CEGLMVK++DG ES+YE
Sbjct: 496 SKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMMDGVESYYE 555

Query: 548 PSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCC 607
           PSKRSRNWLKLKKDYL+GVGDSLDLCVL               FLLGCYN D+ +FETCC
Sbjct: 556 PSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGCYNADSEDFETCC 615

Query: 608 KIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEVLTADLSLSPV 667
           KIGTGFS+EMLQ LYEKLSPT I  PK  YV+  SA+PDVW EP+MLFEVLTADLSLSP+
Sbjct: 616 KIGTGFSEEMLQTLYEKLSPTVIDGPKGTYVFDSSAEPDVWFEPTMLFEVLTADLSLSPI 675

Query: 668 YKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHI 714
           YKAG S Y KGISLRFPRF+RIRDDKSVEDATSSEQ+IE Y++QSH+
Sbjct: 676 YKAGSSVYDKGISLRFPRFLRIRDDKSVEDATSSEQIIEMYQNQSHV 722

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  904 bits (2336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/723 (62%), Positives = 548/723 (75%), Gaps = 31/723 (4%)

Query: 13  KKQATLAKFFSSKKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPNVDETNHETLQKP 72
           K+QATL +FFSS     + K+  +++A K++     +K E+ + ++ + D    + ++  
Sbjct: 49  KQQATLGRFFSSI----NHKKPTKDTALKNE-----SKEETKEENKDDSDSIPRKKIRLS 99

Query: 73  Q-------LSAAEPKTEFAMNPAKLA-------------VEKSHGDVAKIGISAPKDSNV 112
                   ++ ++PK+   +N  + +             +   H    K  +S P    +
Sbjct: 100 TSSSSPSIMAESKPKSPIKLNTERSSSPASASASTTPTPIVADHTLDPKTAVSKPFLCAI 159

Query: 113 MYSEMCSVFNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPXXX 172
            Y E+C +F EIE TSSRL I+KLCSDFL  ++ +  ++L+P+TYL INKLGPDY+P   
Sbjct: 160 PYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPGLE 219

Query: 173 XXXXXXXXMKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFA 232
                   MKTISESCGKSL Q++A+YRELGDLG+IA EAR+VQPTMFKPKPLT G VF 
Sbjct: 220 LGLGEGLLMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVFN 279

Query: 233 NLQDIARAQGKDSQLRKVQLIKKMLTACE-GVEAKFLIRSLESKLRIGLAEKSVLVALSK 291
           NL+ IA+A GKDSQ +K++LIK+MLTACE GVEAKFLIRSLESKLRIGLAEK+VL++LSK
Sbjct: 280 NLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLSK 339

Query: 292 AILTHEH-GGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGI 350
           A+L  E    K+   +L++ AE KIRDAFCQVPNYEIVIN+ L++GIM L +HC L PGI
Sbjct: 340 ALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGI 399

Query: 351 PLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERY 410
           PLKPMLAKP+K+I+E+LDRFQG+ FT EYKYDGERAQVHLL DG+MRIYSRNGENMTERY
Sbjct: 400 PLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERY 459

Query: 411 PEINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLF 470
           PEI+I DFV   +ET TLILDCEAVAWDK++  ILPFQVLSTRKRK V+A+DVKVRVCLF
Sbjct: 460 PEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVRVCLF 519

Query: 471 AFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDC 530
           AFDILC+N   LIN SL ERR  L R+  P PGE Q A+E+TT +LDE+Q +LDQSV D 
Sbjct: 520 AFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDS 579

Query: 531 CEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXX 590
           CEGLMVK+L+GEESHYEPSKRSRNWLKLKKDYL+G+GDSLDLCVL               
Sbjct: 580 CEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRTGTYGG 639

Query: 591 FLLGCYNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLE 650
           FLLGCYN +TGEFETCCKIGTGFSDEMLQ L+EKL  T I  PKA Y+Y  SA+PDVW E
Sbjct: 640 FLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEPDVWFE 699

Query: 651 PSMLFEVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYES 710
           PS+LFEVLTADLSLSP+YKAG S+Y KG+SLRFPRFIRIR+DK VEDATSSEQ+IE YE+
Sbjct: 700 PSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYEN 759

Query: 711 QSH 713
           QSH
Sbjct: 760 QSH 762

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  903 bits (2334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/723 (62%), Positives = 547/723 (75%), Gaps = 27/723 (3%)

Query: 14  KQATLAKFFSS-KKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPNVDETNHETLQKP 72
           KQATLA+FF+S K + +     P +SAK    +++D   +SS G + NV ++    +   
Sbjct: 126 KQATLARFFTSMKNKPSGNTSPPDKSAKHMLQDSVD--DDSSVGVR-NVKKSQQVAV--A 180

Query: 73  QLSAAEPKTEFAMNPAKLAVEKSHG-DVA-KIGISAPK--------------DSNVMYSE 116
           Q +  +P      +    +   S G D++ K     PK               SN+ YS+
Sbjct: 181 QAATVQPFMSSFPSSLPSSAPSSSGADLSQKFQGLGPKVEDFEMNSNDSDHYSSNIPYSD 240

Query: 117 MCSVFNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPXXXXXXX 176
           +C VFN+IE  SSRL+I+++CSDF   V+ ++ K+L+P TYL IN+LGPDY+        
Sbjct: 241 VCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDYEAGLELGLG 300

Query: 177 XXXXMKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQD 236
               MKTISESCGKS+ Q+K +Y+E+GDLG IA  AR+VQPTMFKPKPLT G VF NL+ 
Sbjct: 301 ENLLMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRT 360

Query: 237 IARAQGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTH 296
           IA+ QGKDSQLRK++LIK+MLTAC+GVEAKFLIRSLESKLRIGLAEK+VL++LSKA+L H
Sbjct: 361 IAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLH 420

Query: 297 EH-----GGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIP 351
           +        K+   D++++A+QKIRDAFCQVPNYEIVIN+ LEHGIM L+K+C L PGIP
Sbjct: 421 DENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIP 480

Query: 352 LKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYP 411
           LKPMLAKP+K+I+EVLDRFQG+ FT EYKYDGERAQVHLL DG+MRIYSRNGENMTERYP
Sbjct: 481 LKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYP 540

Query: 412 EINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFA 471
           EI I+DF+   D T  LILDCEAVAWDKD+  ILPFQVLSTRKRK V   DVKVRVCLFA
Sbjct: 541 EIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVKVRVCLFA 600

Query: 472 FDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCC 531
           FDILC+NDE LIN SL ERR YL ++ K VPGE Q A+++ T +LDE+Q +LD+SV   C
Sbjct: 601 FDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSC 660

Query: 532 EGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXF 591
           EGLMVK+LDG ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL               F
Sbjct: 661 EGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGF 720

Query: 592 LLGCYNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEP 651
           LLGCYNQDTGEFETCCKIGTGFSDEMLQ L+ +L+PT I  PKA YV+  SA+PDVW EP
Sbjct: 721 LLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSSAEPDVWFEP 780

Query: 652 SMLFEVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQ 711
           + LFEVLTADLSLSP+YKAG +++ KG+SLRFPRF+RIR+DK VEDATSS+Q++E YE+Q
Sbjct: 781 TTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQ 840

Query: 712 SHI 714
           SH+
Sbjct: 841 SHV 843

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  900 bits (2326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/720 (61%), Positives = 549/720 (76%), Gaps = 22/720 (3%)

Query: 14  KQATLAKFFSSKKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPNVDETNHETLQKPQ 73
           KQATLA+FF+S K  N   EG   S KKS  + ++ + ++  G +    +   +T     
Sbjct: 37  KQATLARFFTSMK--NKPTEG-TPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHT 93

Query: 74  LSA-AEPKTEF----------AMNPAKLAVEKSHGDVAKIGISAPKD---SNVMYSEMCS 119
           ++A +   + F           +  +    ++  G+V     S   D   SN+ YSE+C 
Sbjct: 94  VAAPSSMGSNFSSIPSSAPSSGVADSPQQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCE 153

Query: 120 VFNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPXXXXXXXXXX 179
           VFN+IE  SSRL+I+++CSDF   ++ ++ K+L+P TYL IN+LGPDY+           
Sbjct: 154 VFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYEAGLELGLGENL 213

Query: 180 XMKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIAR 239
            MKTISE+CGKS+ Q+K +Y+++GDLG IA  AR+VQPTMFKPKPLT G VF NL+ IA+
Sbjct: 214 LMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAK 273

Query: 240 AQGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHG 299
            QGKDSQL+K++LIK+MLTAC+G+EAKFLIRSLESKLRIGLAEK+VL++LSKA+L H+  
Sbjct: 274 TQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDEN 333

Query: 300 -----GKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKP 354
                 K+   D++++A+QKIRDAFCQVPNYEIVIN+ LEHGIM L+K+C L PGIPLKP
Sbjct: 334 REDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKP 393

Query: 355 MLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEIN 414
           MLAKP+K+I+EVLDRFQG+ FT EYKYDGERAQVHLL DG+MRIYSRNGENMTERYPEIN
Sbjct: 394 MLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEIN 453

Query: 415 ISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDI 474
           I+DF+   D T  LILDCEAVAWDKD+  ILPFQVLSTRKRK V   DVKV+VCLFAFDI
Sbjct: 454 ITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDI 513

Query: 475 LCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGL 534
           LCYNDE LINKSL ERR YL ++ K VPGE Q A+++TT +LDE+Q +LD+SV   CEGL
Sbjct: 514 LCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGL 573

Query: 535 MVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLG 594
           MVK+L+G ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL               FLLG
Sbjct: 574 MVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG 633

Query: 595 CYNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSML 654
           CYNQDTGEFETCCKIGTGFSDEMLQ L+++L+PT I  PKA +V+  SA+PDVW EP+ L
Sbjct: 634 CYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTL 693

Query: 655 FEVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHI 714
           FEVLTADLSLSP+YKAG +++ KG+SLRFPRF+RIR+DK VEDATSS+Q++E YE+QSH+
Sbjct: 694 FEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHM 753

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  899 bits (2323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/717 (62%), Positives = 542/717 (75%), Gaps = 16/717 (2%)

Query: 14  KQATLAKFFSSKKRSNDEKEGPQESAKKSQL-NAIDAKPESSKGSQPNVDETNH-ETLQK 71
           KQATLA+FFSS K          E A K +L N ID        +   + + +  +TL  
Sbjct: 37  KQATLARFFSSMKNEPSGSSSSPEKAPKHKLENNIDNNSSEGADATKKLKQVSTVQTLVA 96

Query: 72  PQLSAAEPKTEFAMNPAKLAVEKSHGD------VAKIGISAPKD---SNVMYSEMCSVFN 122
           P    + P +  +  P+   V+ S         V K   S   D   SN+ YSE+C VFN
Sbjct: 97  PSTMGSSPFSLPSSAPSSSGVDVSQESREFTPQVEKEPSSNDNDHYSSNIPYSEVCEVFN 156

Query: 123 EIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPXXXXXXXXXXXMK 182
           +IE  SSRL+I+++CSDF   ++ ++ K+L+P TYL IN+LGPDY+            MK
Sbjct: 157 KIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMK 216

Query: 183 TISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARAQG 242
           TISESCGKS+ Q+K +Y+E+GDLG IA  AR+VQPTMFKPK LT G VF NL+ IA+ QG
Sbjct: 217 TISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTVGEVFKNLRTIAKTQG 276

Query: 243 KDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHG--- 299
           KDSQLRK++LIK+MLTAC+GVEAKFLIRSLESKLRIGLAEK+VL++LSKA+L H+     
Sbjct: 277 KDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENKEN 336

Query: 300 --GKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLA 357
              KE   D++++A+Q+IRDAFCQVPNYEIVIN+ L HGIM L+K+C L PGIPLKPMLA
Sbjct: 337 SPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLA 396

Query: 358 KPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISD 417
           KP+K+I+EVLDRFQG+ FT EYKYDGERAQVHLL DG+MRIYSRNGENMTERYPEI I+D
Sbjct: 397 KPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITD 456

Query: 418 FVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCY 477
           F+   + T  LILDCEAVAWDK++  ILPFQ+LSTRKRK V   DVKV+VCLFAFDILCY
Sbjct: 457 FIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDVKVKVCLFAFDILCY 516

Query: 478 NDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVK 537
           NDE LINKSL ERR +L ++ K VPGE Q A+++ T +LDE+Q +LD+SV + CEGLMVK
Sbjct: 517 NDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVK 576

Query: 538 VLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYN 597
           +LDG ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL               FLLGCYN
Sbjct: 577 MLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYN 636

Query: 598 QDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEV 657
           QDTGEFETCCKIGTGFSDEMLQ L+E+L+PT I  PKA +V+  SA+PDVW EP+ LFEV
Sbjct: 637 QDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDASAEPDVWFEPTTLFEV 696

Query: 658 LTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHI 714
           LTADLSLSP+YKAG +++ KG+SLRFPRF+RIR+DK VEDATSS+Q+IE YE+QSH+
Sbjct: 697 LTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIIELYENQSHV 753

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  897 bits (2319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/719 (62%), Positives = 546/719 (75%), Gaps = 36/719 (5%)

Query: 12  AKKQATLAKFFSSKKRSND-----------EKEGPQESAKKSQLNAIDAKPESSKGSQPN 60
           AKKQATLA+FFSS  +               K+   +++KK +LN+ D  P +S GS  +
Sbjct: 26  AKKQATLARFFSSMPKRKIDDDSSTDSTTINKDDDSDTSKKIKLNS-DETPTTSAGSVTS 84

Query: 61  VDETNHETLQKPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSNVMYSEMCSV 120
            DE        P L+++  K    + PAK+    S+    K   + P      Y+++C V
Sbjct: 85  KDE--------PSLTSSPQKP--IVTPAKVP---SNTKPVKFFSTVP------YADLCEV 125

Query: 121 FNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPXXXXXXXXXXX 180
           F E+E TSSRL I+K+CSDFL  V+ +  ++LVPITYL INKLGPDY+P           
Sbjct: 126 FQEVESTSSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPGLELGLGEGLL 185

Query: 181 MKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARA 240
           MKTISESCGKS+QQ+K +YRE+GDLG+IAQ+AR+VQPTMFKPKPLT G VF NL+DIA++
Sbjct: 186 MKTISESCGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQS 245

Query: 241 QGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEH-G 299
           QGKDSQ RK++LIK+MLTAC+GVEAKFLIRSLESKLRIGLAEK+VL++LSKA+L +E+  
Sbjct: 246 QGKDSQQRKMRLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYET 305

Query: 300 GKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAKP 359
            K+PS +L++ AE+KIRDAFCQVPNYEI+I + L  GIMEL+ +C L PGIPLKPMLAKP
Sbjct: 306 SKDPSMELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKP 365

Query: 360 SKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISDFV 419
           +K+I+EVLD FQG+ FTCEYKYDGER QVHLL +G MRIYSRNGENMTERYPE++I DF+
Sbjct: 366 TKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFL 425

Query: 420 ----AHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDIL 475
               ++ D+  +LILDCE VAWD ++N ILPFQVLSTRKRKGV  +DVKVRVCLFAFDIL
Sbjct: 426 VKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDIL 485

Query: 476 CYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLM 535
            YN E LI K+L ERR  L  + K VPGE Q A+ + T  LDE+Q +LDQ++KD CEGLM
Sbjct: 486 YYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLM 545

Query: 536 VKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGC 595
           VK+LDGEES YEPSKRSRNWLKLKKDYL GVGDSLDLCV+               FLLGC
Sbjct: 546 VKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLLGC 605

Query: 596 YNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLF 655
           YNQD+GE+ETCCKIGTGFSDEML  LYE     EI  PK+FY +  SA+PD+W EP +LF
Sbjct: 606 YNQDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLF 665

Query: 656 EVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHI 714
           EVLTADLSLSP+YKAG ++Y KGISLRFPRF+RIRDDKSVEDATSS+Q+IE YE+QSHI
Sbjct: 666 EVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHI 724

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/728 (60%), Positives = 541/728 (74%), Gaps = 38/728 (5%)

Query: 14  KQATLAKFFSS-KKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPNVDETNHETLQKP 72
           KQATLA+FF+S K + +     P+++ K    N  +    SS+G+       +   +Q P
Sbjct: 37  KQATLARFFTSMKNKPSGGSSSPEKAVKHKIENGTNEI--SSEGASAIKKLKHLSAVQTP 94

Query: 73  ---------------------QLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSN 111
                                 + A++   E  + P    VE+  G +     S    SN
Sbjct: 95  VEQSDMSSSSSPLPSSAPSSSGVDASQKSRE--LTPK---VEEEQGPIDNDHYS----SN 145

Query: 112 VMYSEMCSVFNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPXX 171
           + YSE+C VFNEIE  SSRL+I+++CSDF   ++ ++ K+L+P TYL IN+LGPDY+P  
Sbjct: 146 IPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYEPGL 205

Query: 172 XXXXXXXXXMKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVF 231
                    MKTISESCGKS+ Q+K +Y+E+GDLG IA  AR+VQPTMFKPKPLT G VF
Sbjct: 206 ELGLGENLLMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVF 265

Query: 232 ANLQDIARAQGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSK 291
            NL+ IA+ QGKDSQLRK++LIK+MLTAC+GVEAKFLIRSLESKLRIGLAEK+VL++LSK
Sbjct: 266 KNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSK 325

Query: 292 AILTHEHGGKEPS-----SDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVL 346
           A+L H   G+         D++++A+QKIRDAFCQVPNYEIVIN+ LEHGIM L+K C L
Sbjct: 326 ALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKFCTL 385

Query: 347 TPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENM 406
            PGIPLKPMLAKP+K+I+EVLDRFQG+ FT EYKYDGERAQVHLL DG+MRIYSRNGENM
Sbjct: 386 KPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRNGENM 445

Query: 407 TERYPEINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVR 466
           TERYPEI I+DF+   D T  LILDCEAVAWDK++  ILPFQVLSTRKRK V   DVKVR
Sbjct: 446 TERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVKVR 505

Query: 467 VCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQS 526
           VCLFAFD+LC+N E LINKSL ERR  L ++ K VPGE Q A+++ T +LDE+Q +LD+S
Sbjct: 506 VCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDES 565

Query: 527 VKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXX 586
           V   CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL           
Sbjct: 566 VNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTG 625

Query: 587 XXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPD 646
               FLLGCYNQDTGEFETCCKIGTGFSDE LQ L+E+L+PT I  PKA +V+  SA+PD
Sbjct: 626 TYGGFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSSAEPD 685

Query: 647 VWLEPSMLFEVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIE 706
           VW EP+ LFEVLTADLSLSP+YKAG +++ KG+SLRFPRF+RIR+DK VEDATSSEQ++E
Sbjct: 686 VWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVE 745

Query: 707 FYESQSHI 714
            YE+QSH+
Sbjct: 746 LYENQSHV 753

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  893 bits (2308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/706 (63%), Positives = 536/706 (75%), Gaps = 13/706 (1%)

Query: 9   MSSAKKQATLAKFFSSKKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPNVDETNHET 68
           MS+ KKQATL +FF++ KR  D       + KKS++ A +        + P   E + E 
Sbjct: 1   MSAPKKQATLGRFFTALKRPQDGATA-AATVKKSKVEAAECL------AAPAGHEQDAEV 53

Query: 69  LQK-PQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSNVMYSEMCSVFNEIEGT 127
               P+L A +P     +  A  AV ++     K   S    ++VMY+++C+VF  +E T
Sbjct: 54  KNSLPEL-ADKPAPGGVLPQAASAVPRAQSSPVKPAAS----TSVMYADLCAVFEAVEAT 108

Query: 128 SSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPXXXXXXXXXXXMKTISES 187
           SSRL I KLC+DF+YSVL      L+P+TYL IN+LGPDY+P           +KTIS++
Sbjct: 109 SSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYEPGLELGLGEGILIKTISDA 168

Query: 188 CGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARAQGKDSQL 247
           CGKS  QV++ YRE GDLG +AQ+AR VQPTMFKPKPLT   VF+ LQ IA+A+GKDSQ 
Sbjct: 169 CGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQG 228

Query: 248 RKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHGGKEPSSDL 307
           +K++LIKKMLTAC+G+EAK+LIRSLESKLRIGLAEK+VLVALSKAILTHEH GKEPS + 
Sbjct: 229 KKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHDGKEPSPEQ 288

Query: 308 VDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAKPSKSISEVL 367
           VDAAE  +RD FCQVPNYE++INAAL++GIM L +HCVLTPGIPLKPMLAKP+KSI+EVL
Sbjct: 289 VDAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVL 348

Query: 368 DRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISDFVAHPDETHT 427
           DRFQGQRFTCEYKYDGERAQVHL+ DG++RIYSRN ENMTERYPEI    F+A+P  T +
Sbjct: 349 DRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLANPQTTRS 408

Query: 428 LILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCYNDEPLINKSL 487
           LI+DCEAVAWD +K  ILPFQVLSTRKRKGV  +DVKVRVCLFAFD+L  N E L+  SL
Sbjct: 409 LIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSL 468

Query: 488 AERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLDGEESHYE 547
           A+RR +L  +LK VPGELQ A+E+TTM L E+Q YL+QSV   CEGLMVK+LDGEES YE
Sbjct: 469 ADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYE 528

Query: 548 PSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCC 607
           PSKRSRNWLKLKKDYL+GVGDSLDL VL               FLLGCYN D  EFETCC
Sbjct: 529 PSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYGRGKRTGTYGGFLLGCYNPDLEEFETCC 588

Query: 608 KIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEVLTADLSLSPV 667
           KIGTGFS+E+LQ+L+ +L  T I  P+    Y +S+ PDVW EP+MLFEVLTADLSLSPV
Sbjct: 589 KIGTGFSEEVLQSLHAQLKDTVIAAPRGDVSYDDSSPPDVWFEPAMLFEVLTADLSLSPV 648

Query: 668 YKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSH 713
           YKAG   YGKGISLRFPRF+RIR+DKSV DATSS+Q++EFY+ Q++
Sbjct: 649 YKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/717 (61%), Positives = 540/717 (75%), Gaps = 28/717 (3%)

Query: 13  KKQATLAKFFSSKKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPNVDETNHETLQ-- 70
           K+Q TL  FF+S K+S D       + KK +      K ES +       E  HE +   
Sbjct: 22  KRQMTLNNFFTSVKKS-DTNTPASTTPKKME------KDESPQIPATKTAEEKHENMDVD 74

Query: 71  -KPQLSAAE-------PKTEFAMNPA---KLAVEKSHGDVAKIGISAPKDSNVMYSEMCS 119
             P +S++E       P T  +  P    K+ ++  + D  +   + P      Y+++C+
Sbjct: 75  TDPVISSSEVSAKRNSPLTSPSPTPVVSKKIKIQDENNDTKEFYSTVP------YADLCN 128

Query: 120 VFNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPXXXXXXXXXX 179
           +F EIEG SSRL I+KLCS FL SV+    ++L+P+TYL INKLGPDY P          
Sbjct: 129 LFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPGLELGLGENL 188

Query: 180 XMKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIAR 239
            +KTI+ESCG+SLQQ+K +Y E+GDLG+IA EAR VQPTMFKPKPLT G VF NL+ IA 
Sbjct: 189 LIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVFQNLKSIAS 248

Query: 240 AQGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHG 299
           +QGKDSQ +K++LIK+MLT+C+GVEAKFLIRSLESKLRIGLAEK+VL++LSKA+L +E+G
Sbjct: 249 SQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLVYEYG 308

Query: 300 GKEPSSDL--VDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLA 357
             +   D+  V+ AEQKIRDAFCQVPNYE+VI++ L+HGIM L++HC L P IPLKPMLA
Sbjct: 309 ESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAIPLKPMLA 368

Query: 358 KPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISD 417
           KP+KSISE+ DRFQ Q+FTCEYKYDGERAQVHLL DG+MRIYSRNGENMTERYPEI+I D
Sbjct: 369 KPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIRD 428

Query: 418 FVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCY 477
           FV     T +LILDCEAVAWDK++N ILPFQVLSTRKRK V   ++KVRVCLFAFDIL +
Sbjct: 429 FVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCLFAFDILLH 488

Query: 478 NDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVK 537
           NDE LINKSL ERR  L  I K V GE Q A+E+TT +L+E+Q +LDQSVK+ CEGLMVK
Sbjct: 489 NDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVK 548

Query: 538 VLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYN 597
           +L+GEESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL               FLLGCYN
Sbjct: 549 MLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLGCYN 608

Query: 598 QDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEV 657
           QDTGEFET CKIGTGFSDE+LQ L+E+L  T I  PKA YV+  SA+PDVW EP++LFEV
Sbjct: 609 QDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWFEPTLLFEV 668

Query: 658 LTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHI 714
           LTADLSLSPVYKAG S+Y KG+SLRFPRF+R+R+DK VEDATSSEQ++E YE+Q+++
Sbjct: 669 LTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQANL 725

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/706 (62%), Positives = 540/706 (76%), Gaps = 26/706 (3%)

Query: 10  SSAKKQATLAKFFSSKKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPNVDETNHETL 69
           S++K+QATLA+FF+S K S D+ +  + S+      +  +   ++ GS P         L
Sbjct: 28  SNSKRQATLARFFTSIKPSADD-QNSKTSSSPVPPPSSSSSSTTANGSSP---------L 77

Query: 70  QKPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSNVMYSEMCSVFNEIEGTSS 129
           +KP+LS                +E S  D ++  +      ++ Y+++C +F EIE  SS
Sbjct: 78  KKPKLSP---------------IESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENISS 122

Query: 130 RLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPXXXXXXXXXXXMKTISESCG 189
           RLQI+KLCS+F    + +   +L+P+TYL INKLGPDY+            MKTISESCG
Sbjct: 123 RLQIIKLCSEFFTKAMKQNTANLIPLTYLFINKLGPDYEMGLELGLGENLLMKTISESCG 182

Query: 190 KSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARAQGKDSQLRK 249
           KSLQQVK  Y+++GDLG IA  AR+VQPTMFKPKPLT G VF NL+ IA++ GKDSQL+K
Sbjct: 183 KSLQQVKLDYKDIGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQLKK 242

Query: 250 VQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHGGK-EPSSDLV 308
           ++LIKK+LTAC+G+EAK+LIRSLESKLRIGLAEKSVL++LSKA+L +E+    +P  +L+
Sbjct: 243 IRLIKKLLTACKGIEAKYLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELI 302

Query: 309 DAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAKPSKSISEVLD 368
           + AEQKIRDAFCQ+PNYEIVIN+ L++GIM L++HC L PGIPLKPMLAKP+K+I EV D
Sbjct: 303 EKAEQKIRDAFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFD 362

Query: 369 RFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISDFVAHPDETHTL 428
           RFQ   FT EYKYDGERAQVHL+ DGSMRIYSRNGENMTERYPEIN++DF+   + T +L
Sbjct: 363 RFQNIHFTSEYKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSL 422

Query: 429 ILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCYNDEPLINKSLA 488
           I+DCEAVAWD+++  ILPFQVLSTRKRK V  +D+KVR+CLFAFDILC+NDE LINKSL 
Sbjct: 423 IIDCEAVAWDREEKKILPFQVLSTRKRKDVDIKDIKVRICLFAFDILCHNDEKLINKSLR 482

Query: 489 ERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLDGEESHYEP 548
           ERR  L  + + V GE   A E++T +LDE+QL+LDQSVKD CEGLMVKVLDGE+SHYEP
Sbjct: 483 ERREILHSVTREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEP 542

Query: 549 SKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCK 608
           SKRSRNWLKLKKDYL GVGDSLDLCVL               FLLGCYNQDTGEFET CK
Sbjct: 543 SKRSRNWLKLKKDYLDGVGDSLDLCVLGAFYGRGKRTGTYGGFLLGCYNQDTGEFETACK 602

Query: 609 IGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEVLTADLSLSPVY 668
           IGTGFSDE+LQ+LY++L  T I  PKA Y+Y  SAQPDVW EP++LFEVLTADLS+SP+Y
Sbjct: 603 IGTGFSDEVLQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIY 662

Query: 669 KAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHI 714
           KAG S+Y KGISLRFPRFIR+R+DKSVE+ATSSEQ+IE YE+QSH+
Sbjct: 663 KAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQSHV 708

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  869 bits (2246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/680 (63%), Positives = 513/680 (75%), Gaps = 5/680 (0%)

Query: 36  QESAKKSQLNAIDAKPESSKGSQPNVDETNHETLQKPQLSAAEPKTEFAMNPAKLAVEKS 95
           Q S K+S+   +D     +K  +  VDE     +  P  +AA P  +   + + +   KS
Sbjct: 24  QMSTKRSKQLTLDGFLRPNKKQK--VDEEGDSAM--PDETAAAPPVKSESSLSNITPPKS 79

Query: 96  HGDVAKIGISAPK-DSNVMYSEMCSVFNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVP 154
            G+      S  K  SN+ ++E+C  F  IE TSSRL I  +CS FLYSVL +  + LVP
Sbjct: 80  RGETLTPVPSKLKFHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVP 139

Query: 155 ITYLLINKLGPDYQPXXXXXXXXXXXMKTISESCGKSLQQVKARYRELGDLGRIAQEARS 214
           ITYL I+KLGPDY+P           +KTISE+CGKS+QQ++ +YRE+GDLG IA +AR+
Sbjct: 140 ITYLFIHKLGPDYEPGLELGLGESLLIKTISEACGKSIQQIRNKYREIGDLGEIAMQARN 199

Query: 215 VQPTMFKPKPLTTGMVFANLQDIARAQGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLES 274
           VQPTMFKPKPLT G VF NL  IA++ GKDSQ RK  LIKKMLTAC+G EAKFLIRSLES
Sbjct: 200 VQPTMFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLES 259

Query: 275 KLRIGLAEKSVLVALSKAILTHEHGGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALE 334
           KLRIGLAEK+VL+++SKAILTHEH G+EPS+++V+ AE  IRDAFCQVPNYE++IN AL+
Sbjct: 260 KLRIGLAEKTVLISVSKAILTHEHNGQEPSTEMVEQAESLIRDAFCQVPNYEMIINVALQ 319

Query: 335 HGIMELEKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG 394
           +GIM L +H  L PGIPL+PMLAKP+KSISEVLDRFQG +FTCEYKYDGERAQVHL  DG
Sbjct: 320 YGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG 379

Query: 395 SMRIYSRNGENMTERYPEINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRK 454
           SM+IYSRNGE+MTERYPEI++  +V     T + I+D EAVAWD+++  ILPFQVLSTRK
Sbjct: 380 SMKIYSRNGEDMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRK 439

Query: 455 RKGVVAEDVKVRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTM 514
           RKGV  +DVKVRVCL+AFDILC NDEPLINKS  ERR  L        G+   A+E+TT 
Sbjct: 440 RKGVELKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTT 499

Query: 515 SLDEMQLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCV 574
           + DE+Q YLDQSVKD CEGLMVK+L+GEESHYEPSKRSRNWLKLKKDYL+GVGDSLDL V
Sbjct: 500 NFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVV 559

Query: 575 LXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPK 634
           L               FLLGCYN D+ EFETCCKIGTGFSDEMLQ+LY KL  T +  P 
Sbjct: 560 LGAYYGRGKRTGTYGGFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPS 619

Query: 635 AFYVYSESAQPDVWLEPSMLFEVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKS 694
              +Y  SA  DVW EPSMLFEVLTADLSLSPVYKAG  ++GKGISLRFPRF+RIRDDK+
Sbjct: 620 TNVIYDSSAPADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKN 679

Query: 695 VEDATSSEQVIEFYESQSHI 714
           V DATSS+QVIEFYESQ+H+
Sbjct: 680 VTDATSSDQVIEFYESQAHM 699

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  804 bits (2076), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/736 (56%), Positives = 511/736 (69%), Gaps = 60/736 (8%)

Query: 3   RTVRLSMSSAKKQATLAKFFSSKKRSNDEKEGPQ-ESAKKSQLNAIDAKPESSKGSQPNV 61
           RT+  S+  +KKQATLA+FF+S  +    K  P  E A K +       PE+      +V
Sbjct: 35  RTMSNSLEPSKKQATLARFFTSMGK----KTPPAVEVATKQE------SPEN------HV 78

Query: 62  DETNHETLQKPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSNVMYSEMCSVF 121
           D+     +   Q   A  K E   +  K                    S V+YSE+C++F
Sbjct: 79  DKKRKVEVHPSQSVGASEKAESPPDQTK--------------------STVLYSEVCNLF 118

Query: 122 NEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPXXXXXXXXXXXM 181
            +IE TSSRL I+KLCS+F   V+     D++ + YL IN+LGPDY+P           +
Sbjct: 119 QQIEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRLGPDYEPGLELGLGENLLI 178

Query: 182 KTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARAQ 241
           KTISE+ GKS++Q+K   +E GDLG IA++AR++QPTMFKPKPLT   VF NL+ IA A 
Sbjct: 179 KTISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASAT 238

Query: 242 GKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHGGK 301
           GKDSQLRK++LIK+ML+A +G+EAKFLIRSLESKLRIGLAEK+VL++LSKA+L HEH  +
Sbjct: 239 GKDSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKE 298

Query: 302 EPSS----------DLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIP 351
           +  S          DL++ AE K+R+A CQVPNYEIVIN  L+ GI+ ++K C L PGIP
Sbjct: 299 KGESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIP 358

Query: 352 LKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYP 411
           LKPMLAKP+K+I+EVL+ FQG+ F  EYKYDGERAQVHLL  G MRIYSRNGENMTERYP
Sbjct: 359 LKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYP 418

Query: 412 EINISDF------VAHPDETHT-------LILDCEAVAWDKDKNVILPFQVLSTRKRKGV 458
           E+++ DF      + +  E          +ILDCE VAWD ++  ILPFQVL+TRKRK V
Sbjct: 419 ELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNV 478

Query: 459 VAEDVKVRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDE 518
             +DVKVRVCLFAFD+L  N+E +INKSL ER+  L ++   VPGE Q A+ + T  +DE
Sbjct: 479 DLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDE 538

Query: 519 MQLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXX 578
           +Q +LDQ+VK+ CEGLMVK+LDGEESHYEPSKRSRNWLKLKKDYL GVGDSLDL V+   
Sbjct: 539 LQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAY 598

Query: 579 XXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYV 638
                       FLLGCYN+DT EFETCCKIGTGFSDEML NL+  L PTEI  P   Y+
Sbjct: 599 FGKGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYI 658

Query: 639 YSESAQPDVWLEPSMLFEVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDA 698
           Y  SA+PDVW +  +LFEVLTADLSLSPVYKAG S Y KGISLRFPRF+RIR+DK V D 
Sbjct: 659 YDSSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDG 718

Query: 699 TSSEQVIEFYESQSHI 714
           T+SE +IEFYESQSHI
Sbjct: 719 TTSEDIIEFYESQSHI 734

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/710 (56%), Positives = 495/710 (69%), Gaps = 26/710 (3%)

Query: 7   LSMSSAKKQATLAKFFSSKKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPNVDETNH 66
           L +  +KKQ TLA+FF+ ++  ++EK+    S  K Q+       +     QP       
Sbjct: 33  LPLPMSKKQVTLARFFAKREPKDEEKQS--SSPVKEQVQIQGQPQQEQVKIQPQ------ 84

Query: 67  ETLQKPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSNVMYSEMCSVFNEIEG 126
              ++ Q+   +  T     P      K            P  S++ Y+++C +F  IE 
Sbjct: 85  ---EQKQIVVPQEVTTSTQTPRPTKKSK------------PATSSLPYADLCQLFETIES 129

Query: 127 TSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPXXXXXXXXXXXMKTISE 186
            SSRL I  LC+ F    L      LVP+TYL INKLGPDY             +K I  
Sbjct: 130 ESSRLTITNLCTAFFSRTLQLDPSLLVPVTYLCINKLGPDYS-GVELGLGEGLLLKAIGS 188

Query: 187 SCGKSLQQVKARYRELGDLGRIAQEARSVQPT--MFKPKPLTTGMVFANLQDIARAQGKD 244
           +CG S QQ+K +YR+LGDLG++A   R +QPT  MFK +PLT   VF  L  IA +QGKD
Sbjct: 189 ACGVSQQQLKLQYRKLGDLGQLAMSTRVLQPTITMFKLEPLTITKVFDTLAKIAASQGKD 248

Query: 245 SQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHGGKEPS 304
           SQ +K+ +IK++LT+C+GVEAKFLIRSLESKLRIGLAEK+VL +L++A++ HE G     
Sbjct: 249 SQNQKINMIKRLLTSCQGVEAKFLIRSLESKLRIGLAEKTVLTSLARALVIHEKGNDNIQ 308

Query: 305 SDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAKPSKSIS 364
            D    AEQ I+D+FCQ+PNYEI+I  +L++G+ +L  H  LTPGIPLKPMLAKP+KSIS
Sbjct: 309 DDDYSNAEQIIKDSFCQIPNYEIIITTSLQYGVSQLASHIKLTPGIPLKPMLAKPTKSIS 368

Query: 365 EVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISDFVAHPDE 424
           EVLD FQ  +FT EYKYDGERAQVHLLPDGSMRIYSRNGE+MT+RYPE+NI D++     
Sbjct: 369 EVLDTFQNIQFTSEYKYDGERAQVHLLPDGSMRIYSRNGEDMTQRYPELNIQDYLVDSTT 428

Query: 425 THTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCYNDEPLIN 484
           T  LILDCEAVAWD +   ILPFQVLSTRKRK V  +D+KVRVCLFAFDIL +N++ LIN
Sbjct: 429 TTQLILDCEAVAWDVELQKILPFQVLSTRKRKSVDLKDIKVRVCLFAFDILRHNNDSLIN 488

Query: 485 KSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLDGEES 544
            +L ERR  L  I KP PG+ Q A+E+TT +LDE+Q +LD+++KD CEGLMVK LDG +S
Sbjct: 489 NTLRERRDILHSITKPCPGQFQFATELTTSNLDELQTFLDKAIKDSCEGLMVKSLDGTDS 548

Query: 545 HYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFE 604
           HYEPSKRSRNWLKLKKDYLQG+GDSLDLCVL               FLL CYNQDT EFE
Sbjct: 549 HYEPSKRSRNWLKLKKDYLQGMGDSLDLCVLGAYYGRGKRTGTYGGFLLACYNQDTEEFE 608

Query: 605 TCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEVLTADLSL 664
           TCCKIGTGFSDEMLQ LY  L  T I  P+A +V+  SA+PDVW  P+M+FEVLTADLSL
Sbjct: 609 TCCKIGTGFSDEMLQTLYNGLKETAIESPRANFVFDSSAEPDVWFNPTMVFEVLTADLSL 668

Query: 665 SPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHI 714
           SP+YKAG + YGKGISLRFPRFIRIR DKSV DATSSEQVI+FYE+QSH+
Sbjct: 669 SPIYKAGSTVYGKGISLRFPRFIRIRTDKSVNDATSSEQVIDFYENQSHL 718

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  112 bits (280), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 112/425 (26%), Positives = 180/425 (42%), Gaps = 75/425 (17%)

Query: 352 LKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMTERY 410
            +P LAK      EVL R    +FT E K DGER Q+H +  G  ++ +SR G + T  Y
Sbjct: 264 FEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGNDYTYLY 323

Query: 411 PE----INISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVR 466
            +      IS ++   ++    ILD E V++DK +N ILPF ++ +     +  + ++  
Sbjct: 324 GKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSLKIDGLEND 383

Query: 467 VC---LFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYL 523
           +C      FD+L  N  PL N  L +R+ YL  IL P    +++         + ++  L
Sbjct: 384 LCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAHDSESIRSAL 443

Query: 524 DQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXX 583
             ++    EG+++K  D   S Y    R+ +W+K+K +YL+  G++LDL V+        
Sbjct: 444 QAAISVGSEGIVLKKYD---SLYSVGDRNNDWIKVKPEYLEQFGENLDLIVIGRDPGKKD 500

Query: 584 XXXXXXXFL----------------LGCYNQDT---------------GEFETCCKIGTG 612
                   L                L   + D+                +F + C I  G
Sbjct: 501 SLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRITKFISFCVIANG 560

Query: 613 FSDEMLQNL-------YEKLSPTEIPEPKAFYVYSESAQPDVWLEP--SMLFEV----LT 659
            S+E  + +       ++K S      P   Y+   +  P  W+ P  S++ EV    L 
Sbjct: 561 ISNEEFKEIDRKTFGCWKKFSD---EAPPTDYLEFGTRLPVEWINPHDSVVLEVKARSLE 617

Query: 660 ADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDA-TSSEQVI---------EFYE 709
            + +L   +K G + YG      + R  RIR DK   D  T S+ VI         E Y 
Sbjct: 618 NNEALRDKFKTGYTLYGA-----YCR--RIRTDKDFNDCYTFSDLVIATNKKRSSSELYG 670

Query: 710 SQSHI 714
           + SHI
Sbjct: 671 NHSHI 675

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 101/382 (26%), Positives = 168/382 (43%), Gaps = 44/382 (11%)

Query: 349 GIPLKPMLAKP-SKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENM 406
           G+P  P LAK    S  +V  R +   F  E K DGER Q+H +  G  ++ +SR G + 
Sbjct: 253 GLPFAPFLAKRLYISYDKVALRLKSD-FYIEEKMDGERIQLHYMDYGRKLKWFSRRGNDY 311

Query: 407 TERYPEI----NISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAED 462
           T  Y E      ++ ++    +    +LD E +++D ++N +LPF ++ +  R  + AE 
Sbjct: 312 TYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEG 371

Query: 463 V---KVRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEM 519
           +     R      D L  N   LIN  L  R+ YL  IL P P  +++   +       +
Sbjct: 372 ILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSI 431

Query: 520 QLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXX 579
           +  L++++    EG+++K     +S YE   R+ NW+K+K +YL+  G++LDL V+    
Sbjct: 432 KSSLEKAIMMGSEGIILKHF---KSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDP 488

Query: 580 XXXXXXXXXXXFLLG-----------CYNQDTGE----------FETCCKIGTGFSDEML 618
                       L G             N D+ E          F + C I  G S E  
Sbjct: 489 GKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEF 548

Query: 619 QNLYEKLS----PTEIPEPKAFYVYSESAQPDVWLEP--SMLFEVLTADLSLSPVYKAGG 672
           + +  K +     TE  +P     +  S  P+ W+ P  S++ EV    L  +   ++ G
Sbjct: 549 KQIERKTAGKWKNTEDHKPPKILEFG-SKLPEEWIYPEDSVVLEVKARSLDNT---ESSG 604

Query: 673 SSYGKGISLRFPRFIRIRDDKS 694
             +  G +L      RIR+DK+
Sbjct: 605 RKFKVGCTLHGGYCRRIREDKN 626

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score =  106 bits (264), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 100/409 (24%), Positives = 168/409 (41%), Gaps = 55/409 (13%)

Query: 349 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNGENMT 407
           G    P LAK      E +       F  E K DGER QVH +  G+ +R  SR G + T
Sbjct: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327

Query: 408 ERYPEI----NISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDV 463
           + Y E      +++++         +LD E + +D D+NV+LPF ++ +  R+ +  E +
Sbjct: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387

Query: 464 ---KVRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQ 520
                R  L   D++  N   LI   L +R+ +L R+LKP P  +++   V       ++
Sbjct: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447

Query: 521 LYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXX 580
             L++S+    EG+   VL   ++ YE   R+  W+K+K +YL+  G++LDL ++     
Sbjct: 448 KSLEKSISMGSEGI---VLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPG 504

Query: 581 XXXXXXXXXXFLLGCYNQDTGEFE------------------------------TCCKIG 610
                        G   +D  E E                              + C I 
Sbjct: 505 KKDSLMCGLAVYEG--EEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562

Query: 611 TGFSDEMLQNLYEKLSPTEIPE----PKAFYVYSESAQPDVWLEP--SMLFEVLTADLSL 664
            G S +  + +  K     +      P A  +   S  P+ W++P  S++ EV    L  
Sbjct: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622

Query: 665 SPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSH 713
           +   ++    +  G +L      RIRDDK   D T      E ++ + H
Sbjct: 623 T---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  106 bits (264), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 109/416 (26%), Positives = 173/416 (41%), Gaps = 66/416 (15%)

Query: 349 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMT 407
           G    P +A+  K   E +    G  F  E K DG+R QVH +  G S+  +SRNG N T
Sbjct: 291 GYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINYT 350

Query: 408 ERYPEIN----ISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDV 463
             Y E +    IS+ +   +     ILD E V++DK+   ILPF +  +     V  E  
Sbjct: 351 YLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETT 410

Query: 464 -----KVRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDE 518
                  R     FD+L  N + L N+ + +R+ YLE+IL P    + L S       + 
Sbjct: 411 GHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAEA 470

Query: 519 MQLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXX 578
           +   L  +V    EG+   VL    S Y   KR  +W+K+K +YL+  G+++DL V+   
Sbjct: 471 ITAALGAAVAHGSEGI---VLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVI--- 524

Query: 579 XXXXXXXXXXXXFLLGCYNQDTGE----------------------------FETCCKIG 610
                       F+      D  E                            F + C I 
Sbjct: 525 ---GRDKGRKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQPKIEKFISFCSIA 581

Query: 611 TGFSDEMLQNLYEKLS-----PTEIPEPKAFYVYSESAQPDVWLEP--SMLFEV----LT 659
            G S+E  + + ++L+     P +  +P   +V   +  P  W++P  S++ EV    + 
Sbjct: 582 NGISNEEFKEI-DRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSID 640

Query: 660 ADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHIN 715
            + S S +YK G + Y            RIR DK+   A++  +     E++S+ N
Sbjct: 641 NEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTASTVAEYDTAREARSYFN 689

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score =  105 bits (263), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 133/259 (51%), Gaps = 14/259 (5%)

Query: 328 VINAALEHGIMELEKH-CVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERA 386
           V++  L +  M L K+   +  G    P LAK      E +     Q F  E K DGER 
Sbjct: 254 VLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERI 313

Query: 387 QVHLLPDGS-MRIYSRNGENMTERYPEI----NISDFVAHPDETHTLILDCEAVAWDKDK 441
           Q+H +  G+ +R  SR G + T  Y +      IS  +   ++    +LD E V++DK+K
Sbjct: 314 QLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEK 373

Query: 442 NVILPFQVLSTRKRKGVVAEDVKV-----RVCLFAFDILCYNDEPLINKSLAERRTYLER 496
           NV+LPF ++ +   + ++  D KV     R     FD++  N   L    L  R++YL  
Sbjct: 374 NVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRS 433

Query: 497 ILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWL 556
           IL PV   +++ S+V     + +++ L+++++   EG+++K      S YE   R+ +W+
Sbjct: 434 ILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQF---SSPYEIGARNDSWI 490

Query: 557 KLKKDYLQGVGDSLDLCVL 575
           K+K +Y + +G+++DL V+
Sbjct: 491 KIKPEYFEELGETMDLVVI 509

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  103 bits (256), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 103/403 (25%), Positives = 165/403 (40%), Gaps = 49/403 (12%)

Query: 349 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMT 407
           G    P LAK      E + R     F  E K DGER QVH +  G S+R YSR G + T
Sbjct: 251 GFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGIDYT 310

Query: 408 ERYPEINISDFVAH----PDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVV---A 460
             Y     S  ++H     D     +LD E V +D  + VILPF ++    +  +     
Sbjct: 311 YLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSFNSI 370

Query: 461 EDVKVRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQ 520
            +V        FD+L  N   L    L +R+ YLE IL PV   +++       +++ ++
Sbjct: 371 NNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNVESIK 430

Query: 521 LYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXX 580
             L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YL+  G++LDL ++     
Sbjct: 431 KSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGRDPG 487

Query: 581 XXXXXXXXXXFL-------------LGCYNQDTGE-----------FETCCKIGTGFSDE 616
                      L              G  N    E             + C +  G S E
Sbjct: 488 KKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVANGISQE 547

Query: 617 MLQNLYEKL-----SPTEIPEPKAFYVYSESAQPDVWLEP--SMLFEVLTADLSLSPVYK 669
             + +  K        +E+  P + + +  S  P  W+EP  S++ E+ +  L  +   +
Sbjct: 548 EFKEIDRKTRGCWKKTSEVAPPASIFEFG-SKIPAEWIEPNESIVLEIKSRSLDNT---E 603

Query: 670 AGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQS 712
                Y    +L      RIR DK   D T    + E Y+S+S
Sbjct: 604 TNMQKYATSCTLYGGYCKRIRFDK---DWTDCFTLNELYDSRS 643

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 132/286 (46%), Gaps = 15/286 (5%)

Query: 299 GGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAK 358
           GG+E     ++A     +D    V +   V     +  I       V+ PG    P LAK
Sbjct: 211 GGQE--HKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDLVINPGFAFAPQLAK 268

Query: 359 P-SKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMTERYPEINIS 416
             S S  ++  + +   F  E K DGER Q+H    G  ++ +SR G + T  Y E    
Sbjct: 269 KLSISYEKICMKLKND-FIIEEKMDGERIQLHYQDYGEKLKFFSRRGTDYTYLYGESIHD 327

Query: 417 DFVAH----PDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDV---KVRVCL 469
            F+        +    ILD E + +DK +N+ILPF ++ +  R  +  + +     +   
Sbjct: 328 GFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTKDGIMNEGYQPLF 387

Query: 470 FAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKD 529
             FD++  N   L N  L  R+ YL  I  P P  ++L S     + D ++  L+ ++  
Sbjct: 388 MVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNEDSIRKSLELAISM 447

Query: 530 CCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 575
             EG+++K  D   S Y  + R+ +W+K+K +YL+  G+++DL V+
Sbjct: 448 GSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 490

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  100 bits (248), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 95/401 (23%), Positives = 178/401 (44%), Gaps = 51/401 (12%)

Query: 346 LTPGIPLKPMLAKPSK-SISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNG 403
           +T     +P LAK +  S   V  + Q   F  E K DGER Q+H +  G  ++  SR G
Sbjct: 241 ITISHAFEPQLAKRTHLSYERVASKLQ-HDFIIEEKMDGERLQIHYINYGEQIKYLSRRG 299

Query: 404 ENMTERYPEINISDFVAHPDETHTLILDC----EAVAWDKDKNVILPFQVLSTRKRKGVV 459
            + +  Y E + S  ++   + H  + DC    E + +D +K+++LPF ++ +     + 
Sbjct: 300 VDFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQ 359

Query: 460 AEDVKV------RVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTT 513
           +E   +      +    AFD++  N + L N +L  R+ YL +IL PV   +++   +  
Sbjct: 360 SELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKA 419

Query: 514 MSLDEMQLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLC 573
           ++ + ++  L+Q++    EG+++K L    S Y    R+ +W+K+K +YL+  G+++DL 
Sbjct: 420 INAEAIKDSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLL 476

Query: 574 VLXXXXXXXXXXXXXXXFLLGCYNQDTGE------FETCCKIGTGFSDEMLQNLYEKLSP 627
           ++               F  G    D  E      F + C I  G S+E  +++  K   
Sbjct: 477 II------GREQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTW- 529

Query: 628 TEIPEPKAFYVYSE-----------SAQPDVWLEP--SMLFEVLTADLSLSPVYKAGGSS 674
                   ++++SE           +  P  W+ P  S++ EV    +      K     
Sbjct: 530 ------GKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEK---RK 580

Query: 675 YGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHIN 715
           Y  G +L F    +IR DK  +   S  +  +  ++++  N
Sbjct: 581 YRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYN 621

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 77/299 (25%), Positives = 137/299 (45%), Gaps = 20/299 (6%)

Query: 286 LVALSKAILTHEHGGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCV 345
           ++  S+ I  HEH         ++      +D    V + + V N   +  +        
Sbjct: 211 IILKSRVIGGHEH-------KFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLKNDDLT 263

Query: 346 LTPGIPLKPMLAKP-SKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNG 403
           +  G P  P  AK  S S  ++  + +   F  E K DGER Q+H    G+ +   SR G
Sbjct: 264 INVGSPFAPQSAKKLSISYEKICAKLK-HDFFIEEKMDGERIQLHYQDYGNKLSFLSRRG 322

Query: 404 ENMTERYPEI----NISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVV 459
            + T  Y E      +S ++   +     +LD E V +DK++N +LPF ++ +  R  + 
Sbjct: 323 TDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSARSIIT 382

Query: 460 AEDVK---VRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSL 516
            E V     R  L  FD++  N   L+N  L +R+ YLE+I  P    ++L         
Sbjct: 383 QEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKRCSDE 442

Query: 517 DEMQLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 575
             ++  L+ ++    EG+++K  +   S Y  + R+ +W+K+K +YL+  G+++DL V+
Sbjct: 443 RSIKNALEHAISIGSEGVVLKHYN---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 498

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 135/293 (46%), Gaps = 18/293 (6%)

Query: 291 KAILTHEHGGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGI 350
           + I  HEH        L++A      D F  V +   V     E  +    +   L  G 
Sbjct: 201 RIIGGHEH-------KLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGS 253

Query: 351 PLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNGENMTER 409
              P LAK      E + +  G  F+ E K DGER Q+H +  G+ ++  SR G + T  
Sbjct: 254 AFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYL 313

Query: 410 Y----PEINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVK- 464
           Y        I+ ++   +     ILD E V +D++K +ILPF ++ +  +  +  E +  
Sbjct: 314 YGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLSKESISN 373

Query: 465 --VRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLY 522
                   AFD++  N   L++  L +R+ YL +IL    G + + S     +L+ +   
Sbjct: 374 GSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNLESITKS 433

Query: 523 LDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 575
           L  ++    EG+++K L+   S Y  + R+ +W+K+K  YL+  G+++DL ++
Sbjct: 434 LAAAISVGSEGIILKKLN---SRYMVASRNDSWIKIKPQYLKQFGENMDLIII 483

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score = 97.1 bits (240), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 98/391 (25%), Positives = 166/391 (42%), Gaps = 49/391 (12%)

Query: 349 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNGENMT 407
           G    P LAK      E +       F  E K DGER Q+H +  GS ++  SR G + +
Sbjct: 262 GHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFS 321

Query: 408 ERY-PEIN---ISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDV 463
             Y  E+    IS ++    +    +LD E V++DK + +ILPF ++ +     ++  +V
Sbjct: 322 HLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSEV 381

Query: 464 K-----VRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDE 518
                  R     FD++  N   L    L  R+ YL+ IL PVP  +++   +       
Sbjct: 382 GNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKA 441

Query: 519 MQLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXX 578
           ++ ++ ++++   EG++VK      S YE   R+ +W+K+K +Y + +G+++DL V+   
Sbjct: 442 IKNFMQRAIEMGSEGVIVK---QASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVI--- 495

Query: 579 XXXXXXXXXXXXFLLGCYNQDT-------GEFE------------TCCKIGTGFSDEMLQ 619
                        + G    D+       G  E            + C +  G SDE  +
Sbjct: 496 ---GRDPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFK 552

Query: 620 NLYEK-----LSPTEIPEPKAFYVYSESAQPDVWLEP--SMLFEVLTADLSLSPVYKAGG 672
            +  K     +S  E P P +   +  S  P  W++P  S++ EV    +  S   +   
Sbjct: 553 EINRKTRGSWVSYKEKPPPLSLLEFG-SKIPVEWIDPKNSVVIEVKARSVENS---EYSS 608

Query: 673 SSYGKGISLRFPRFIRIRDDKSVEDATSSEQ 703
             Y  G +L      RIR+DK     TS  Q
Sbjct: 609 KRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQ 639

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score = 97.1 bits (240), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 93/388 (23%), Positives = 166/388 (42%), Gaps = 62/388 (15%)

Query: 349 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNGENMT 407
           G+   P LA       + +    G  F  E K DGER Q+H    GS ++ YSR   + T
Sbjct: 266 GLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYT 325

Query: 408 ERYPEI----NISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDV 463
             Y        +++F+         +LDCE V +D +  ++LPF ++ +  +  +  + +
Sbjct: 326 YLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGI 385

Query: 464 KVRV---CLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQ 520
             +     L  FD+L  N   L++    +RR YL++IL P    +++   +       ++
Sbjct: 386 DTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQMIK 445

Query: 521 LYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXX 580
             L++++    EG+++K  D   S Y  + RS +W+K+K +YL+  G+++DL ++     
Sbjct: 446 KSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDLVLM----- 497

Query: 581 XXXXXXXXXXFLLGCY-------------NQDTGE--------FETCCKIGTGFSDE--- 616
                      +LG               N  + E        F + C I  G S+E   
Sbjct: 498 -GRDPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEYK 556

Query: 617 -------MLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEP--SMLFEVLTADLSLSPV 667
                   L N  EK+ P E       Y+   S  P  W++P  S++ E+    L  +  
Sbjct: 557 EIDRKTKGLWNDSEKIPPLE-------YMKFGSKVPRQWIDPKKSLILEIKARSLDNT-- 607

Query: 668 YKAGGSSYGKGISLRFPRFIR-IRDDKS 694
            ++    +  G +L F  + R IR+DK+
Sbjct: 608 -RSSERKFAAGCTL-FGGYCRQIREDKN 633

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score = 97.1 bits (240), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 105/459 (22%), Positives = 185/459 (40%), Gaps = 63/459 (13%)

Query: 299 GGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAK 358
           GG+E    L++      +D    + + ++V +   +  +   +    +  G    P LAK
Sbjct: 203 GGQE--HKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAK 260

Query: 359 PSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMTERY----PEI 413
                 E + R     F  E K DGER QVH +  G S++ +SR G + T  Y       
Sbjct: 261 KVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGIDYTYLYGASLSSG 320

Query: 414 NISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVV---AEDVKVRVCLF 470
            IS  +   D     +LD E V +D  + VILPF ++    ++ +      +V       
Sbjct: 321 TISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFNSINNVDFHPLYM 380

Query: 471 AFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDC 530
            FD+L  N   L    L +R+ YL  IL P+   +++        ++ ++  L+ ++   
Sbjct: 381 VFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVESIKKSLEVAISLG 440

Query: 531 CEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXX 590
            EG+++K  +   S Y  + R+ NW+K+K +YL+  G++LDL V+               
Sbjct: 441 SEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLIVI------GRDSGKKDS 491

Query: 591 FLLGCYNQDTGEFE------------------------------TCCKIGTGFSDEMLQN 620
           F+LG    D  E++                              + C I  G S E  + 
Sbjct: 492 FMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQEEFKE 551

Query: 621 LYEKL-----SPTEIPEPKAFYVYSESAQPDVWLEP--SMLFEVLTADLSLSPVYKAGGS 673
           +  K        +E+  P +   +  S  P  W++P  S++ E+ +  L  +   +    
Sbjct: 552 IDRKTRGHWKRTSEVAPPASILEFG-SKIPAEWIDPSESIVLEIKSRSLDNT---ETNMQ 607

Query: 674 SYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQS 712
            Y    +L      RIR DK   D  +   + + YES++
Sbjct: 608 KYATNCTLYGGYCKRIRYDKEWTDCYT---LNDLYESRT 643

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 111/235 (47%), Gaps = 11/235 (4%)

Query: 349 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMT 407
           G    P LAK      E + R     F  E K DGER QVH +  G S++ +SR G + T
Sbjct: 251 GFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGIDYT 310

Query: 408 ERY----PEINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDV 463
             Y        IS ++   +     +LD E V +D  + VILPF ++    +  +   D+
Sbjct: 311 YLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCSDI 370

Query: 464 K---VRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQ 520
                R     FD+L  N+  L    L +R+ YL  IL P    +++        +  ++
Sbjct: 371 NNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQSVK 430

Query: 521 LYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 575
             L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YL+  G++LDL ++
Sbjct: 431 NSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDLIII 482

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 105/453 (23%), Positives = 182/453 (40%), Gaps = 65/453 (14%)

Query: 286 LVALSKAILTHEHGGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCV 345
           ++  ++ I  HEH        L++A      D    V + + V        I        
Sbjct: 195 IILKARVIGPHEHK-------LLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELS 247

Query: 346 LTPGIPLKPMLAKP-SKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNG 403
           +  G    P LAK  S S  ++  + +   F  E K DGER Q+H +  G+ ++  SR G
Sbjct: 248 INIGYAFAPHLAKKLSISYDKICKKLKND-FFIEEKMDGERIQIHYMDYGNDIKFLSRRG 306

Query: 404 ENMTERYPEI----NISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVV 459
            + T  Y E      I+ ++    +    +LD E V +D+D++++LPF ++ +     + 
Sbjct: 307 VDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALT 366

Query: 460 AEDVK---VRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSL 516
            E++        L  FD++  N   L+   L +R+ YL  +L+P    +Q+ +     + 
Sbjct: 367 KEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNE 426

Query: 517 DEMQLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLX 576
           + ++  L+ ++    EG+   VL    S Y    R+ +W+K+K +YL+  G+++DL V+ 
Sbjct: 427 NIIRKSLEHAISVGSEGI---VLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIG 483

Query: 577 XXXXXXXXXXXXXXFL------------LGCYN--QDTGEFE------------TCCKIG 610
                          L             G  N   D  ++E            + C I 
Sbjct: 484 RDSAKKDSFYCGLTVLDEEEEKLVEEIDKGVVNLVSDESDYENPENNRHIKKVVSFCMIA 543

Query: 611 TGFSDEMLQNLYEKL-----SPTEIPEPKAFYVYSESAQPDVWLEP--SMLFEVLTADL- 662
            G S    + +Y K         E+P P     +     P  W+EP  S++ E+    L 
Sbjct: 544 NGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQV-PMEWIEPEHSVVLEIKARSLD 602

Query: 663 ---SLSPVYKAGGSSYGKGISLRFPRFIRIRDD 692
              S    +KAG + YG           RIRDD
Sbjct: 603 NTESSCKRFKAGCTLYGGYCR-------RIRDD 628

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 126/286 (44%), Gaps = 15/286 (5%)

Query: 299 GGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAK 358
           GG+E    L++      +D    V +  +V +   +  I        +  G    P LAK
Sbjct: 203 GGQE--HKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIKVGFAFAPQLAK 260

Query: 359 PSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMTERYPEIN--- 414
                 E +       F  E K DGER QVH +  G S++ +SR G + T  Y  +N   
Sbjct: 261 KVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTYLYG-VNLLS 319

Query: 415 --ISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVK---VRVCL 469
             IS ++   D     +LD E V +D  + VILPF ++    ++ +   D+         
Sbjct: 320 GTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFNDINNNDFHPLY 379

Query: 470 FAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKD 529
             FD+L  N   L    L +R+ YL  IL P    +++         + ++  L+ ++  
Sbjct: 380 MVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAESVKKSLEVAISL 439

Query: 530 CCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 575
             EG+   VL    S Y  + R+ NW+K+K +YL+  G++LDL ++
Sbjct: 440 GSEGV---VLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIII 482

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 109/235 (46%), Gaps = 11/235 (4%)

Query: 349 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMT 407
           G    P LAK      + +       F  E K DGER Q+H +  G +++ +SR+G + T
Sbjct: 272 GYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFSRHGTDYT 331

Query: 408 ERYPEI----NISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDV 463
             Y        I+ F+         +LD E V +D     +LPF ++ +     +  +D+
Sbjct: 332 YLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQLNKKDI 391

Query: 464 ---KVRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQ 520
                      FDIL  N   LI+  L +R+ +L  +L P    +++ S +      +++
Sbjct: 392 DNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTDSIQIK 451

Query: 521 LYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 575
             LD ++    EG+   VL    S Y P+ R  NW+K+K +YL+  G+++DL V+
Sbjct: 452 KGLDAAISVGSEGI---VLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIVI 503

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 109/209 (52%), Gaps = 11/209 (5%)

Query: 375 FTCEYKYDGERAQVHLLPDGS-MRIYSRNGENMTERYPEIN----ISDFVAHPDETHTLI 429
           F  E K DGER Q+H +  G+ ++  SR G + +  Y +      I  ++    +    I
Sbjct: 299 FFIEEKMDGERIQLHYMNYGAKLKFLSRRGLDYSYLYGDNRNNGAIGRYLNFHKDVKECI 358

Query: 430 LDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVK---VRVCLFAFDILCYNDEPLINKS 486
           LD E V +D  KN ILPF ++ +   + +   D++         AFD++  N   L    
Sbjct: 359 LDGEMVTYDSVKNCILPFGLVKSSAMQSLSVSDIEPDGYHPLYMAFDLVYLNGSSLSTLP 418

Query: 487 LAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLDGEESHY 546
           L +R+ YL+++L P P  +++   +       ++  L+++++   EG+++K  D   S Y
Sbjct: 419 LHQRKNYLDKLLIPCPDFVEILPALHCNDSSLIKSSLEKAIELGSEGIILKRFD---SQY 475

Query: 547 EPSKRSRNWLKLKKDYLQGVGDSLDLCVL 575
             +KRS +W+K+K +YL+  G+++DL V+
Sbjct: 476 LVAKRSDDWIKIKPEYLEQFGENMDLIVI 504

>KLTH0G10120g Chr7 complement(857050..857694) [645 bp, 214 aa] {ON}
           similar to uniprot|P53615 Saccharomyces cerevisiae
           YNL036W NCE103 Carbonic anhydrase poorly transcribed
           under aerobic conditions and at an undetectable level
           under anaerobic conditions involved in non-classical
           protein export pathway
          Length = 214

 Score = 37.7 bits (86), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 11/101 (10%)

Query: 404 ENMTERYPEINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAE-D 462
           E MTE +P +   DF AH    HTL + C    +++    ++P ++ + +    VV++ D
Sbjct: 29  EKMTEAHPTL-FRDFNAHGQAPHTLFIGCSDSRYNEQCLGVIPGEIFTWKTIANVVSDKD 87

Query: 463 VKVRVCL-FAFDILCYNDEPL--------INKSLAERRTYL 494
           +  R  L FA ++L  N   L        IN  LA +R  L
Sbjct: 88  LTCRATLEFAINVLKVNKVVLCGHTDCGGINTCLALKREAL 128

>KLTH0E11352g Chr5 (1014490..1017447) [2958 bp, 985 aa] {ON} similar
           to uniprot|P48526 Saccharomyces cerevisiae YPL040C ISM1
           Mitochondrial isoleucyl-tRNA synthetase null mutant is
           deficient in respiratory growth
          Length = 985

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 48/97 (49%), Gaps = 10/97 (10%)

Query: 611 TGFSDEMLQNLY-EKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEVLTADLSLSPVYK 669
           +G +  +L++ Y ++L  TE+P P A      S Q   W + S+L ++ T++ + +P   
Sbjct: 578 SGSTWNVLEDFYTQRLKLTEMPYPLADVYLEGSDQHRGWFQSSLLTKIATSEQAAAP--- 634

Query: 670 AGGSSYGKGISLRFPRFIR-IRDDKSVEDATSSEQVI 705
                YG  I+  F    R I+  KS+ +  S E VI
Sbjct: 635 -----YGTVITHGFTLDERGIKMSKSIGNTISPETVI 666

>NCAS0G03410 Chr7 (624153..627323) [3171 bp, 1056 aa] {ON} Anc_1.506
           YKL197C
          Length = 1056

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 77/189 (40%), Gaps = 51/189 (26%)

Query: 184 ISESCGKSLQQVKA---RYRELG----DLGRIAQEARSVQPTMFKPKPLTTGMVFANLQD 236
           I++ CG +   VK      + +G    ++  + ++A+SV+P +         + F     
Sbjct: 753 IAQQCGLNFLSVKGPEILNKYIGASEQNVRELFEKAQSVKPCI---------LFFDEFDS 803

Query: 237 IARAQGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTH 296
           IA  +G DS     +++ ++LT  +G E              GL    VL A S+     
Sbjct: 804 IAPKRGHDSSGVTDRVVNQLLTQMDGAE--------------GLDGVYVLAATSRP---- 845

Query: 297 EHGGKEPSSDLVDAAEQKI----RDAFCQVPNYE---IVINAALEHGIMELEKHCVLTPG 349
                    DL+D+A  +     +   C +PN +    +I A   HG     K   L PG
Sbjct: 846 ---------DLIDSALLRPGRLDKSILCNIPNEDERHDIICAITGHGRTSKSK-LKLAPG 895

Query: 350 IPLKPMLAK 358
           + L+P++ K
Sbjct: 896 VILQPIIKK 904

>Kpol_1042.13 s1042 complement(25499..29014) [3516 bp, 1171 aa] {ON}
           complement(25499..29014) [3516 nt, 1172 aa]
          Length = 1171

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 265 AKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHGGKEPSSDLVDAAEQKIRDAFCQVPN 324
            K  +RSLE   R  L  ++ +  LSK +LTH  GG   +  ++   E+ + +A  Q+  
Sbjct: 402 TKLAVRSLED--RSSLVRRNAVKLLSKLLLTHPFGGMNGNQLILKDWEKCLEEATAQLDK 459

Query: 325 YE 326
           YE
Sbjct: 460 YE 461

>Smik_8.288 Chr8 complement(472376..473305) [930 bp, 309 aa] {ON}
           YHR199C (REAL)
          Length = 309

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 29/61 (47%)

Query: 289 LSKAILTHEHGGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTP 348
           L    L+      E SS LV + ++K+RDA        I+IN  L+ GI  + K+  +  
Sbjct: 134 LDSKFLSQAFIDTESSSSLVKSHQEKLRDALNDPAKAPILINNLLDSGIRLMSKNTPIKA 193

Query: 349 G 349
           G
Sbjct: 194 G 194

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,251,848
Number of extensions: 2873751
Number of successful extensions: 9782
Number of sequences better than 10.0: 81
Number of HSP's gapped: 10053
Number of HSP's successfully gapped: 85
Length of query: 715
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 598
Effective length of database: 40,065,477
Effective search space: 23959155246
Effective search space used: 23959155246
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)