Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.246107.342ON5082569181e-118
KLTH0H01430g7.342ON5022568471e-107
SAKL0F10934g7.342ON4982605946e-70
NCAS0H006707.342ON4832685865e-69
KLLA0C16731g7.342ON4782585727e-67
TDEL0C020507.342ON5012625633e-65
KAFR0L014607.342ON5502685645e-65
YLR206W (ENT2)7.342ON6132685676e-65
Skud_12.2707.342ON6262745677e-65
Smik_4.757.342ON4602625551e-64
Skud_4.947.342ON4472615522e-64
Smik_12.2647.342ON6122685581e-63
YDL161W (ENT1)7.342ON4542615436e-63
TPHA0D045607.342ON4872605441e-62
Suva_4.837.342ON4622615376e-62
Ecym_47317.342ON5142585329e-61
ZYRO0F11550g7.342ON5382585279e-60
Suva_10.3007.342ON6181255273e-59
NDAI0D006107.342ON4862675177e-59
KNAG0C038007.342ON4472685094e-58
Kpol_2001.707.342ON5332555093e-57
CAGL0A03872g7.342ON5102664988e-56
TBLA0E004807.342ON5991294897e-54
ACL157C7.342ON5152614803e-53
KAFR0B008907.342ON4141214508e-50
KNAG0B026507.342ON6461264442e-47
TBLA0E020407.342ON7012684084e-42
Suva_12.2164.346ON4101252301e-19
Kwal_47.168574.346ON3821232291e-19
Skud_10.3494.346ON4101252254e-19
KNAG0M003804.346ON4031232254e-19
Smik_10.4184.346ON4091252245e-19
YJR125C (ENT3)4.346ON4081252246e-19
KLTH0D16896g4.346ON4011232236e-19
TBLA0E047604.346ON4261252246e-19
NDAI0D032004.346ON4351232247e-19
SAKL0G17952g4.346ON4151232221e-18
NCAS0A062104.346ON4231232221e-18
KLLA0B04587g4.346ON4001232211e-18
KAFR0B067404.346ON3991232211e-18
CAGL0H04323g4.346ON4121232202e-18
TDEL0D007104.346ON3751232182e-18
AER155C4.346ON3641232121e-17
Kpol_1001.24.346ON4181252103e-17
ZYRO0B14784g4.346ON4241252095e-17
TPHA0B004004.346ON3991252077e-17
Ecym_11334.346ON3921231891e-14
SAKL0H25762g4.17ON2621111602e-11
Kwal_55.206114.17ON2541111574e-11
TBLA0B062204.346ON3391191604e-11
Kpol_388.54.17ON2681051503e-10
KLTH0E05874g4.17ON2551111406e-09
ZYRO0G07876g4.17ON2591001344e-08
TDEL0G017404.17ON2571131292e-07
Ecym_84074.17ON2541201263e-07
TPHA0F002304.17ON2801101273e-07
TBLA0G006504.17ON4231241276e-07
KLLA0D03949g4.17ON2251021238e-07
CAGL0E03806g4.17ON2601001176e-06
Suva_10.354.17ON2471151176e-06
Skud_12.304.17ON2471031151e-05
YLL038C (ENT4)4.17ON2471031151e-05
Smik_12.194.17ON2471031151e-05
ACL061C4.17ON2341051132e-05
NCAS0C058404.17ON2671091042e-04
TBLA0H012108.335ON491971010.001
NDAI0H002804.17ON310110990.001
SAKL0H02530g5.84ON66990960.005
KAFR0B058008.335ON38297930.009
KLLA0D16654g8.335ON39997930.009
AGR046C8.335ON38797920.012
NCAS0B036608.335ON416102910.014
YHR161C (YAP1801)5.84ON63768920.014
KAFR0I014604.17ON275114890.019
NDAI0J009308.335ON418116890.023
KNAG0A051008.335ON421101890.028
CAGL0E01199g8.335ON41297880.033
ZYRO0F13684g8.335ON40797870.045
Skud_8.2255.84ON62168850.083
KNAG0J028704.17ON329135840.085
TBLA0A040408.335ON41596830.14
Kwal_YGOB_27.112618.335ON404105830.14
KLTH0G11902g8.335ON39999820.18
Kwal_27.11263singletonOFF275105810.20
Smik_8.2455.84ON62768810.30
Kpol_344.88.335ON384102790.38
Suva_2.3158.335ON40397790.46
TDEL0F045908.335ON36197780.60
Skud_4.4128.335ON40697770.74
SAKL0H15290g8.335ON39397760.87
Smik_4.3988.335ON41697760.88
YDR153C (ENT5)8.335ON41197760.89
TPHA0C007408.335ON38597760.93
Kpol_1036.768.335ON36897741.6
Kpol_1050.735.84ON67162732.5
TDEL0G010805.84ON51542706.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.24610
         (508 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   358   e-118
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   330   e-107
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   233   6e-70
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    230   5e-69
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   224   7e-67
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   221   3e-65
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   221   5e-65
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   223   6e-65
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   223   7e-65
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   218   1e-64
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   217   2e-64
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   219   1e-63
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   213   6e-63
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   214   1e-62
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   211   6e-62
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   209   9e-61
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   207   9e-60
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   207   3e-59
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   203   7e-59
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   200   4e-58
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   200   3e-57
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   196   8e-56
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   192   7e-54
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   189   3e-53
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   177   8e-50
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   175   2e-47
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   161   4e-42
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    93   1e-19
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    93   1e-19
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    91   4e-19
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    91   4e-19
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    91   5e-19
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    91   6e-19
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    91   6e-19
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    91   6e-19
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    91   7e-19
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    90   1e-18
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    90   1e-18
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    90   1e-18
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    90   1e-18
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    89   2e-18
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    89   2e-18
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    86   1e-17
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    86   3e-17
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    85   5e-17
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    84   7e-17
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    77   1e-14
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    66   2e-11
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    65   4e-11
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    66   4e-11
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    62   3e-10
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    59   6e-09
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    56   4e-08
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    54   2e-07
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    53   3e-07
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    54   3e-07
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    54   6e-07
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    52   8e-07
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    50   6e-06
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    50   6e-06
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    49   1e-05
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    49   1e-05
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    49   1e-05
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    48   2e-05
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    45   2e-04
TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.3...    44   0.001
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    43   0.001
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    42   0.005
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    40   0.009
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    40   0.009
AGR046C Chr7 complement(800910..802073) [1164 bp, 387 aa] {ON} S...    40   0.012
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    40   0.014
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    40   0.014
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    39   0.019
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    39   0.023
KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.3...    39   0.028
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    39   0.033
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    38   0.045
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    37   0.083
KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.1...    37   0.085
TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa] ...    37   0.14 
Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)...    37   0.14 
KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} simi...    36   0.18 
Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {O...    36   0.20 
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    36   0.30 
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    35   0.38 
Suva_2.315 Chr2 complement(560767..560940,560968..561033,561037....    35   0.46 
TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {O...    35   0.60 
Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON...    34   0.74 
SAKL0H15290g Chr8 (1322030..1323211) [1182 bp, 393 aa] {ON} simi...    34   0.87 
Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON...    34   0.88 
YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}  ...    34   0.89 
TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.3...    34   0.93 
Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa] ...    33   1.6  
Kpol_1050.73 s1050 complement(162665..164488,164492..164527,1645...    33   2.5  
TDEL0G01080 Chr7 (220997..222544) [1548 bp, 515 aa] {ON} Anc_5.8...    32   6.0  

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  358 bits (918), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 183/256 (71%), Positives = 183/256 (71%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120

Query: 121 IVRVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGSEDEDLQRAMEESRLTAEQEE 180
           IVRVK                                AGSEDEDLQRAMEESRLTAEQEE
Sbjct: 121 IVRVKARELTALLLDDERLREERSLRTKNRKPRRRPTAGSEDEDLQRAMEESRLTAEQEE 180

Query: 181 AERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           AERRRKLEIYDNSSDDLQTA                                        
Sbjct: 181 AERRRKLEIYDNSSDDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLSQQQTQAQ 240

Query: 241 XPMYYDVFGNPISAEE 256
            PMYYDVFGNPISAEE
Sbjct: 241 QPMYYDVFGNPISAEE 256

 Score =  255 bits (652), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 131/184 (71%)

Query: 325 PLETGSNNPFARHSNQNANEDASKYANVAPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 384
           PLETGSNNPFARHSNQNANEDASKYANVAPS                             
Sbjct: 325 PLETGSNNPFARHSNQNANEDASKYANVAPSPPQDNQLLSQQQQLQQEQQQQQQQQQQPQ 384

Query: 385 XXXXXXXXXXTRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQ 444
                     TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQ
Sbjct: 385 PQPQPQPLKQTRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQ 444

Query: 445 GTGYKQVSSTPKHNPFLGQQYTGLPSTNVVPSYTGYGFGXXXXXXXXXXXXXXGADQGMS 504
           GTGYKQVSSTPKHNPFLGQQYTGLPSTNVVPSYTGYGFG              GADQGMS
Sbjct: 445 GTGYKQVSSTPKHNPFLGQQYTGLPSTNVVPSYTGYGFGNQPNQNQQNQNQSNGADQGMS 504

Query: 505 LIDL 508
           LIDL
Sbjct: 505 LIDL 508

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  330 bits (847), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 166/256 (64%), Positives = 179/256 (69%), Gaps = 2/256 (0%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MSKSL+R+AKNVVNGYSTTQVLLREATSNDP+GPSLD+MDEIAERSWDSVSFFEIMDMLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLY+IKTLREF HEDE G+DQGQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120

Query: 121 IVRVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGSEDEDLQRAMEESRLTAEQEE 180
           IVRVK                                + S D+D+QRA+EESR+TAEQEE
Sbjct: 121 IVRVKARELTALLQDEERLREERELKGRNRRPRRRKNSDSYDDDMQRALEESRMTAEQEE 180

Query: 181 AERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           AERRRKLE+YDNS+DDLQTA                                        
Sbjct: 181 AERRRKLEMYDNSADDLQTA--LQLSKEEEELRRLRELQMQQQMQQAQQQMFGLQQQQTQ 238

Query: 241 XPMYYDVFGNPISAEE 256
            PMYYDVFGNPISAEE
Sbjct: 239 QPMYYDVFGNPISAEE 254

 Score =  203 bits (517), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 109/186 (58%), Positives = 120/186 (64%), Gaps = 10/186 (5%)

Query: 325 PLETGSNNPFARHSNQNANEDASKYANVAPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 384
           PLETGSNNPFA+++ Q + ED SKYA  +                               
Sbjct: 325 PLETGSNNPFAKNAQQPSAEDPSKYAAAS--------SPQRTQQLSPQLQPQPEQFQQQQ 376

Query: 385 XXXXXXXXXXTRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQ 444
                     TRTGNQS+T+K S+LNNLLASGTGLDTFGNTGQTRIPAQHTKTG FINSQ
Sbjct: 377 QQIPQQPLKQTRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQ 436

Query: 445 GTGYKQVSSTP--KHNPFLGQQYTGLPSTNVVPSYTGYGFGXXXXXXXXXXXXXXGADQG 502
           GTGYKQVS+ P  KHNPFLGQQYTGLPST+VVPSYTGYGFG              GADQG
Sbjct: 437 GTGYKQVSNMPQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQG 496

Query: 503 MSLIDL 508
           +SLIDL
Sbjct: 497 VSLIDL 502

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  233 bits (594), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 159/260 (61%), Gaps = 15/260 (5%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MSK+L+R AKNVVNGYS+ QVL+R ATSN+P GP++D +DE+AE+++D+V FFEIMDMLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           KRLNDKGKNWRHVAKSLTVLDYLVR GSE+CV W++ENLY+IKTLREFMHEDE+G+D GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120

Query: 121 IVRVKXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXAGSE-DEDLQRAMEESRLTA 176
           I+RVK                                    G E D+DLQRA+EESRLTA
Sbjct: 121 IIRVKAKELTSLLRDEERLTEERNMRKKRRGKTRRPERSRGGEEYDDDLQRALEESRLTA 180

Query: 177 EQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 236
           E+EE    R+ +   N  DD QTA                                    
Sbjct: 181 EEEERR--RRTDSGSNDDDDFQTALQLSKEEEELRRLRNLQMQQQQTAMFQQQQQQP--- 235

Query: 237 XXXXXPMYYDVFGNPISAEE 256
                 MYYDVFGNPI+ EE
Sbjct: 236 ------MYYDVFGNPITPEE 249

 Score =  164 bits (416), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 95/125 (76%), Gaps = 11/125 (8%)

Query: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSS- 453
           TRTGNQSI++K+++LNNLLASGTGLDTFGNTGQTRIPAQHT+TGNFINSQGTGYKQV++ 
Sbjct: 374 TRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTND 433

Query: 454 TPKHNPFLGQQYTGLPSTNVVPSYTGYGFGXXXXXXXXXXXXXX----------GADQGM 503
            PK+NPFL  QYTGLPST+VVPSYTGYGFG                          DQG+
Sbjct: 434 QPKNNPFLAAQYTGLPSTSVVPSYTGYGFGNQQLSSQQGQQLQQQQQQQQQQRGNPDQGI 493

Query: 504 SLIDL 508
           SLIDL
Sbjct: 494 SLIDL 498

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  230 bits (586), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 153/268 (57%), Gaps = 25/268 (9%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKN+V GYSTTQVL+R+ATSND   PS +++ E+A+RS+DSV FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W KENLY+IKTLREF HED+ G DQGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120

Query: 121 IVRVKXXXXXXXXXXXXXXXXXXX-----------XXXXXXXXXXXXXAGSEDED-LQRA 168
           I+RVK                                              ED+D LQRA
Sbjct: 121 IIRVKAKELTSLLLDEERLKEERTINLKNRRDGDMKGRRRRRGTRNGRGNDEDQDELQRA 180

Query: 169 MEESRLTAEQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXX 228
           +EESRLTAE++E  RRR++  YD+   DLQTA                            
Sbjct: 181 LEESRLTAEEDE-RRRRQMAQYDDQDPDLQTALQLSKEEEELKKLQEMQRLQQQQGQMNQ 239

Query: 229 XXXXXXXXXXXXXPMYYDVFGNPISAEE 256
                          Y+D+FGNPIS +E
Sbjct: 240 PQG------------YFDIFGNPISPDE 255

 Score =  159 bits (403), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 109/187 (58%), Gaps = 25/187 (13%)

Query: 325 PLETGSNNPFARHS--NQNANEDASKYANVAPSXXXXXXXXXXXXXXXXXXXXXXXXXXX 382
           PL+TGSNNPFA ++  N+ A E    Y   AP                            
Sbjct: 319 PLQTGSNNPFAMNNFNNKPAVESTQAYTASAPQLNQQPAQQQPQQQPLKQ---------- 368

Query: 383 XXXXXXXXXXXXTRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFIN 442
                       TRTGNQSIT+K+S+LN LLA+GTG+DTFGNTG+ RIPAQHT+TG FIN
Sbjct: 369 ------------TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFIN 416

Query: 443 SQGTGYKQVSSTPKHNPFLGQQYTGLPSTNVVPSYTGYGFGXXXXXXXXXXXXXXG-ADQ 501
           SQGTGY+QV++ PK+NPFL  QYTGLPSTN+V + TGYGFG                 DQ
Sbjct: 417 SQGTGYRQVTNDPKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSQQQQQQQQQQQRPDQ 476

Query: 502 GMSLIDL 508
           G SLIDL
Sbjct: 477 GFSLIDL 483

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  224 bits (572), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 126/258 (48%), Positives = 150/258 (58%), Gaps = 15/258 (5%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MSK+ +R AKN+VNGYS  QVL+R ATSND +GPS+D ++E+AER++D+V FFEIMDMLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELG-IDQG 119
           KRLNDKG+NWRHVAKSLT LD+LVRCGSE+CV W KENLY+IKTLREF H DE   ID G
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 120 QIVRVKXXXXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXAGSEDEDLQRAMEESRLTA 176
           +IVRVK                                      +D+DLQRA+EESR+TA
Sbjct: 121 EIVRVKAKELTALLRDEERLKEERMMRLKGRKRGGRKNRRDDNEDDDDLQRALEESRITA 180

Query: 177 EQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 236
           E+E  ERRRK  +       LQ A                                    
Sbjct: 181 EEE--ERRRKQLMMQGDDSSLQAA---------LELSKEEEELRRLQQLQAQQQAALWQQ 229

Query: 237 XXXXXPMYYDVFGNPISA 254
                PMYYD+FGNPISA
Sbjct: 230 QQQQQPMYYDIFGNPISA 247

 Score =  156 bits (394), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 70/89 (78%), Positives = 81/89 (91%), Gaps = 1/89 (1%)

Query: 396 RTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSS-T 454
           RTGNQSI++K SELNNLLASGTG+DTFGNTG+TR+PAQHTKTG FINSQGTGYKQ+++  
Sbjct: 360 RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDA 419

Query: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483
           PKHNPFL  QYTG+PS+ + PSYTGYGFG
Sbjct: 420 PKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  221 bits (563), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 124/262 (47%), Positives = 151/262 (57%), Gaps = 23/262 (8%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKNVV GYS+ QVL+R AT+N+ EGPS+D +DE+AE+++DSV FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           KRLNDKGK WRH+AKSLTVLDYLVR GSE+CV W +ENLYVIKTL EF ++D+ G+DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDDGGVDQGQ 120

Query: 121 IVRVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGSE------DEDLQRAMEESRL 174
           I+RVK                                  +       D+DLQRA++ESRL
Sbjct: 121 IIRVKAKELTNLLSDDERLREEREMNRKGRKNGTRRRRRTTGEQDGFDDDLQRALDESRL 180

Query: 175 TAEQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 234
           TA  EE ERRRK+    +  DDLQ A                                  
Sbjct: 181 TA--EEDERRRKM--LGSEDDDLQAALQLSKEEEELKRLQEMQKLQQQQTQQQPS----- 231

Query: 235 XXXXXXXPMYYDVFGNPISAEE 256
                    YYD+FGNPIS EE
Sbjct: 232 --------QYYDIFGNPISPEE 245

 Score =  155 bits (392), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 86/184 (46%), Positives = 104/184 (56%), Gaps = 7/184 (3%)

Query: 325 PLETGSNNPFARHSNQNANEDASKYANVAPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 384
           P+ TGSNNPFA ++ Q       + A  A S                             
Sbjct: 325 PMATGSNNPFALNNLQ------LQQARPAQSSPVPNFTSTQAQSPPKPQPQAQPQKQAPL 378

Query: 385 XXXXXXXXXXTRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQ 444
                      RTG+ ++TEK+ ELN LLA+GTG+DTFGNTG  RIPAQHTKTG FINSQ
Sbjct: 379 PQQPQQALKPVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQ 438

Query: 445 GTGYKQVSSTPKHNPFLGQQYTGLPSTNVVPSYTGYGFGXXXXXXXXXXXXXXGADQGMS 504
           GTGY+QV+  PK NPFL  QYTG+PS+N+VP++TGYGFG               ADQG+S
Sbjct: 439 GTGYRQVTGEPKKNPFLQSQYTGIPSSNIVPAHTGYGFGNQPSQQNQAQQHQT-ADQGVS 497

Query: 505 LIDL 508
           LIDL
Sbjct: 498 LIDL 501

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  221 bits (564), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 122/268 (45%), Positives = 149/268 (55%), Gaps = 21/268 (7%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKNV+ GYS+TQVL+R+ATSND    ++D +D+IA RS+DSV FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           KRLNDKGK W+H+ KSLTVLDYLVR GSE+CV W KENLYVIKTLREF +ED+ GIDQGQ
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDDTGIDQGQ 120

Query: 121 IVRVKXXXXXX------------XXXXXXXXXXXXXXXXXXXXXXXXXXAGSEDEDLQRA 168
           I+RVK                                             G +D+DLQR 
Sbjct: 121 IIRVKAKELTSLLQDEERLREERRFNNRRNRRNNRSANRSRATSRSQSNIGPDDDDLQRV 180

Query: 169 MEESRLTAEQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXX 228
           +EES+ TAE++E  RR++L  YD    + Q A                            
Sbjct: 181 IEESKKTAEEDE-RRRKELARYDEEDPEFQAALQLSKEEEELKNLQDLQRQQQQLQMLQQ 239

Query: 229 XXXXXXXXXXXXXPMYYDVFGNPISAEE 256
                         +YYDVFGNPIS +E
Sbjct: 240 QQTSAN--------VYYDVFGNPISYDE 259

 Score =  151 bits (381), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 71/89 (79%), Positives = 79/89 (88%), Gaps = 1/89 (1%)

Query: 396 RTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSS-T 454
           RTGN+ ITEK+SELNNLLA GTG+DTFGNTGQ RIPAQHTKTG FINSQGTGYKQV++  
Sbjct: 389 RTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNER 448

Query: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483
            K+NPFL  QYTGLPS+N+VPS TGYGFG
Sbjct: 449 SKNNPFLNTQYTGLPSSNIVPSSTGYGFG 477

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  223 bits (567), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 150/268 (55%), Gaps = 16/268 (5%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKN++ GYS+TQVL+R+AT+ND   PS+D +D++A+RS+DSV FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +EN YVIKTLREF HE+E G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---------------XAGSEDEDL 165
           I+RVK                                               + S  +DL
Sbjct: 121 IIRVKAKELVSLLNDEERLREERSMNTRNRRANRAARPRPRRQRTRSNPHDSSPSYQDDL 180

Query: 166 QRAMEESRLTAEQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXX 225
           ++A+EESR+TA QE+ +RRR+L  YD+   D Q A                         
Sbjct: 181 EKALEESRITA-QEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQS 239

Query: 226 XXXXXXXXXXXXXXXXPMYYDVFGNPIS 253
                           P YYD+FGNPIS
Sbjct: 240 LSQFQAPLQQQQPQQQPAYYDIFGNPIS 267

 Score =  156 bits (395), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 70/89 (78%), Positives = 82/89 (92%)

Query: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454
           TRTGNQSI++K+S+LN LLA+GTG+DTFGNTG+ RIPAQHTKTG FINSQGTGYKQV++ 
Sbjct: 428 TRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 487

Query: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483
           PK+NPFL  QYTGLPSTN+VP+ TGYGFG
Sbjct: 488 PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  223 bits (567), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 121/274 (44%), Positives = 150/274 (54%), Gaps = 19/274 (6%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           M K  +R AKN+V GYS+TQVL+R+AT+ND   PS+D +D++A+RS+DSV FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +EN YVIKTLREF HE+E G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAG---------------SEDEDL 165
           I+RVK                                 G               S  ++L
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180

Query: 166 QRAMEESRLTAEQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXX 225
           ++ +EESR+TA QE+ +RRR+L  YD+   D Q A                         
Sbjct: 181 EKVLEESRITA-QEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQP 239

Query: 226 XXXX---XXXXXXXXXXXXPMYYDVFGNPISAEE 256
                              P YYD+FGNPIS +E
Sbjct: 240 LSQMPVPVQQQQQQQQQQLPAYYDIFGNPISQDE 273

 Score =  157 bits (396), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 71/89 (79%), Positives = 82/89 (92%)

Query: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454
           TRTGNQSI++K+++LN LLA+GTGLDTFGNTG+ RIPAQHTKTG FINSQGTGYKQV+S 
Sbjct: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513

Query: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483
           PK+NPFL  QYTGLPSTN+VP+ TGYGFG
Sbjct: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 542

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  218 bits (555), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 122/262 (46%), Positives = 148/262 (56%), Gaps = 26/262 (9%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKN+V GYS+TQVL+R ATSND    S D + E+AE+S+DS  FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           KRLNDKGK WRH+AK+LTVLDYL+R GSE+CV W KENLY+IKTL+EF HED+ GIDQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IVRVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGS------EDEDLQRAMEESRL 174
           IVRVK                                 G+       D DLQRA++ SR+
Sbjct: 121 IVRVKSKELTALLSDDERLNEERNMNIKGRNRKGRSRRGTGRSSNDNDNDLQRALDASRM 180

Query: 175 TAEQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 234
           TA  EE E+RRK++      +D +TA                                  
Sbjct: 181 TA--EEDEKRRKMD------EDYETA------------LQLSKEEEELKRLQDLQRMQQL 220

Query: 235 XXXXXXXPMYYDVFGNPISAEE 256
                  PMYYD+FGNPI+ EE
Sbjct: 221 QTQQQQQPMYYDIFGNPITPEE 242

 Score =  155 bits (392), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 75/114 (65%), Positives = 88/114 (77%), Gaps = 3/114 (2%)

Query: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454
           TRTGNQS+T+K+++LN LLA+GTG+DTFGN G  R+PAQHTKTG FINSQGTGYKQVS+ 
Sbjct: 350 TRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSND 409

Query: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFGXXXXXXXXXXXXXXGADQGMSLIDL 508
           PK+NPFL  QYTGLPSTNVVP+ TGYGFG                +QG +LIDL
Sbjct: 410 PKYNPFLSGQYTGLPSTNVVPTQTGYGFGNQPQQQSQNNHLN---NQGYALIDL 460

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%)

Query: 242 PMYYDVFGNPISAEE 256
           P+YYDVFGNPI+ EE
Sbjct: 264 PLYYDVFGNPITPEE 278

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  217 bits (552), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 122/261 (46%), Positives = 148/261 (56%), Gaps = 24/261 (9%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKN+V GYS+TQVL+R ATSND    S D + E+AE+S+DS  FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           KRLNDKGK WRH+AK+LTVLDYL+R GSE+CV W KENLY+IKTL+EF HED+ G+DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGVDQGQ 120

Query: 121 IVRVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGS-----EDEDLQRAMEESRLT 175
           IVRVK                                 G+     +D+DLQRA++ SR+T
Sbjct: 121 IVRVKAKELTTLLSDDERLNEERNMNIKGRSRKGRKRRGTGRNDEDDDDLQRAIDASRMT 180

Query: 176 AEQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 235
           A  EE ERRRK        +D +TA                                   
Sbjct: 181 A--EEDERRRK------QDEDYETA-----------LQLSKEEEELKRLQDLQRMQQVHA 221

Query: 236 XXXXXXPMYYDVFGNPISAEE 256
                 PMYYD+FGNPI+ EE
Sbjct: 222 QQQQQQPMYYDIFGNPITPEE 242

 Score =  155 bits (391), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 86/114 (75%), Gaps = 3/114 (2%)

Query: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454
           TRTGNQS+T+K+ +LN LLA+GTG+DTFGN G +R+PAQHTKTG FINSQGTGY+QVS+ 
Sbjct: 337 TRTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQVSND 396

Query: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFGXXXXXXXXXXXXXXGADQGMSLIDL 508
           PK NPFL  QYTGLPSTN+VP+ TGYGFG                 QG +LIDL
Sbjct: 397 PKQNPFLNSQYTGLPSTNIVPTQTGYGFGNQPQQQSQNNRSNS---QGYTLIDL 447

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/14 (92%), Positives = 13/14 (92%)

Query: 243 MYYDVFGNPISAEE 256
           MYYDVFGNPIS EE
Sbjct: 265 MYYDVFGNPISPEE 278

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  219 bits (558), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 120/268 (44%), Positives = 148/268 (55%), Gaps = 18/268 (6%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKN++ GYS+TQVL+R+AT+ND   PS+D +D++A+RS+DSV FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +EN YVIKTLREF HE+E G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKXX---------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGSEDEDL 165
           I+RVK                                               + S   DL
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRRDRSAARPRPRRQRTRSNPHDSSPSYQNDL 180

Query: 166 QRAMEESRLTAEQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXX 225
           ++A+EESR+TA QE+ +RRR+L  YD+   D Q A                         
Sbjct: 181 EKALEESRITA-QEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQNQQQS 239

Query: 226 XXXXXXXXXXXXXXXXPMYYDVFGNPIS 253
                             YYD+FGNPIS
Sbjct: 240 LSQMQVPVQQQQEQPA--YYDIFGNPIS 265

 Score =  152 bits (385), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 69/89 (77%), Positives = 80/89 (89%)

Query: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454
           TRTGNQSI++K+++LN LLA+GTG DTFGNTG+ RIPAQHTKTG FINSQGTGYKQV + 
Sbjct: 429 TRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVINE 488

Query: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483
           PK+NPFL  QYTGLPSTN+VP+ TGYGFG
Sbjct: 489 PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  213 bits (543), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 145/261 (55%), Gaps = 24/261 (9%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKN+V GYS+TQVL+R ATSND    S D + E+AE+S+DS  FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           KRLNDKGK WRH+AK+LTV+DYL+R GSE+CV W +ENLY+IKTL+EF HED+ GIDQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IVRVKXXXXXX-----XXXXXXXXXXXXXXXXXXXXXXXXXXAGSEDEDLQRAMEESRLT 175
           IVRVK                                     +   D+DLQRA+  SRLT
Sbjct: 121 IVRVKAKELTALLSDDERLNEERNMNIKGRNRKGRRRRGTGRSDENDDDLQRAISASRLT 180

Query: 176 AEQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 235
           A  EE ERRRK        +D +TA                                   
Sbjct: 181 A--EEDERRRK------QDEDYETA-----------LQLSKEEEELKRLQDLQRMQQQQG 221

Query: 236 XXXXXXPMYYDVFGNPISAEE 256
                 PMYYD+FGNPI+ EE
Sbjct: 222 QQQLQQPMYYDIFGNPITPEE 242

 Score =  151 bits (381), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 77/87 (88%)

Query: 396 RTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSSTP 455
           RTGNQS+T+K+S+LN LLA+GTG+DTFGN G+ RIPAQHTKTG FINSQGTGY+QVS  P
Sbjct: 345 RTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDP 404

Query: 456 KHNPFLGQQYTGLPSTNVVPSYTGYGF 482
            HNPFL  QYTGLPST+VVP+ TGYGF
Sbjct: 405 NHNPFLNSQYTGLPSTSVVPTQTGYGF 431

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 11/12 (91%), Positives = 12/12 (100%)

Query: 242 PMYYDVFGNPIS 253
           PMYYDVFGNPI+
Sbjct: 263 PMYYDVFGNPIT 274

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  214 bits (544), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 122/260 (46%), Positives = 147/260 (56%), Gaps = 24/260 (9%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MS   +R  KNVV GYS+TQVL+R AT+N+  GP++D++ +IAE+++DS  FFEIMDMLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDE--LGIDQ 118
           KRLNDKGK W+H+AKSLTVLDYLVR GSE+CV W KENLY+IKTL EF +EDE   G+DQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 119 GQIVRVKXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXAGSEDEDLQRAMEESRLTA 176
           GQI+RVK                                      DEDLQRA+EESR TA
Sbjct: 121 GQIIRVKAKELTALLMDDERLREERRLNNRRDRNRNRRPPARNGSDEDLQRALEESRRTA 180

Query: 177 EQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 236
             EE ER+R+L   +    DLQ A                                    
Sbjct: 181 --EEDERKRRL---NQDDSDLQAA---------------LQLSKEEEELKRLQELQSSMH 220

Query: 237 XXXXXPMYYDVFGNPISAEE 256
                P+YYDVFGNPIS EE
Sbjct: 221 MQQQQPVYYDVFGNPISYEE 240

 Score =  148 bits (373), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 71/113 (62%), Positives = 85/113 (75%)

Query: 396 RTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSSTP 455
           RTGN+ +T K++ELN LLASGTG+DTFGNTG+TRIPAQHT+TG FINSQGTGY+Q S   
Sbjct: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434

Query: 456 KHNPFLGQQYTGLPSTNVVPSYTGYGFGXXXXXXXXXXXXXXGADQGMSLIDL 508
           K NPFL  QYTGLPS+N++P+ TGYGFG                +QG+SLIDL
Sbjct: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFGNQPQQQQYQQQQQQNNNQGVSLIDL 487

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  211 bits (537), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 119/261 (45%), Positives = 147/261 (56%), Gaps = 24/261 (9%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MSK L+R AKN+V GYS+TQVL+R ATSND    S D + E+AE+S+DS  FFEIMDMLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           KRLNDKGK WRH+AK+LTVLDYL+R GSE+CV W KENLY+IKTL+EF H+D+ G DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120

Query: 121 IVRVKXXXXXX-----XXXXXXXXXXXXXXXXXXXXXXXXXXAGSEDEDLQRAMEESRLT 175
           IVRVK                                     +  +D+DLQRA++ SR+T
Sbjct: 121 IVRVKAKELTSLLSDEERLNEERNMNIKGRNRGGRRRRRTNRSSEDDDDLQRAIDASRMT 180

Query: 176 AEQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 235
           A  +E ERRRK +      +D +TA                                   
Sbjct: 181 A--DEDERRRKQD------EDYETA-----------LQLSKEEEELKRLQDLQRIQAQQQ 221

Query: 236 XXXXXXPMYYDVFGNPISAEE 256
                 PMY D+FGNPI+ EE
Sbjct: 222 QQQQQQPMYCDIFGNPITPEE 242

 Score =  159 bits (402), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 76/114 (66%), Positives = 87/114 (76%), Gaps = 3/114 (2%)

Query: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454
           TRTGNQS+T+K+S+LN LL +GTG+DTFGN G TR+PAQHTKTG FINSQGTGY+QVS+ 
Sbjct: 352 TRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSND 411

Query: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFGXXXXXXXXXXXXXXGADQGMSLIDL 508
           PKHNPFL  QYTGLPSTNVVP+ TGYGFG                 QG +LIDL
Sbjct: 412 PKHNPFLNSQYTGLPSTNVVPAQTGYGFGNQPQQQSQTNGTNS---QGYALIDL 462

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 11/12 (91%), Positives = 12/12 (100%)

Query: 242 PMYYDVFGNPIS 253
           PMYYD+FGNPIS
Sbjct: 267 PMYYDMFGNPIS 278

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  209 bits (532), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 145/258 (56%), Gaps = 8/258 (3%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MSK L+R AKNV+NGYS  QVL+R ATSND  GPSLD M+E+AER++ +V FFEIM MLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDE-LGIDQG 119
           +RLNDK KNWRHVAKSLTV DYLVR G+E CV WA+EN+++I+ L EF+H DE  G D G
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 120 QIVRVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGSE----DEDLQRAMEESRLT 175
           Q++RVK                                  +     D DL+RA+EESR+T
Sbjct: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPETNPDGVDPDLKRALEESRIT 180

Query: 176 AEQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 235
           AE+E  ERRRKL      +++LQ A                                   
Sbjct: 181 AEEE--ERRRKLAEKTEDAEELQAA-LQLSKEEEELRKLRELQQQREQQMAFWQQQQVQQ 237

Query: 236 XXXXXXPMYYDVFGNPIS 253
                 PMYYD+FGNPI+
Sbjct: 238 VQYQQQPMYYDIFGNPIT 255

 Score =  156 bits (395), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 78/115 (67%), Positives = 88/115 (76%), Gaps = 4/115 (3%)

Query: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSS- 453
           TRTGNQSI++K+ ELN LLA+GTG+DTFGNTGQ RI +QHTKT  FINS GTG+KQVS+ 
Sbjct: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462

Query: 454 TPKHNPFLGQQYTGLPSTNVVPSYTGYGFGXXXXXXXXXXXXXXGADQGMSLIDL 508
            PKHNPFL  QYTGLPSTN+VPS+TGYGFG                DQGMSLIDL
Sbjct: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTASKPN---DQGMSLIDL 514

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  207 bits (527), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 116/258 (44%), Positives = 143/258 (55%), Gaps = 19/258 (7%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           M    +R AKN + GY++ QVL+R+AT+N+ EGPS+D++DE+A RS+DSV FFEIMDM+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +ENLY+IKTLREF H+D+   D GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQDGGQ 120

Query: 121 IVRVKXXXXXXXXXXXXXXXXXX-----XXXXXXXXXXXXXXAGSEDEDLQRAMEESRLT 175
           I+RVK                                       S D ++QRA++ SRLT
Sbjct: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAPPRMMSPSPPTPRRNSYDSEMQRALDASRLT 180

Query: 176 AEQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 235
           A  EE ERRRK    +N   DL+TA                                   
Sbjct: 181 A--EEDERRRK--TLNNEDADLETALQLSKEEEELKRLQELQKAQQDQQRLSQMQPQG-- 234

Query: 236 XXXXXXPMYYDVFGNPIS 253
                   YYD+FGNPIS
Sbjct: 235 --------YYDIFGNPIS 244

 Score =  139 bits (351), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 62/89 (69%), Positives = 76/89 (85%)

Query: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454
            RTGNQSI++K+++LN LLA  TG+DTFGN G  RIPAQHTKTG FINSQGTG+KQ S+ 
Sbjct: 423 VRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQYSNE 482

Query: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483
           PK NPFL  Q+TG+P+++VVPS+TGYGFG
Sbjct: 483 PKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  207 bits (527), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 92/125 (73%), Positives = 109/125 (87%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKN+V GYS+TQVL+R+AT+NDP  PS+D +D++A+RS+DSV FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +EN YVIKTLREF HE+E G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVK 125
           I+RVK
Sbjct: 121 IIRVK 125

 Score =  150 bits (378), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 81/89 (91%)

Query: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454
           TRTGNQSI++K+++LN LLA+GTG DTFGNTG++RIPAQHTKTG FINSQGTGYKQV + 
Sbjct: 437 TRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNE 496

Query: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483
           PK+NPFL  QYTGLPST++VP+ TGYGFG
Sbjct: 497 PKNNPFLNSQYTGLPSTSIVPTQTGYGFG 525

 Score = 38.1 bits (87), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 37/90 (41%), Gaps = 9/90 (10%)

Query: 164 DLQRAMEESRLTAEQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXX 223
           DL++A+EESR+TA+++E  RR ++  YD+   D Q A                       
Sbjct: 183 DLEKALEESRITAQEDEL-RRNEMAQYDDDDPDFQAALQLSKEEEELKQLQELQKQQQLQ 241

Query: 224 XXXXXXXXXXXXXXXXXXPMYYDVFGNPIS 253
                               YYD+FGNPIS
Sbjct: 242 SQLQMPPQQQAA--------YYDIFGNPIS 263

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  203 bits (517), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 120/267 (44%), Positives = 148/267 (55%), Gaps = 14/267 (5%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKN++ GYSTTQVL+R+ATSND   PS +I+ EI++RS+DSV FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           KRLNDKGK W+H+AKSLTVLDYLVR GSE+CV W K+NLY+IKTL+EF  ED+  +D+  
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD-NVDESS 119

Query: 121 IVRVKXXXXXX-----------XXXXXXXXXXXXXXXXXXXXXXXXXXAGSEDEDLQRAM 169
           I+RVK                                               DEDLQ+A+
Sbjct: 120 IIRVKAKELTALLQDDERLKEERSINLKNNRRSERKNRSRRGTNATRRGTKSDEDLQKAL 179

Query: 170 EESRLTAEQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 229
           EESR+TAE++E   RR+L  YDN   D QTA                             
Sbjct: 180 EESRITAEEDERR-RRELAQYDNQDTDYQTALQLSKEEEELKKLQELQRLQQLQQQQQQQ 238

Query: 230 XXXXXXXXXXXXPMYYDVFGNPISAEE 256
                        +YYD+FGNPIS EE
Sbjct: 239 MQFQQQPQQQEQ-VYYDIFGNPISPEE 264

 Score =  150 bits (380), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 69/89 (77%), Positives = 80/89 (89%), Gaps = 1/89 (1%)

Query: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454
           TRTGNQSI++K++ELNNLLASGTG+DTFGNTG  RIPAQHT+TG FINSQGTGYKQ+ + 
Sbjct: 368 TRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVND 427

Query: 455 P-KHNPFLGQQYTGLPSTNVVPSYTGYGF 482
           P K NPFL  QYTGLPS+N+VPS+TGYGF
Sbjct: 428 PVKKNPFLNNQYTGLPSSNIVPSHTGYGF 456

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  200 bits (509), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 113/268 (42%), Positives = 148/268 (55%), Gaps = 41/268 (15%)

Query: 5   LIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLN 64
           ++R AKN+V GYS T+VL+R+AT+N+   PS +++D++A++S++SV FFEI+DMLDKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQIVRV 124
           DKGK WRHVAK+LTVLDYLVR GSE+CV W +ENLY+IKTLREF HED  G D+G+I+RV
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120

Query: 125 KXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGSE------DEDLQRAMEESRLTAE- 177
           K                                 GS       DEDLQRA+EES+ TAE 
Sbjct: 121 KAKELTSLLMDEERLKEERAMNIRRRGGPKRRSGGSRERNNRSDEDLQRAIEESKRTAEE 180

Query: 178 ---------QEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXX 228
                      EA+R+  L++     +DL+                              
Sbjct: 181 EERRRRNGASSEADRQAALQL-SREEEDLR------------------------RLQEQA 215

Query: 229 XXXXXXXXXXXXXPMYYDVFGNPISAEE 256
                        PMYYDVFGNPI+ EE
Sbjct: 216 RLAQQQQQQQQQQPMYYDVFGNPITPEE 243

 Score =  147 bits (371), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 80/89 (89%)

Query: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454
           TR+GNQ+I++K+S LNNLLASGTG+DTFGNTG+ RIPAQHT+TG FINSQGTGY+QV++ 
Sbjct: 338 TRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNND 397

Query: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483
            K NPFL  QYTGLPSTN+VP+ TG+GFG
Sbjct: 398 DKPNPFLNGQYTGLPSTNIVPTQTGFGFG 426

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  200 bits (509), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 115/255 (45%), Positives = 144/255 (56%), Gaps = 16/255 (6%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           M K  +R AKNVV GYS+TQV++R ATSND  GP +D +D +AE+++DSV FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           KRLNDKGK W+H+AKSLTVLDYLVR GSE+CV W KENLY+I+TL+EF + D+   DQGQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120

Query: 121 IVRVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAG--SEDEDLQRAMEESRLTAEQ 178
           I+RVK                                    S+D++LQRA+EES+ TAE 
Sbjct: 121 IIRVKAKELTSLLNDEERLRDERGMNRRGGRRERARPRRRPSDDDELQRAIEESKRTAED 180

Query: 179 EEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 238
           ++  RR + +       DLQTA                                      
Sbjct: 181 DDRRRRMRDD----EEADLQTA----------LQLSKEEEELKRLQELQRLQQQQQQQQQ 226

Query: 239 XXXPMYYDVFGNPIS 253
              PMYYD+FGNPIS
Sbjct: 227 QQQPMYYDIFGNPIS 241

 Score =  157 bits (397), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 71/89 (79%), Positives = 80/89 (89%)

Query: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454
           TRTGNQ IT+K  ELN LLASGTG+DTFGNTG+ RIPAQHTKTG FINSQGTGY+QV++ 
Sbjct: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442

Query: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483
           PK+NPFL  QYTGLPSTN+VPS+TGYGFG
Sbjct: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFG 471

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  196 bits (498), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 117/266 (43%), Positives = 150/266 (56%), Gaps = 26/266 (9%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           M   L+R AKN+V GYS+TQV++R+AT+ND   PS+ +++++A++++D+V FFEIMDMLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDEL-GIDQG 119
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W KENLY+IKTLREF HEDE+ G D+G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 120 QIVRVKXXXXXX------------XXXXXXXXXXXXXXXXXXXXXXXXXXAGSEDEDLQR 167
           QI+RVK                                              + D+DLQ+
Sbjct: 121 QIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRRRRSRSRSTSYRNAYDDDLQK 180

Query: 168 AMEESRLTAEQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXX 227
           A+EESR+TAE+EEA RR +   Y+N   DL  A                           
Sbjct: 181 ALEESRMTAEEEEARRREQ-AQYENQDPDLLAALQLSKEEEELKKLQDMQRMQELQAQQQ 239

Query: 228 XXXXXXXXXXXXXXPMYYDVFGNPIS 253
                          +YYD+FGNPIS
Sbjct: 240 QQN------------VYYDIFGNPIS 253

 Score =  164 bits (416), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 84/89 (94%)

Query: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454
           TRTGNQSI++K+SELNNLLASGTG+DTFGNTG+ RIPAQHTKTG FINSQGTGYKQV++ 
Sbjct: 361 TRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 420

Query: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483
           PK+NPFL  QYTGLPSTN+VPS+TGYGFG
Sbjct: 421 PKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  192 bits (489), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 108/129 (83%), Gaps = 4/129 (3%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R  KN+V GYS+TQ+L+R+AT+ND   PS+DI+D+IAE+++DSV FFEIMDMLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDEL----GI 116
           KRLNDKGK W+HVAKSLTVLDYL+R GSE+CV W KENLY+IKTL+EF  +D +    G 
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 117 DQGQIVRVK 125
           DQGQIVRV+
Sbjct: 121 DQGQIVRVR 129

 Score =  148 bits (373), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 76/88 (86%)

Query: 396 RTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSSTP 455
           RTGNQ I++K++ LN LLA+GTG+DTFGNTG  RIPAQHT TG FINSQGTGYKQ  + P
Sbjct: 471 RTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYINDP 530

Query: 456 KHNPFLGQQYTGLPSTNVVPSYTGYGFG 483
           K+NPF+  QYTGLPSTNVVPSYTGYGFG
Sbjct: 531 KNNPFMSNQYTGLPSTNVVPSYTGYGFG 558

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  189 bits (480), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 117/261 (44%), Positives = 144/261 (55%), Gaps = 13/261 (4%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MSK L+R AKNVVNGYS  Q+L+R ATSN+  GPS+D M+E+AERS+ +V FFEI+ MLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDE-LGIDQG 119
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV WA+ENLY+ + L EF H DE  G+D G
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 120 QIVRVKXXXXXXXXXXXXXXXXXXXXX----XXXXXXXXXXXAGSEDEDLQRAMEESRLT 175
           QI+RVK                                    A   D DLQRA+EESR+T
Sbjct: 121 QIIRVKARELVALLRDEERLREERNMRLGRNPRNRQASVPPPAEDLDPDLQRALEESRIT 180

Query: 176 AEQEEAERRRKL-EIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 234
           AE+EE  RR K  +  DN  ++L+ A                                  
Sbjct: 181 AEEEERRRREKTNQQQDN--EELEVALQLSKEEEELRKLRELQQQREQQMALWQQQQQQQ 238

Query: 235 XXXXXXXPMYYDVFGNPISAE 255
                   MYYD+FGNPIS E
Sbjct: 239 PQA-----MYYDIFGNPISLE 254

 Score =  166 bits (419), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 91/115 (79%), Gaps = 1/115 (0%)

Query: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSS- 453
           TRTGNQSIT+K+SELN LLASGTGLDTFGNTGQTRIPAQHTKTG FINSQGTGYKQV + 
Sbjct: 401 TRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNE 460

Query: 454 TPKHNPFLGQQYTGLPSTNVVPSYTGYGFGXXXXXXXXXXXXXXGADQGMSLIDL 508
            PKHNPF+  QYTGLPSTN+VPS+TGYGFG                +Q +SLID+
Sbjct: 461 PPKHNPFIATQYTGLPSTNMVPSHTGYGFGNAGNGFQQSGNSNKPNEQNISLIDI 515

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  177 bits (450), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 101/121 (83%)

Query: 5   LIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLN 64
           ++R AKN+V GYS+TQ L+R+ATSN  + P +D + E+AE +++++ FFEIMDMLDKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQIVRV 124
            KGK W+HV KSL VLDYLVR GSE+CV W KENLY+IKTLREF +EDE G+DQGQ+VRV
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDESGMDQGQMVRV 120

Query: 125 K 125
           +
Sbjct: 121 R 121

 Score =  143 bits (360), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 77/89 (86%)

Query: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454
           TRTG+QSI++K+S LN LLA+GTG+DTFGNTG  RIPAQHTKTG FINSQGTGYKQVS+ 
Sbjct: 314 TRTGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQVSTN 373

Query: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483
             +N FL  QYTGLPS+N+VPS TGYGFG
Sbjct: 374 GFNNVFLNSQYTGLPSSNIVPSQTGYGFG 402

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%)

Query: 242 PMYYDVFGNPISAEE 256
           PMYYD+FGNPI+ EE
Sbjct: 217 PMYYDIFGNPITPEE 231

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  175 bits (444), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 79/126 (62%), Positives = 101/126 (80%), Gaps = 1/126 (0%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MS+  +R AKNV+ GYS+TQVL+R+AT+ND   P LD +++IA  S+DSV FFEIMD+L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMH-EDELGIDQG 119
           KRLND GK WRH+ KSLTVLDYLVR GSEHC  WA+++L+++K LR F   +D +G DQG
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 120 QIVRVK 125
           QIVRVK
Sbjct: 121 QIVRVK 126

 Score =  140 bits (352), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 74/90 (82%), Gaps = 3/90 (3%)

Query: 397 TGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST-- 454
           TGNQ +T K+SELNNLLA GTG+DTFGN G  RIPAQHT+TG FINSQGTG+KQV+S   
Sbjct: 496 TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGK 555

Query: 455 -PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483
            P  NPFL  QYTGLPST +VP+YTGYGFG
Sbjct: 556 DPNSNPFLNSQYTGLPSTGIVPAYTGYGFG 585

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 31/42 (73%), Gaps = 1/42 (2%)

Query: 159 GSEDEDLQRAMEESRLTAEQEEAERRRKLEIYDNSSDDLQTA 200
           G++D+DLQRA+EES+ T  QE+ ERRR+L +YD    + Q A
Sbjct: 202 GNDDDDLQRAIEESKRTV-QEDEERRRQLSMYDEEDPEFQAA 242

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  161 bits (408), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 132/268 (49%), Gaps = 36/268 (13%)

Query: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60
           MS   +R  KN+  GYS TQVL+R+AT+N+  G S+D++D++ E S+D+  F +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           +R++DK K WRHVAKSLTV+DYLVR GSE CV WA++N   ++ LR+F + D  GIDQGQ
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120

Query: 121 IVRVKXXXXXXXXXXXXXXXXXXXXXXXXXXXX------------XXXXAGSEDEDLQRA 168
           ++RVK                                               ++ED+ RA
Sbjct: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180

Query: 169 MEESRLTAEQEEAERRRKLEIYDNSSDDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXX 228
           +EES+ TAE++EA RR+  E       DL+ A                            
Sbjct: 181 LEESKKTAEEDEARRRKDQE---REKQDLKEA---------------------VKLSKEE 216

Query: 229 XXXXXXXXXXXXXPMYYDVFGNPISAEE 256
                        P Y+D  GNPIS EE
Sbjct: 217 DELKRLQDEANNKPQYFDENGNPISQEE 244

 Score =  110 bits (276), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 53/78 (67%), Positives = 59/78 (75%)

Query: 397 TGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSSTPK 456
           TGN  I+ K+S LN LLA GTG+DTFGN G TRIPAQHTKTG FINSQGTGYKQV+S+  
Sbjct: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTSSSS 655

Query: 457 HNPFLGQQYTGLPSTNVV 474
             P L  QYTGLP+   V
Sbjct: 656 PIPLLPTQYTGLPAQTAV 673

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 77/125 (61%), Gaps = 1/125 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+NVV  Y+  +  +REAT+N+P G S  +MD+I++ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   + ++ +IK L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQGRDQGI 134

Query: 121 IVRVK 125
            VR +
Sbjct: 135 NVRTR 139

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 75/123 (60%), Gaps = 1/123 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+NVV  Y+  +  +REAT+N+P G S  +M++IA+ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K    WR + K+L +LDYL+R G+E  +   + NL +IK L  F + D  G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVR 123
            VR
Sbjct: 135 NVR 137

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 91.3 bits (225), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 77/125 (61%), Gaps = 1/125 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+NVV  Y+  +  +REAT+N+P G S  +MD+I++ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   + ++ +IK L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQGRDQGI 134

Query: 121 IVRVK 125
            VR +
Sbjct: 135 NVRTR 139

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 91.3 bits (225), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 75/123 (60%), Gaps = 1/123 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+NVV  ++  +  +REAT+N+P G S  +M++IA+ +++     E+M ML +
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K G  WR + K+L +LDYL+R GSE  +   +  L +++ L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQGRDQGV 134

Query: 121 IVR 123
            VR
Sbjct: 135 NVR 137

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 90.9 bits (224), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 77/125 (61%), Gaps = 1/125 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+NVV  Y+  +  +REAT+N+P G S  +MD+I++ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   + ++ +I+ L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IVRVK 125
            VR +
Sbjct: 135 NVRTR 139

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 90.9 bits (224), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 77/125 (61%), Gaps = 1/125 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+NVV  Y+  +  +REAT+N+P G S  +MD+I++ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   + ++ +I+ L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IVRVK 125
            VR +
Sbjct: 135 NVRTR 139

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 90.5 bits (223), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 75/123 (60%), Gaps = 1/123 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+N+V  Y+  +  +REAT+N+P G S  +M++I++ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K    WR + K+L +LDYL+R G+E  +   + NL +IK L  F + D  G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVR 123
            VR
Sbjct: 135 NVR 137

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 90.9 bits (224), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 77/125 (61%), Gaps = 1/125 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+NVV  Y+  +  +REAT+N+P G S  +M++IA+ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILR 74

Query: 62  RLNDKGKN-WRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K  N WR + K+L +L+YL+  G+E  +  A+ +L +I+ L  F + D  G DQG 
Sbjct: 75  RFTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSEGRDQGA 134

Query: 121 IVRVK 125
            VR +
Sbjct: 135 NVRSR 139

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 90.9 bits (224), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 77/123 (62%), Gaps = 1/123 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+NVV  Y+  +  +REAT+N+P G S  +M++IA+ +++    +EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   + +L +I+ L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSEGRDQGI 134

Query: 121 IVR 123
            VR
Sbjct: 135 NVR 137

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 75/123 (60%), Gaps = 1/123 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+NVV  Y+  +  +REAT+N+P G S  +M++I+  +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K    WR + K+L +L+YL++ GSE  +  ++ NL +IK L  F + D  G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQGRDQGI 134

Query: 121 IVR 123
            VR
Sbjct: 135 NVR 137

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 77/123 (62%), Gaps = 1/123 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+NVV  Y+  +  +REAT+N+P G S  +M++IA+ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   + ++ V+K L+ F + D  G DQG 
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYIDAEGRDQGI 134

Query: 121 IVR 123
            VR
Sbjct: 135 NVR 137

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 74/123 (60%), Gaps = 1/123 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+NVV  Y+  +  +REAT+N+P G S  +M+ IA+ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K    WR + K+L +L+YLV+ GSE  +   + NL ++K L  F + D  G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQGRDQGI 134

Query: 121 IVR 123
            VR
Sbjct: 135 NVR 137

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 76/123 (61%), Gaps = 1/123 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+NVV  Y+  +  +REAT+N+P G S  +M++IA+ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K G  WR + KSL +LDYL+R GSE  +   + ++ +I+ L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQGRDQGI 134

Query: 121 IVR 123
            VR
Sbjct: 135 NVR 137

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 76/123 (61%), Gaps = 1/123 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+NVV  Y+  +  +REAT+N+P G S  +M++IA+ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K G  WR + K+L +L+YL++ GSE  +   + ++ ++K L  F + D  G DQG 
Sbjct: 75  RFTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYIDSQGRDQGV 134

Query: 121 IVR 123
            VR
Sbjct: 135 NVR 137

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 76/123 (61%), Gaps = 1/123 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NVV  Y+  +  +REAT+N+P G S  +M++I++ +++     EI+ M+ +
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RLNDKGKN-WRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           RL +K  N WR + K+L +LDYL+R  SE  +   + ++ +IK L  F + D  G DQG 
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVR 123
            VR
Sbjct: 135 NVR 137

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 75/123 (60%), Gaps = 1/123 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+NV+  Y+  +  +REAT+N+P G S  +M +IA+ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  RLNDKGKN-WRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K  N WR + KS+ +L+YLV+ GSE  +   + NL +I+ L  F + D  G DQG 
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDSQGRDQGI 134

Query: 121 IVR 123
            VR
Sbjct: 135 NVR 137

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 76/125 (60%), Gaps = 1/125 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+NV+  Y+  +  +REAT+N+P G S  +M++I++ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K    WR + K+L +L+YL++ GSE  +   + +L +IK L  F + D  G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVK 125
            VR K
Sbjct: 135 NVRNK 139

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 76/125 (60%), Gaps = 1/125 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+NVV  Y+  +  +REAT+N+P G S  +M+ IA+ +++     EI+ M+ +
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RLNDKGKN-WRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K  N WR + K+L +L+YL++ GSE  +   + ++ ++K L  F + D  G DQG 
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQGRDQGI 169

Query: 121 IVRVK 125
            VR +
Sbjct: 170 NVRTR 174

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 84.3 bits (207), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 74/125 (59%), Gaps = 1/125 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+NV+  Y+  +  +REAT+N+P G S  +M +IA+ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K    WR + KSL + DYL++ GSE  +   + ++ +IK L  F + D  G DQG 
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVK 125
            VR K
Sbjct: 135 NVRNK 139

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 70/123 (56%), Gaps = 1/123 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RKA+NVV  Y+  +  +REAT+N+  G    +M +IA+ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120
           R  +K    WR + KS+ +L+YL+  GSE  +   +  L +IK L  F + D  G DQG 
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVR 123
            VR
Sbjct: 135 NVR 137

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 66/111 (59%), Gaps = 8/111 (7%)

Query: 4   SLIRKAKNVVNGYSTTQVLLREATSNDP-EGPSLDIMDEIAERSWDSVSFFEIMDMLDKR 62
           S IR  +N+  G STT+V +++AT +D   G +  +M+EI+  ++ + +  EI  ++ +R
Sbjct: 2   SFIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRR 59

Query: 63  LN-----DKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREF 108
           L+        +N  H+ K+LT++ YL+  GS   V W ++  Y++ TLREF
Sbjct: 60  LSGNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREF 110

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 66/111 (59%), Gaps = 8/111 (7%)

Query: 4   SLIRKAKNVVNGYSTTQVLLREATSNDPE-GPSLDIMDEIAERSWDSVSFFEIMDMLDKR 62
           SL++  +N+  G S+T+V  R AT++D   G +  +M+E++  ++   +  EI  ++ KR
Sbjct: 2   SLLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKR 59

Query: 63  LN-----DKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREF 108
           L+        KN  H+ K+LT++ YL+  GS+  V W +  LY+I TL+EF
Sbjct: 60  LSGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEF 110

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 65/119 (54%), Gaps = 1/119 (0%)

Query: 2   SKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R A+N +   +  +  +REAT+NDP G S+ +M +I   +++     +I++ML  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQG 119
           R  +K G  WR + KS+ +L YL+  GS   V   K NL +IK L  F   D+ G +Q 
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDDQGYNQS 133

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 61/105 (58%), Gaps = 8/105 (7%)

Query: 17  STTQVLLREATS-NDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDKGK-----NW 70
           S T+  ++EAT  N+  G +  +M+EI+  ++   +  EI+ +L KRL    K     N 
Sbjct: 13  SATEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGSSKKSSHRNC 72

Query: 71  RHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREF--MHEDE 113
            H+ K++T++ YL+  GS   + WA+ N+ + + L++F  +HED+
Sbjct: 73  VHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHEDD 117

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 58.5 bits (140), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 64/111 (57%), Gaps = 8/111 (7%)

Query: 4   SLIRKAKNVVNGYSTTQVLLREATSNDP-EGPSLDIMDEIAERSWDSVSFFEIMDMLDKR 62
           SL+R  ++   G S T++  + AT++D   G +  +M+EI+  ++ S +  EI  ++ KR
Sbjct: 2   SLLRTVRSF--GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKR 59

Query: 63  L---NDKG--KNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREF 108
           L   N K   KN  H+ K+LT+  YL+  GS   V W +  +Y+I +L+EF
Sbjct: 60  LSGNNRKSSHKNAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEF 110

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 59/100 (59%), Gaps = 6/100 (6%)

Query: 13  VNGYSTTQVLLREATSNDPE-GPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDKG---- 67
           V G S+T++ +R+AT+ D + G +  +M+EI+  ++   +  EI  +L +RL+  G    
Sbjct: 9   VFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTS 68

Query: 68  -KNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLR 106
            KN  H+ K+LT++ YL+  GSE  V W + NL   + L+
Sbjct: 69  HKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLK 108

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 63/113 (55%), Gaps = 6/113 (5%)

Query: 17  STTQVLLREAT-SNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDKGKN-----W 70
           STT++ +++AT  N+  G +  +M+EI+  ++   +  EI+ ++ KRL   G+       
Sbjct: 13  STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRLMGHGRRNSHKIC 72

Query: 71  RHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQIVR 123
            H+ K+LT++ YL+  GS   + W + N+ ++  L+EF  +D      GQ +R
Sbjct: 73  IHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRNDEKIGQQIR 125

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 66/120 (55%), Gaps = 9/120 (7%)

Query: 15  GYSTTQVLLREATSN-DPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRL-----NDKGK 68
           G S+T V +++AT + +  G    +M+EIA  ++   +  EI  +L KRL         K
Sbjct: 11  GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRLVGNYKKTPSK 70

Query: 69  NWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHED---ELGIDQGQIVRVK 125
              ++ K+LT++ +LV  GSE C+ W + +L +I++ ++F   D   +  ++Q Q++  K
Sbjct: 71  RAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRDGEKKQMVNQIQLLSCK 130

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 59/110 (53%), Gaps = 8/110 (7%)

Query: 5   LIRKAKNVVNGYSTTQVLLREATSND-PEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRL 63
           L    +N V   S T+  +R+AT +D   G +  +M+EI+  ++   +  EI+ +L KRL
Sbjct: 3   LFDSVRNFVQ--SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRL 60

Query: 64  N-----DKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREF 108
                 +  KN  H+ K+LT++ YL+  GS   + W + N+ + + L+ F
Sbjct: 61  TGYSKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNF 110

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 66/124 (53%), Gaps = 13/124 (10%)

Query: 4   SLIRKAKNVVNGYSTTQVLLREATS-NDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKR 62
           ++    +N V   S T++ +R AT  N+  G +  +M+EI+  ++ + +  EI+ +L KR
Sbjct: 2   AIFESVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKR 59

Query: 63  LNDKGK-----NWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREF-----MHED 112
           L   GK     N  H+ K+LT++ YL+  GS   + W  EN  + + ++ F     +H++
Sbjct: 60  LTGYGKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFEVSDTIHDE 119

Query: 113 ELGI 116
           +  I
Sbjct: 120 KFAI 123

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 60/102 (58%), Gaps = 8/102 (7%)

Query: 15  GYSTTQVLLREAT-SNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDKGKNWR-- 71
           G STTQ+ +++AT SN+  G +  +M+E++  ++   S  EI +++ KRL +     +  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 72  -----HVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREF 108
                 V K+LT+++YL+  GSE  V W + +L  I+ L+++
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDY 112

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 57/100 (57%), Gaps = 10/100 (10%)

Query: 17  STTQVLLREATS-NDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDKGKNWR---- 71
           S T++ +R+AT  N+  G +  +M+EI+  ++   +  +++ ++ KRL+  G N R    
Sbjct: 13  SPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLS--GVNKRNSHR 70

Query: 72  ---HVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREF 108
              HV K+LT++ YL+  GS   + W K + YVI+ L  F
Sbjct: 71  TCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSF 110

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 62/115 (53%), Gaps = 9/115 (7%)

Query: 17  STTQVLLREATSND-PEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDKGKNWR---- 71
           S T+  +++ATS D   G +  +M+EI+  ++   +  EI+ ++ KRL   G+N R    
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLL-LGQNRRNSHR 71

Query: 72  ---HVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQIVR 123
               V K+LT++ YL+  GS   + W K N+ +I+ L +F  +D      G+ +R
Sbjct: 72  SCIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQDARDDRNGEEIR 126

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 56/103 (54%), Gaps = 7/103 (6%)

Query: 17  STTQVLLREATSND-PEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRL------NDKGKN 69
           S T+  +++ATS D   G +  +M+EI+  ++   +  EI+ ++ KRL       +  +N
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHED 112
              V K+LT++ YL+  GS   + W K N+ +I+ L  F  +D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENFHIQD 115

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 57/103 (55%), Gaps = 7/103 (6%)

Query: 17  STTQVLLREATSND-PEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRL------NDKGKN 69
           S T+  +++AT+ D   G +  +M+EI+  ++   +  EI+ ++ KRL       +  +N
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHED 112
              V K+LT++ YL+  GS   + W K N+ +I+ L +F  +D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQVQD 115

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 57/103 (55%), Gaps = 7/103 (6%)

Query: 17  STTQVLLREATSND-PEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRL------NDKGKN 69
           S T+  +++AT+ D   G +  +M+EI+  ++   +  EI+ ++ KRL       +  +N
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHED 112
              V K+LT++ YL+  GS   + W K N+ +++ L +F  +D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQVQD 115

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 55/105 (52%), Gaps = 6/105 (5%)

Query: 15  GYSTTQVLLREATS-NDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDKG-----K 68
           G S T   +R+AT  N+  G S  ++ EI   ++   +  ++  +L KRL+        K
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 69  NWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDE 113
           N  H+ K+LT+ +YL+  GSE  V W +    +++ L++F   +E
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNE 115

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 58/109 (53%), Gaps = 10/109 (9%)

Query: 17  STTQVLLREATSNDPE-GPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDKGKNWRH--- 72
           S T+  +++AT+ D   G +  +M+EI+  ++   +  EI+ +L KRL+   +   H   
Sbjct: 13  SPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRKTSHKNC 72

Query: 73  --VAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTL----REFMHEDELG 115
             + K+LT++ YL+  GS   V W + N  +I  L     E+  +D++G
Sbjct: 73  IFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNLISEKVEYPKDDKMG 121

>TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.335
           YDR153C
          Length = 491

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 20/97 (20%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R+AT+ D  GP+   +D+I     + V   +I+D + KRL D 
Sbjct: 21  RYAQNMIIAYEPYQIDIRQATNTDSWGPTKKHLDQIL-LDRNKVPLRKIVDYIMKRLMDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V KSL VL +L+
Sbjct: 80  INTRPRNLYDRARKDYVNYGTEWRVVFKSLIVLKFLL 116

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 57/110 (51%), Gaps = 11/110 (10%)

Query: 5   LIRKAKNVVNGYSTTQVLLREATS-NDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRL 63
           L    KN V   + ++V  ++AT  N+  G +  +M+EI+  ++   +  +I+ ++ KRL
Sbjct: 3   LFDTVKNFVQTPTESKV--KQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRL 60

Query: 64  ND---KGKNWRH-----VAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTL 105
           +      K   H     + K+LT++ YL+  GS   + W + N Y+++ +
Sbjct: 61  SSATSSNKKLSHKTSVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENI 110

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
           similar to uniprot|P53309 Saccharomyces cerevisiae
           YGR241C YAP1802 Yeast Assembly Polypeptide, member of
           AP180 protein family, binds Pan1p and clathrin; member
           of clathrin assembly polypeptide AP180 family and weakly
           similar to uniprot|P38856 Saccharomyces cerevisiae
           YHR161C YAP1801 Yeast Assembly Polypeptide member of
           AP180 protein family binds Pan1p and clathrin clathrin
           assembly protein
          Length = 669

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 42/90 (46%), Gaps = 4/90 (4%)

Query: 22  LLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDKGKNWRHVAKSLTVLD 81
           L++ AT      P    +D I   + DS  F EIM  L+ R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 82  YLVRCGSEHC-VPWAKENLYVIKTLREFMH 110
            ++R G     + +   +L   + LR+  H
Sbjct: 65  LMMRDGDRDVTIKYLSHHLEFFQ-LRDVFH 93

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 20/97 (20%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   Q+ +R AT+ D  GP+   ++++  R+   V  + + + + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVM-RNRFQVPMYLVTEYILKRLIDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K LTV++YL+
Sbjct: 80  IATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLL 116

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   Q+ +R AT+ D  GP+   + ++    ++ VS F + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYE-VSMFLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L +L+YL+
Sbjct: 80  MAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLL 116

>AGR046C Chr7 complement(800910..802073) [1164 bp, 387 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR153C
           (ENT5)
          Length = 387

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 43/97 (44%), Gaps = 20/97 (20%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ D  GP+   M ++  R  + V  + I +   KRL D 
Sbjct: 21  RFAQNVIIQYEPYQVDVRRATNTDSWGPTPKQMLKVM-RHKNHVPMYLITEYTMKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L VL++L+
Sbjct: 80  MAKRPKNLYEKARKQYVNYGHEWRVVLKCLVVLEFLI 116

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 20/102 (19%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ D  GP+   + ++    +  V  + +++   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLVRCGSE 89
                              G  WR V K L V+D+L+   SE
Sbjct: 80  IASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSE 121

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
          YAP1801Protein involved in clathrin cage assembly;
          binds Pan1p and clathrin; homologous to Yap1802p,
          member of the AP180 protein family
          Length = 637

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 22 LLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDKGKNWRHVAKSLTVLD 81
          L++ AT      P    +D I   + +   F+EI+  LD R+ND    W  V KSL V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82 YLVRCGSE 89
           ++R GS+
Sbjct: 65 LMIREGSK 72

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 58/114 (50%), Gaps = 14/114 (12%)

Query: 4   SLIRKAKNVVNGYSTTQVLLREATS-NDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKR 62
           S     +N+V  YS T++ +R+AT  N+    +  +M+EI+  ++ + +  EI+ +L K+
Sbjct: 2   SFFNSVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKK 59

Query: 63  L-------NDKG----KNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTL 105
           L       N  G    K    V K+ T++ YL+  GS   + W K N  V++ L
Sbjct: 60  LSLLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQIL 113

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 47/116 (40%), Gaps = 33/116 (28%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ D  GP+   + ++    +  V  + +++   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYL-------------VRCGSEH 90
                              G  WR V K LTV++YL             VRC   H
Sbjct: 80  IAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRCLDTH 135

>KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.335
           YDR153C
          Length = 421

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 20/101 (19%)

Query: 3   KSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKR 62
           ++  R A+NV+  Y   QV +R AT+ D  GP+   + ++    +  V  + + + + KR
Sbjct: 17  RNAARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRHRY-QVPMYLMTEYILKR 75

Query: 63  LNDK-------------------GKNWRHVAKSLTVLDYLV 84
           L D                    G  WR V K LTV+++L+
Sbjct: 76  LVDHIATRPKNLYEKARKDYVNYGAEWRVVLKCLTVIEFLM 116

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 20/97 (20%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ D  GP+   + ++    +  V  + I + + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRY-QVPLYLITEYILKRLIDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L V++YL+
Sbjct: 80  IAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLL 116

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 38.1 bits (87), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV +R AT+ D  GP+   ++++    +  V  + I +   KRL D 
Sbjct: 21  RFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKRLIDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K LTV++YL+
Sbjct: 80  IATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLL 116

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
          YHR161C (REAL)
          Length = 621

 Score = 37.4 bits (85), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 2/68 (2%)

Query: 22 LLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDKGKNWRHVAKSLTVLD 81
          L++ AT      P    +D I   +     F+EI+  LD R+ND    W  V K+L V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 82 YLVRCGSE 89
           ++R G +
Sbjct: 65 LMMREGKK 72

>KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.17
           YLL038C
          Length = 329

 Score = 37.0 bits (84), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 64/135 (47%), Gaps = 19/135 (14%)

Query: 5   LIRKAKNVVNGYSTTQVLLREATSNDPEGPSLD---IMDEIAERSWDSVSFFEIMDMLDK 61
           L    +N VN  STT++ +++AT +D E  S     +M+EI+  ++   +  EI  +L K
Sbjct: 3   LFDSVRNFVN--STTELKVKQAT-DDSEVLSSSTGTVMNEISVLTYSPKTLKEIQSVLRK 59

Query: 62  RLNDKGKNWRHVA--------KSLTVLDYLVRCGSEHCVPWAKENLYVIKTLR-----EF 108
           R +      R V         K+LT++ +L+  GS   V W K N+   + L+     EF
Sbjct: 60  RFHLMSTLPRKVLHRSCLIVLKTLTLILFLLNNGSNAFVSWIKSNVGAFEPLQNVPITEF 119

Query: 109 MHEDELGIDQGQIVR 123
              D+  +   + +R
Sbjct: 120 SFTDKADLPMYEQIR 134

>TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa]
           {ON} Anc_8.335 YDR153C
          Length = 415

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 20/96 (20%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   Q+ +R AT+ D  GP+   + ++    +  V  + + + + KR+ D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTSKHLAKVLRNRY-QVPLYLMTEYILKRIVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYL 83
                              G  WR V K L V+D+L
Sbjct: 80  IAVRPKNFYEKARKDYVNYGAEWRVVLKCLVVIDFL 115

>Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)
           [1215 bp, 404 aa] {ON} ANNOTATED BY YGOB -
          Length = 404

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 44/105 (41%), Gaps = 23/105 (21%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ D  GP+   + ++    +  V    + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKY-QVPLHLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYL---VRCGSE 89
                              G  WR V K L VL+YL   V  GSE
Sbjct: 80  IASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSE 124

>KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 399

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 45/99 (45%), Gaps = 24/99 (24%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPS---------------LDIMDEIA-ERSWDSV 50
           R A+NV+  Y   QV +R AT+ D  GP+               L +M E   +R  D +
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQVPLHLMTEYTLKRLVDHI 80

Query: 51  S-----FFEIMDMLDKRLNDKGKNWRHVAKSLTVLDYLV 84
           +     F+E      K+  + G  WR V K L VL+YL+
Sbjct: 81  ASRPKNFYE---KARKQYVNYGSEWRVVLKCLVVLEYLL 116

>Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {OFF}
           YDR153C - Hypothetical ORF [contig 29] FULL
          Length = 275

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 44/105 (41%), Gaps = 23/105 (21%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ D  GP+   + ++    +  V    + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKY-QVPLHLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYL---VRCGSE 89
                              G  WR V K L VL+YL   V  GSE
Sbjct: 80  IASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSE 124

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
          YHR161C (REAL)
          Length = 627

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 22 LLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDKGKNWRHVAKSLTVLD 81
          L++ AT      P    +D I   +     F+EI+  L+ R+ND    W  V KSL V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82 YLVRCGSE 89
           ++R G++
Sbjct: 65 LMIREGAK 72

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 45/102 (44%), Gaps = 20/102 (19%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R  +N++  Y   Q+ +R AT+ D  GP+   + ++    + SV  + + + + KR+ D 
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKY-SVPLYLMTEYVLKRIVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLVRCGSE 89
                              G  WR + K L V++YL+   SE
Sbjct: 80  LAKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSE 121

>Suva_2.315 Chr2
           complement(560767..560940,560968..561033,561037..562005)
           [1209 bp, 403 aa] {ON} YDR153C (REAL)
          Length = 403

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ D  GP+   + ++    +  V  + + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L V+++L+
Sbjct: 80  IATRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLL 116

>TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {ON}
           Anc_8.335 YDR153C
          Length = 361

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 43/97 (44%), Gaps = 20/97 (20%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R AT+ D  GP+   ++++    +  V  + + +   KRL D 
Sbjct: 21  RFAQNMIVQYEPYQIDIRRATNTDAWGPTPKHLEKVLRNRY-QVPLYLLTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L V+++L+
Sbjct: 80  VATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLL 116

>Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON}
           YDR153C (REAL)
          Length = 406

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ D  GP+   + ++    +  V  + + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L V+++L+
Sbjct: 80  IASRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLL 116

>SAKL0H15290g Chr8 (1322030..1323211) [1182 bp, 393 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 393

 Score = 33.9 bits (76), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV +R AT+ D  GP+   + ++  R+   V  + + + + KRL D 
Sbjct: 21  RFAQNMIVQYEPYQVDIRRATNTDSWGPTPKHLSKVM-RNRFQVPLYLMTEYILKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L +L++++
Sbjct: 80  IATRPKNLYEKARKQYVNYGNEWRVVLKCLVLLEHML 116

>Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON}
           YDR153C (REAL)
          Length = 416

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   Q+ +R AT+ D  GP+   + ++    +  V  + + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L V+++L+
Sbjct: 80  IATRPKNFYEKARKDYVNYGSEWRVVLKCLAVIEFLL 116

>YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}
           ENT5Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p, clathrin adaptor complex AP-1, and
           clathrin
          Length = 411

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   Q+ +R AT+ D  GP+   + ++    +  V  + + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L V+++L+
Sbjct: 80  IATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLL 116

>TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.335
           YDR153C
          Length = 385

 Score = 33.9 bits (76), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R  +N++  Y   Q+ +R A++ D  GP+   + ++    + SV  + I +   KRL D 
Sbjct: 21  RFMQNMIVQYEPYQIDVRRASNTDAWGPTSKHLQKVLRHKY-SVPLYLITEYTLKRLIDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L +LD+L+
Sbjct: 80  IATNSKNVYEKARKEYVNFGSEWRVVFKCLVILDFLL 116

>Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa]
           {ON} complement(205197..206303) [1107 nt, 369 aa]
          Length = 368

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 43/97 (44%), Gaps = 20/97 (20%)

Query: 7   RKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R AT+ D  GP+   + ++    +  V  + + + + KRL D 
Sbjct: 21  RFAQNMIVQYEPYQIDIRTATNTDSWGPTSKHLQKVIRHKY-HVPVYLMTEYILKRLIDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L ++++L+
Sbjct: 80  IASKPKNFYEKARKEYVNYGNEWRVVMKCLILIEFLL 116

>Kpol_1050.73 s1050
           complement(162665..164488,164492..164527,164531..164686)
           [2016 bp, 671 aa] {ON}
           complement(162665..164488,164492..164527,164531..164686)
           [2016 nt, 672 aa]
          Length = 671

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 32/62 (51%), Gaps = 14/62 (22%)

Query: 425 TGQ-TRIPAQHTKTGNFINSQGTGYKQVSSTPKHNPFLGQQYTGLPSTN--VVPSYTGYG 481
           TGQ T +  QH         Q TG+ Q S+T    P L  Q TG  S+N  V PS+TG G
Sbjct: 498 TGQHTSLQMQH--------PQNTGFIQQSATV---PNLTNQQTGFFSSNTQVTPSFTGAG 546

Query: 482 FG 483
           FG
Sbjct: 547 FG 548

>TDEL0G01080 Chr7 (220997..222544) [1548 bp, 515 aa] {ON} Anc_5.84
           YGR241C
          Length = 515

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 6/42 (14%)

Query: 448 YKQVSSTPKHNPFLG-----QQYTGLPSTN-VVPSYTGYGFG 483
           ++Q    P  NPFL      QQ TG  S N + P++TG GFG
Sbjct: 331 FEQQVPQPTGNPFLTMNDLPQQQTGFYSANQITPAFTGAGFG 372

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,999,478
Number of extensions: 1227210
Number of successful extensions: 4362
Number of sequences better than 10.0: 104
Number of HSP's gapped: 4360
Number of HSP's successfully gapped: 174
Length of query: 508
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 394
Effective length of database: 40,409,475
Effective search space: 15921333150
Effective search space used: 15921333150
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)