Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.246047.340ON38138120530.0
KLTH0H01474g7.340ON38138011761e-161
SAKL0F10978g7.340ON4054065583e-67
KLLA0C16687g7.340ON3983744293e-48
Ecym_45197.340ON4324084296e-48
ACL159W7.340ON4133874102e-45
TPHA0D045507.340ON4374552886e-28
NCAS0A140707.340ON1731281533e-11
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.24604
         (381 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.24604 s56 (1071942..1073087) [1146 bp, 381 aa] {ON} [con...   795   0.0  
KLTH0H01474g Chr8 complement(134657..135802) [1146 bp, 381 aa] {...   457   e-161
SAKL0F10978g Chr6 complement(859590..860807) [1218 bp, 405 aa] {...   219   3e-67
KLLA0C16687g Chr3 (1461624..1462820) [1197 bp, 398 aa] {ON} cons...   169   3e-48
Ecym_4519 Chr4 (1034982..1036280) [1299 bp, 432 aa] {ON} similar...   169   6e-48
ACL159W Chr3 (77497..78738) [1242 bp, 413 aa] {ON} NOHBY310; No ...   162   2e-45
TPHA0D04550 Chr4 (993082..994395) [1314 bp, 437 aa] {ON} Anc_7.340    115   6e-28
NCAS0A14070 Chr1 (2767470..2767991) [522 bp, 173 aa] {ON} Anc_7....    64   3e-11

>Kwal_56.24604 s56 (1071942..1073087) [1146 bp, 381 aa] {ON} [contig
           161] FULL
          Length = 381

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/381 (100%), Positives = 381/381 (100%)

Query: 1   MRVKWLCNCSTDPISLYDLNLCRKCHRVSCRWCQKPELLIKFCPGCSKGAETKNQMSCNK 60
           MRVKWLCNCSTDPISLYDLNLCRKCHRVSCRWCQKPELLIKFCPGCSKGAETKNQMSCNK
Sbjct: 1   MRVKWLCNCSTDPISLYDLNLCRKCHRVSCRWCQKPELLIKFCPGCSKGAETKNQMSCNK 60

Query: 61  NCFECPRCQLAVSVSMRKQGDGARCFELVCNGCLWKYTTPAMTKARPLTQFVKELQEKED 120
           NCFECPRCQLAVSVSMRKQGDGARCFELVCNGCLWKYTTPAMTKARPLTQFVKELQEKED
Sbjct: 61  NCFECPRCQLAVSVSMRKQGDGARCFELVCNGCLWKYTTPAMTKARPLTQFVKELQEKED 120

Query: 121 PHEQRFISLRKLYRDKIQFQNLETTDVIDPSFATKEVAERLNNMKLFELVNEEFPLPIHK 180
           PHEQRFISLRKLYRDKIQFQNLETTDVIDPSFATKEVAERLNNMKLFELVNEEFPLPIHK
Sbjct: 121 PHEQRFISLRKLYRDKIQFQNLETTDVIDPSFATKEVAERLNNMKLFELVNEEFPLPIHK 180

Query: 181 GTFTSWNSFPRARALRGKFNYRCPACGEYLTKCHPDPKSSRFMLESFAMHQLPDLQVVSR 240
           GTFTSWNSFPRARALRGKFNYRCPACGEYLTKCHPDPKSSRFMLESFAMHQLPDLQVVSR
Sbjct: 181 GTFTSWNSFPRARALRGKFNYRCPACGEYLTKCHPDPKSSRFMLESFAMHQLPDLQVVSR 240

Query: 241 SLIDPKIDDENSMALVFKASSSAHVATDITIVSCATAHIPVRQFTLTRDIPSRNELTQEA 300
           SLIDPKIDDENSMALVFKASSSAHVATDITIVSCATAHIPVRQFTLTRDIPSRNELTQEA
Sbjct: 241 SLIDPKIDDENSMALVFKASSSAHVATDITIVSCATAHIPVRQFTLTRDIPSRNELTQEA 300

Query: 301 IKRLASEVPTFQLNTNTKILAAEKSRRNSKVERTHKNEIIDQGNGWCIIPMYILEPTPTH 360
           IKRLASEVPTFQLNTNTKILAAEKSRRNSKVERTHKNEIIDQGNGWCIIPMYILEPTPTH
Sbjct: 301 IKRLASEVPTFQLNTNTKILAAEKSRRNSKVERTHKNEIIDQGNGWCIIPMYILEPTPTH 360

Query: 361 KLQLTIPIEGVYVTFQVVLST 381
           KLQLTIPIEGVYVTFQVVLST
Sbjct: 361 KLQLTIPIEGVYVTFQVVLST 381

>KLTH0H01474g Chr8 complement(134657..135802) [1146 bp, 381 aa] {ON}
           conserved hypothetical protein
          Length = 381

 Score =  457 bits (1176), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 215/380 (56%), Positives = 277/380 (72%), Gaps = 1/380 (0%)

Query: 1   MRVKWLCNCSTDPISLYDLNLCRKCHRVSCRWCQKPELLIKFCPGCSKGAETKNQMSCNK 60
           M  +WLC+CST+P S+Y LN+C KCHRVSC WCQKPELLIK+CPGC + AE++ Q+ C  
Sbjct: 1   MIAQWLCSCSTEPNSIYKLNICAKCHRVSCNWCQKPELLIKYCPGCFRVAESEGQLRCVH 60

Query: 61  NCFECPRCQLAVSVSMRKQGDGARCFELVCNGCLWKYTTPAMTKARPLTQFVKELQEKED 120
           NC ECPRC+L +SVSM K   G + FE+VCNGC W+Y TP ++  + LT  V+EL++KED
Sbjct: 61  NCLECPRCELILSVSMEKLASGHKRFEMVCNGCSWRYKTPEVSTLKTLTGCVEELRKKED 120

Query: 121 PHEQRFISLRKLYRDKIQFQNLETTDVIDPSFATKEVAERLNNMKLFELVNEEFPLPIHK 180
           P+ QRF SLR+ Y  K + Q +E    +  S A+KE+ +RLN  KL++++NEE P+    
Sbjct: 121 PYTQRFNSLREFYGFKRELQYMEEGGEVSESIASKELFDRLNETKLYKMINEECPIEFKD 180

Query: 181 GTFTSWNSFPRARALRGKFNYRCPACGEYLTKCHPDPKSSRFMLESFAMHQLPDLQVVSR 240
              +   + P    LR KF+YRCP+CGE+LTK HPDP+SSRF+LESFA H LP L++V R
Sbjct: 181 TKDSGDIALPLPLRLRAKFDYRCPSCGEWLTKSHPDPRSSRFLLESFAAHMLPSLEIVHR 240

Query: 241 SLIDPKIDDENSMALVFKASSSAHVATDITIVSCATAHIPVRQFTLTRDIPSRNELTQEA 300
           S ++P + DEN+MALVF AS  +    +ITI+  AT HIPVRQFTL  D P + E T E 
Sbjct: 241 SKVEPSVSDENAMALVFTASDQSDTPVEITILGSATIHIPVRQFTLAYDGPVKCESTMET 300

Query: 301 IKRLASEVPTFQLNTNTKILAAEKSRRNSKVERT-HKNEIIDQGNGWCIIPMYILEPTPT 359
           IKRL + VPT+QLN+NT ILA EKSRR ++ E   HKN +IDQG+GWCI+PMYILEP  T
Sbjct: 301 IKRLVTRVPTYQLNSNTNILATEKSRRLTRPETAPHKNNMIDQGSGWCILPMYILEPAKT 360

Query: 360 HKLQLTIPIEGVYVTFQVVL 379
           H++QLTIPI+GVYVT Q VL
Sbjct: 361 HRIQLTIPIKGVYVTLQAVL 380

>SAKL0F10978g Chr6 complement(859590..860807) [1218 bp, 405 aa] {ON}
           conserved hypothetical protein
          Length = 405

 Score =  219 bits (558), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 138/406 (33%), Positives = 205/406 (50%), Gaps = 30/406 (7%)

Query: 1   MRVKWLCNCSTDPISLYDLNLCRKCHRVSCRWCQKPELLIKFCPGCSKGAETKNQMSCNK 60
           MRV  LC+CS+   SL  LNLC+ C+RVSC  CQ  E ++K+CP C +     +Q  C K
Sbjct: 1   MRVLVLCDCSSKCKSLSQLNLCQACYRVSCTQCQLFEPVLKYCPLCMEVPSRADQTHCTK 60

Query: 61  NCFECPRCQLAVSVSMRKQGDGARCFELVCNGCLWKYTTPAMTKARPLTQFVKELQEKED 120
           NCF+CPRC+L + +S     DG + +   C GC W Y TP++ K R LT+++K L+  E 
Sbjct: 61  NCFQCPRCKLGLVISSGSCDDGNKKYVFKCMGCHWDYKTPSVGKIRSLTKYIKSLKANEC 120

Query: 121 PHEQRFISLRKLYRDKIQFQNLETTDV-----IDPSFAT--KEVAERLNNM-KLFELVNE 172
              +RF  L + Y  K Q  +   T       +D S     + V +RL+   KLFEL++E
Sbjct: 121 LLSRRFEVLERHYHSKRQLLDWGLTKTPLKIPLDGSLVADRRNVLQRLSQGDKLFELLDE 180

Query: 173 EFPLPIHKGTFTSWNSFPRARALRGKFNYRCPACGEYLTKCHPDPKSSRFMLESFAMHQL 232
             P+P++    +     P    LR K+ Y CP C   L K    PKS +F   SFA+  L
Sbjct: 181 PCPMPLNDT--SDALELPLQMHLRCKYKYSCPYCLNTLLKPETQPKSLKFYTTSFAVKYL 238

Query: 233 PDLQVVSRSLIDPKIDDENSMALVFKASSSAHVATDITIVSCATAHIP---VRQFTLTRD 289
           P L +  RS ID K+ D+   ALV    +S+     IT+       IP   VR   +T  
Sbjct: 239 PALSLAPRSQIDNKVYDDTRFALVINNPTSSE-EMHITMSGSDGLFIPITEVRIRAVTPV 297

Query: 290 IPSRNELTQEAIKRLASEVPTFQLNTNTKILAAEKSRRNSK----------------VER 333
            PS  +   + I++    VPT++L  +TK+   E+++R  K                +E 
Sbjct: 298 TPSHQDHGLKTIEQFILSVPTYKLTADTKLSRVERTKRLGKKNLNVYSTANNSSTSLLED 357

Query: 334 THKNEIIDQGNGWCIIPMYILEPTPTHKLQLTIPIEGVYVTFQVVL 379
               +++DQG+GWCI+P+ +L     H L +T+  +   VT   V+
Sbjct: 358 LEDYKLLDQGSGWCIVPVNVLNNASVHSLFITVATQKFKVTMNCVI 403

>KLLA0C16687g Chr3 (1461624..1462820) [1197 bp, 398 aa] {ON}
           conserved hypothetical protein
          Length = 398

 Score =  169 bits (429), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 105/374 (28%), Positives = 187/374 (50%), Gaps = 21/374 (5%)

Query: 15  SLYDLNLCRKCHRVSCRWCQKPELLIKFCPGCSKGAETKNQMSCNKNCFECPRCQLAVSV 74
           +  DLNLC KCH +SC+ CQ  E++ K+C  C K A   + + C+KNCF+CP C +++ +
Sbjct: 15  NFLDLNLCTKCHLISCQQCQDFEVVGKYCSQCGKDASKNDAVYCHKNCFQCPCCAMSLQI 74

Query: 75  SMRKQGDGA--RCFELVCNGCLWKYTTPAMTKARPLTQFVKELQEKEDPHEQRFISLRKL 132
              K  +    R +   C GC W Y TP + K + LT+++ EL+   D H +RF SLR+ 
Sbjct: 75  ISNKDENNTDHRSYSFKCQGCNWSYCTPVVPKIKSLTKYIIELEYSTDTH-RRFESLRQF 133

Query: 133 YRDKIQFQNLETT------DVIDPSFATKEVAERLNNMKLFELVNEEFPLPIHKGTFTSW 186
           Y  +    +L         D +DPS          N   L++L+NEE  +P  +    + 
Sbjct: 134 YHTRNTLNSLSLKPESLKFDALDPSNLNSWWKRLANGEPLWKLINEENAIPFDELKQENK 193

Query: 187 NSFPRARALRGKFNYRCPACGEYLTKCHPDPKSSRFMLESFAMHQLPDLQVVSR---SLI 243
           +  P    LR K+NY CP C   +T+  P P + +++        +P + V+S    + +
Sbjct: 194 HWLPSLCKLRPKYNYFCPYCKRCMTRMDPTPDTVKWVKTPPIYSGIPRISVISSYQCTQL 253

Query: 244 DPKIDDENSMALVFKASSSAHVATDITIVSCATAHIPVRQFTLTRDIPSRNELTQ--EAI 301
             + D +N++ L+ + +     AT + I +  +  +P  + ++   I +  +     E +
Sbjct: 254 YKEFDHDNNLMLLIENTRQDSNAT-LKINAEESLLVPNHELSIFAAIKTNQKRKDNLEQL 312

Query: 302 KRLASEVPTFQLNT---NTKILAAEKSRRNSKVERTHKNE---IIDQGNGWCIIPMYILE 355
           + +   +PT  LNT   + K+L  E +RR   + +   ++   IID+G GW +IP+ I+ 
Sbjct: 313 QDVLHSLPTHMLNTSPDSDKLLRVENTRRLGLLNKRLSSDNLRIIDEGTGWIVIPLMIIN 372

Query: 356 PTPTHKLQLTIPIE 369
             P +++ + +  E
Sbjct: 373 RKPRYEIDIFVHFE 386

>Ecym_4519 Chr4 (1034982..1036280) [1299 bp, 432 aa] {ON} similar to
           Ashbya gossypii ACL159W
          Length = 432

 Score =  169 bits (429), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 115/408 (28%), Positives = 204/408 (50%), Gaps = 37/408 (9%)

Query: 1   MRVKWLCNCSTDPISLYDLNLCRKCHRVSCRWCQKPELLIKFCPGCSKGAETKNQMSCNK 60
           M V++ C C  + +   DLN+CR+C+ +SC  CQ  E ++K+CP C +     +Q+ CN+
Sbjct: 22  MEVRYQCICK-NLVKWSDLNICRECYSLSCFRCQGFEPVVKYCPKCLEEPGKMDQIFCNR 80

Query: 61  NCFECPRCQLAVSVSMRKQGDGARCFELVCNGCLWKYTTPAMTKARPLTQFVKELQEKED 120
           NCF+CPRC +++ +S  K     +C+   C GC W +TTP   K + LT+++ EL   ++
Sbjct: 81  NCFQCPRCDISLVISSEKMDSDKKCYLFNCTGCKWTFTTPPTGKIKSLTKYILELYSSKN 140

Query: 121 PHEQRFISLRKLYRDKIQ-----FQNLETTDVIDPSFATKEVAERLN-NMKLFELVNEEF 174
                 I+     +  +Q     F+  E    ++ + A + + +RL    KL +L++E+ 
Sbjct: 141 ARAYELITHLHNKKQLLQWEGKAFKFDEIVSALEGN-APRSIVQRLAVGEKLHQLISEQI 199

Query: 175 PLPIHKGTFTSWNSFPRARALRGKFNYRCPACGEYLTKCHPDPKSSRFMLESFAMHQLPD 234
           PLP+   +      +P+   L+ K+ Y CP C   L+     P SSR   ESFAM+ LP 
Sbjct: 200 PLPLKDDSNEVL--YPKRLHLKCKYRYTCPQCNHTLSVPDDSPSSSRLHKESFAMNILPR 257

Query: 235 LQVVSRSL-IDPKIDDENSMALVFKASSSAHVATDITIVSCATAHIPVRQFTL----TRD 289
           +++   ++ +     D ++ A+V    + +  + + T+ +  T  +P+R+F +      D
Sbjct: 258 IRIEKLAVALGMDHQDPSAFAIVVINPNPSR-SIECTLTASDTLFMPIRKFNIPAVSVND 316

Query: 290 IP----SRNELTQEAIKRLASEVPTFQLNTNTKILAAEKSRRNSK---VERTHKNEI--- 339
                 S  ++  + +++ A   PT+ L  + KI  AE++RR       + +  N I   
Sbjct: 317 YKIIKNSGKDINLQILEQYAKFTPTYMLGNDHKINRAERTRRLGSRFPFQNSTTNSINLL 376

Query: 340 ----------IDQGNGWCIIPMYILEPTPTHKLQLTIPIEGVYVTFQV 377
                     ID+G+GWCI+P+ +L     H L L + IEG  V   +
Sbjct: 377 DYDIDEDAKAIDKGDGWCILPLKLLNKG-NHLLNLLVNIEGFEVRLNL 423

>ACL159W Chr3 (77497..78738) [1242 bp, 413 aa] {ON} NOHBY310; No
           homolog in Saccharomyces cerevisiae
          Length = 413

 Score =  162 bits (410), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 105/387 (27%), Positives = 186/387 (48%), Gaps = 39/387 (10%)

Query: 1   MRVKWLCNCSTDPISLYDLNLCRKCHRVSCRWCQKPELLIKFCPGCSKGAETKNQMSCNK 60
           M V++ C C    +   DLN C++CH +SC  CQ+ E ++K+CP C +     +Q+ CN+
Sbjct: 1   MEVRYQCVCQ-QLVKWSDLNSCKECHSISCFRCQEFEPVLKYCPKCLEEPGKIDQIFCNR 59

Query: 61  NCFECPRCQLAVSVSMRKQGDGARCFELVCNGCLWKYTTPAMTKARPLTQFVKELQEKED 120
           NCF+CPRC +++ +S  K  + ++ +   C GC W +TTP   K + LT++V EL   ++
Sbjct: 60  NCFQCPRCNISLVISSEKVTEDSKSYVFTCTGCKWSFTTPPTGKIKSLTKYVLELYNSKN 119

Query: 121 PHEQRFISLRKLYRDKIQ-----FQNLETTDVIDPSFATKEVAERLNNMKLFELVNEEFP 175
                 ++     +  +Q     F+  E  + ++ +     V       KL  L+NEE  
Sbjct: 120 SRAYELMTHLHNKKQLLQWEGRAFKFDEIVNALEGNAPRSFVQRLAAGEKLHHLINEELA 179

Query: 176 LPIHKGTFTSWNSFPRARALRGKFNYRCPACGEYLTKCHPDPKSSRFMLESFAMHQLPDL 235
            P+ +        +P+   L+ ++ Y CP C   L+     P SS+   ESFAM+ LP +
Sbjct: 180 QPLQQD--MEHVLYPKRTHLKCRYRYMCPKCHHTLSMPDQTPASSKLHKESFAMNVLPHI 237

Query: 236 QV--VSRSLIDPKIDDENSMALVFKASSSAHV-ATDITIVSCATAHIPVRQFTLTRDIPS 292
           ++   +R+L    +D ++  AL     +   + A D  + +  T  +PVR+FT+    P 
Sbjct: 238 RIETEARAL---GVDTQDPTALAIIVMNPIPMRAVDFVLSASDTLFLPVRKFTIPSVAPD 294

Query: 293 RNELTQ--------EAIKRLASEVPTFQLNTNTKILAAEKSRR-------NSKVERTHKN 337
            ++L +        + ++     +PT  L  + K+  AE++RR             T  N
Sbjct: 295 DSQLDRSQGKDVNLQILEHYVKFIPTCMLGNDHKLNRAERTRRLGNRFQFQGSASPTPPN 354

Query: 338 EI----------IDQGNGWCIIPMYIL 354
            +          +DQG+ WCI+P+ +L
Sbjct: 355 PVDYDIEEEARPLDQGDAWCILPLKLL 381

>TPHA0D04550 Chr4 (993082..994395) [1314 bp, 437 aa] {ON} Anc_7.340
          Length = 437

 Score =  115 bits (288), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 108/455 (23%), Positives = 185/455 (40%), Gaps = 95/455 (20%)

Query: 1   MRVKWLCNCSTD------------PISLYDLNLCRKCHRVSCRWCQKPELLIKFCPGCSK 48
           M++KW CNC  +             I    LNLCRKCH++SC  CQ  +   KFCP C +
Sbjct: 1   MKIKWTCNCCKERNHYNGNDAQQYGIDFSRLNLCRKCHKISCDSCQLFQDYEKFCPYCCR 60

Query: 49  GAETKN-------------------QMSCNKNCFECPRCQLAVSVSM----RKQGDGARC 85
             +  +                      C   CF+CP+C  ++++S+    R +    + 
Sbjct: 61  NNKVPDCADGSRLSFEERYCQEICYDEYCTNGCFQCPKCNNSLALSLCKNERLKDPNGKT 120

Query: 86  FELVCNGCLWKYTTPAMTKARPLTQFVKELQEKEDPHEQRFISLRKLYRDKIQFQNLETT 145
               C  C W ++T      + L++ +  L    DP  QRF  L  +Y +       +++
Sbjct: 121 ISFQCYCCSWSWSTELPGNVKLLSKHIFSLHLNLDPKFQRFKQLSNIYLN-------DSS 173

Query: 146 DVI--DPSFATKEVAER-------------LNNMKLFE-------LVNEEFPLPIHKGTF 183
           D    DPS++ K++  +             +NN K          L+N++FP   H+  +
Sbjct: 174 DCSNNDPSYSVKDIYLKQGDLQSARGLLDIINNKKETSFNTSSTVLLNDQFP---HQNLY 230

Query: 184 TSWN-SFPRARALRGKFNYRCPACGEYLTKCHPDPKSSRFMLESFAMHQLPDLQVVSRSL 242
              N S P    L  KF Y+CP C E + K   +  SS    ESFA  QLP ++V   ++
Sbjct: 231 DDTNTSLPELSKLVMKFEYKCPHCEETILKPSSELYSSDNTYESFAFTQLPTIEV--SAI 288

Query: 243 IDPKIDDENSMALVFK-ASSSAHVATDITIVSCATAHIPVRQFTLTRDIPSRNELTQEAI 301
            D K D    + L+ K    + +      I++     +   +F   +    + +   +  
Sbjct: 289 KDLKQD----LVLIMKNIEDNLNDFVQAEIITSDNIQLSQNKFIFMKSTGDKLQDKSKYY 344

Query: 302 KRLAS---EVPTFQL----NTNTKILAAEKSRRNSKVERTHKNEIIDQGNG--------- 345
             L S    +P+F L    N N K +  EK RR   + + +   +++  N          
Sbjct: 345 AELMSYLEGLPSFDLNLCDNVNNKFVRIEKQRR---LAKNNNIAVMNNANSPMNYKEESD 401

Query: 346 -WCIIPMYILEPTPTHKLQLTIPIEGVYVTFQVVL 379
            + + P+ IL  T  +KL +    +   V+ + +L
Sbjct: 402 RYIVSPIKILTETALNKLLVKYKFKTYEVSLECIL 436

>NCAS0A14070 Chr1 (2767470..2767991) [522 bp, 173 aa] {ON} Anc_7.340
          Length = 173

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 61/128 (47%), Gaps = 5/128 (3%)

Query: 7   CNCSTDPISLYDLNLCRKCHRVSCRWCQKPELLIKFCPGCSK-GAETKNQMSCNKNCFEC 65
           C CS DP   +  N C+ CH  +C  C+  + L + CP C            C  +CF+C
Sbjct: 3   CPCSRDPQVPHVTN-CKVCHNTTCPDCELFQPLQRECPQCQTITMHMDEDTRCKNDCFQC 61

Query: 66  PRCQLAVSVSMRKQGDGARCFELVCNGCLWKYTTPAM--TKARPLTQFVKELQEKEDPHE 123
           P C+ A++V + K     R ++  C  C + Y TP+M  T  R ++Q V  L E  +   
Sbjct: 62  PNCETALTVLLAKSSRKKR-YKFTCKHCDYDYVTPSMSVTDERSISQIVDHLNETLNVEY 120

Query: 124 QRFISLRK 131
            RF  L+K
Sbjct: 121 LRFQELKK 128

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.134    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,286,457
Number of extensions: 1720688
Number of successful extensions: 5109
Number of sequences better than 10.0: 19
Number of HSP's gapped: 5268
Number of HSP's successfully gapped: 19
Length of query: 381
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 270
Effective length of database: 40,753,473
Effective search space: 11003437710
Effective search space used: 11003437710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)