Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.239168.323ON49949920960.0
KLTH0G12298g8.323ON50049818370.0
SAKL0H15554g8.323ON53647911351e-150
AGL195C8.323ON55447311231e-148
Ecym_42548.323ON5293749981e-130
KLLA0D16368g8.323ON5114999941e-129
KAFR0B057208.323ON4844528911e-114
TDEL0F044908.323ON5104958651e-110
Smik_4.3898.323ON5255108211e-103
Skud_4.4048.323ON5354878131e-102
YDR145W (TAF12)8.323ON5394948121e-102
NCAS0B035708.323ON5194848001e-100
Suva_2.3068.323ON5411706062e-71
ZYRO0F10384g8.323ON5581716055e-71
Kpol_543.638.323ON5851985936e-69
CAGL0E01397g8.323ON5751715523e-63
NDAI0J010208.323ON6381715564e-63
TPHA0A015608.323ON5401715424e-62
TBLA0A039408.323ON7521705395e-60
KNAG0I008908.323ON5081735092e-57
TBLA0H012808.323ON4051162935e-28
KNAG0C012701.216ON410751751.5
Kwal_33.145252.88ON30044713.5
KLTH0D15554g4.297ON12347674.4
Kwal_47.171404.297ON12350674.6
YLR403W (SFP1)4.265ON68371689.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23916
         (499 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145...   811   0.0  
KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]...   712   0.0  
SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]...   441   e-150
AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON} S...   437   e-148
Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar t...   389   e-130
KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} simi...   387   e-129
KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON} Anc_8...   347   e-114
TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.3...   337   e-110
Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W ...   320   e-103
Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W ...   317   e-102
YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subun...   317   e-102
NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.3...   312   e-100
Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa...   238   2e-71
ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some s...   237   5e-71
Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON} (145534...   233   6e-69
CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {...   217   3e-63
NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {...   218   4e-63
TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {O...   213   4e-62
TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.3...   212   5e-60
KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {O...   200   2e-57
TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {O...   117   5e-28
KNAG0C01270 Chr3 (245114..257437) [12324 bp, 4107 aa] {ON} Anc_1...    33   1.5  
Kwal_33.14525 s33 complement(706024..706926) [903 bp, 300 aa] {O...    32   3.5  
KLTH0D15554g Chr4 (1284597..1284968) [372 bp, 123 aa] {ON} simil...    30   4.4  
Kwal_47.17140 s47 complement(269893..270264) [372 bp, 123 aa] {O...    30   4.6  
YLR403W Chr12 (925568..927619) [2052 bp, 683 aa] {ON}  SFP1Regul...    31   9.5  

>Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145W
           (TAF12) - TFIID subunit [contig 171] FULL
          Length = 499

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/499 (82%), Positives = 410/499 (82%)

Query: 1   MSANSNSGQPIQGNNNVQGSPAQRFTPESMQQMAYKFTQCFNEAKRIGLQTPQGQELLKQ 60
           MSANSNSGQPIQGNNNVQGSPAQRFTPESMQQMAYKFTQCFNEAKRIGLQTPQGQELLKQ
Sbjct: 1   MSANSNSGQPIQGNNNVQGSPAQRFTPESMQQMAYKFTQCFNEAKRIGLQTPQGQELLKQ 60

Query: 61  ASHIKAVYDAYXXXXXXXXGFDQNXXXXXXXXXXXXXXXXXRAPNGTATNTISSNIQNLL 120
           ASHIKAVYDAY        GFDQN                 RAPNGTATNTISSNIQNLL
Sbjct: 61  ASHIKAVYDAYRQRQQAAQGFDQNAPGASSAGSTSGSPATARAPNGTATNTISSNIQNLL 120

Query: 121 TPQQNEAYGRLIQSSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEI 180
           TPQQNEAYGRLIQSSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEI
Sbjct: 121 TPQQNEAYGRLIQSSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEI 180

Query: 181 LNKLKGFSASYVALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANSATSQNASPL 240
           LNKLKGFSASYVALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANSATSQNASPL
Sbjct: 181 LNKLKGFSASYVALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANSATSQNASPL 240

Query: 241 PTNSNGNQTSSXXXXXXXXXXXXXXNGTPGQTRSAASSRSPTQVTSVXXXXXXXXXXXXX 300
           PTNSNGNQTSS              NGTPGQTRSAASSRSPTQVTSV             
Sbjct: 241 PTNSNGNQTSSPAQQQAAVQVPPPQNGTPGQTRSAASSRSPTQVTSVNAAAHLANNATSA 300

Query: 301 XRRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEV 360
            RRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEV
Sbjct: 301 ARRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEV 360

Query: 361 DNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRK 420
           DNERVMSKRKLRELVKSV                         FITNVTSFACRLAKHRK
Sbjct: 361 DNERVMSKRKLRELVKSVGIDEGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRK 420

Query: 421 SDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSARVSKTXXXX 480
           SDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSARVSKT    
Sbjct: 421 SDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSARVSKTASAA 480

Query: 481 XXXXXXXVTGNNDSKNQPM 499
                  VTGNNDSKNQPM
Sbjct: 481 QAAAAHAVTGNNDSKNQPM 499

>KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]
           {ON} similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145W
          Length = 500

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/498 (71%), Positives = 379/498 (76%)

Query: 1   MSANSNSGQPIQGNNNVQGSPAQRFTPESMQQMAYKFTQCFNEAKRIGLQTPQGQELLKQ 60
           MS+N NSGQP Q  NN QG+PAQR TPES+QQMAYKF+QCFNEAKR+GLQTPQGQELLKQ
Sbjct: 1   MSSNPNSGQPAQSGNNQQGTPAQRLTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQ 60

Query: 61  ASHIKAVYDAYXXXXXXXXGFDQNXXXXXXXXXXXXXXXXXRAPNGTATNTISSNIQNLL 120
           AS IKA+YDAY        GF+Q                  R+PNGT  N +SSNIQNLL
Sbjct: 61  ASRIKAMYDAYRQRQQSAQGFEQGGATSNTGDNTAGTPTNARSPNGTPNNNMSSNIQNLL 120

Query: 121 TPQQNEAYGRLIQSSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEI 180
           TPQQNEAYGRLIQ+SNENGEKIKGEYTYLK+QIEILDGEIKKR+GDPATVKQLE NK EI
Sbjct: 121 TPQQNEAYGRLIQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEI 180

Query: 181 LNKLKGFSASYVALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANSATSQNASPL 240
           LNKL+GFSASY+ALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANS  SQNASPL
Sbjct: 181 LNKLRGFSASYLALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANSTASQNASPL 240

Query: 241 PTNSNGNQTSSXXXXXXXXXXXXXXNGTPGQTRSAASSRSPTQVTSVXXXXXXXXXXXXX 300
           P  +  NQ SS                TP Q RS  +SRSPTQVTSV             
Sbjct: 241 PAATGANQASSPIQQTGAPSQVQQQTATPSQPRSGVNSRSPTQVTSVNAAAHLANNATSA 300

Query: 301 XRRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEV 360
            R+AIFKQPNPSVPVSETITQ+MPT +V+RSNRPTITGGSAMNAAALTTPVMTKLPPYEV
Sbjct: 301 ARQAIFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEV 360

Query: 361 DNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRK 420
           DNERVMSKRKLRELVKSV                         FITNVTSFACRLAKHRK
Sbjct: 361 DNERVMSKRKLRELVKSVGIDEGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRK 420

Query: 421 SDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSARVSKTXXXX 480
           SDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPT SYNQKLQGINSA+V+KT    
Sbjct: 421 SDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGINSAKVTKTTSAA 480

Query: 481 XXXXXXXVTGNNDSKNQP 498
                  V+ N DSKNQP
Sbjct: 481 QAAAAQAVSSNADSKNQP 498

>SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]
           {ON} some similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 536

 Score =  441 bits (1135), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 249/479 (51%), Positives = 297/479 (62%), Gaps = 23/479 (4%)

Query: 21  PAQRFTPESMQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAY-XXXXXXXX 79
           P Q+ T  S+QQ+A +FT  F EA RIG+ T +G+ELLKQA+ IKA+YDAY         
Sbjct: 21  PLQQVTSASIQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYNKQKQQAAQ 80

Query: 80  GFDQN---XXXXXXXXXXXXXXXXXRAPNGTATNTISSNIQNLLTPQQNEAYGRLIQSSN 136
            F Q                     +  N  + N  SSNI+ LLTP+Q+EAY +L ++  
Sbjct: 81  AFGQTNNRPPAPAAGNPPQVAQNTQQRQNSNSANNPSSNIRTLLTPEQSEAYNKLTKTFG 140

Query: 137 ENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEILNKLKGFSASYVALNQ 196
           ++ + I+GE  YL++ IE+LD EIK RE +P  V++LE+ KAE++ KL+G  AS+ AL Q
Sbjct: 141 DSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRGLDASFQALPQ 200

Query: 197 KLREDKKKFYIECAATNPNLKRFLQASTQQQRANSATSQNASPLPTNSNGNQTS------ 250
           K  E KKKFYIECAA+NPNLKRFLQASTQQQ+      Q       N+N  Q S      
Sbjct: 201 KFHEAKKKFYIECAASNPNLKRFLQASTQQQQQQQQQQQQQQQQKVNTNQGQISVSPVVQ 260

Query: 251 SXXXXXXXXXXXXXXNGTPG-------------QTRSAASSRSPTQVTSVXXXXXXXXXX 297
                            TPG             Q  S ++SRSPTQVTSV          
Sbjct: 261 QTSSQPAAAASASMAATTPGASTPSQQQQKKPTQGNSTSTSRSPTQVTSVNAAALLANNN 320

Query: 298 XXXXRRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPP 357
               R+AIFKQPNPS+PVSE +T K PT +  RSNRPTITGGSAMNAAAL TPVMTKLPP
Sbjct: 321 TAAARQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRPTITGGSAMNAAALNTPVMTKLPP 380

Query: 358 YEVDNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAK 417
           YEVD+ERVMSKRKLRELVKSV                         FI+NVT FACRLAK
Sbjct: 381 YEVDSERVMSKRKLRELVKSVGVDEGDGETTIDGDVEELLLDLADDFISNVTGFACRLAK 440

Query: 418 HRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSARVSKT 476
           HRKSDNLDVRDIQLHLERNWNIRIPGY+ADE+RSTRKWN T +Y QKLQGIN+A+  KT
Sbjct: 441 HRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNSTTNYTQKLQGINAAKAVKT 499

>AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR145W
           (TAF12)
          Length = 554

 Score =  437 bits (1123), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 241/473 (50%), Positives = 300/473 (63%), Gaps = 20/473 (4%)

Query: 12  QGNNNVQGSPAQRFTPESMQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAY 71
           QGN  V      + TP SM+Q+AYKF    +EA+++G++TP+G ELLK+AS+IKA+Y+ Y
Sbjct: 67  QGNGQVP-----QLTPSSMRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETY 121

Query: 72  XXXXXXXXGFDQNXXXXXXXXXXXXXXXXXRAPNGTATNTISSNIQNLLTPQQNEAYGRL 131
                      +N                   P    T++++SNI+ LLTPQQ EAY +L
Sbjct: 122 HRQQAQQAFQVRNPAPAGQLAAAGTGQATAPRP----TSSVASNIKMLLTPQQREAYEKL 177

Query: 132 IQSSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEILNKLKGFSASY 191
            Q+ NE+ + I GEY +LK+ IE+LD EIK R+G+P TVKQLE  K E+L KL G +  +
Sbjct: 178 TQTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVKQLETKKNELLTKLTGLNTQF 237

Query: 192 VALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRA---NSATSQNASPLPTNSNGNQ 248
            AL +K +EDKKKFYIECAATN NLK+FLQA++QQQRA   N+ T+ + +     +N   
Sbjct: 238 QALPKKFQEDKKKFYIECAATNVNLKKFLQATSQQQRASAGNTGTTNSPANTQLGANIGA 297

Query: 249 TSSXXXXXXXXXXXXXXNGTPGQTR------SAASSRSPTQVTSVXXXXXXXXXXXXXXR 302
            S+                TP   R      ++ ++R P QVT V              R
Sbjct: 298 ASAATPAAANAAPTGSSAATPQSQRQQMQRPNSGANRYPAQVTPV--NAAANQNNSGTAR 355

Query: 303 RAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDN 362
             IFKQPNPS+P+ E IT    T +  RSNRPTIT GSAMNA+ALT PVMTKLPPYEVD+
Sbjct: 356 PVIFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVDS 415

Query: 363 ERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSD 422
           ERVMSKRKLRELVK+V                         FITNVTSFACRLAKHRKSD
Sbjct: 416 ERVMSKRKLRELVKTVGIDDGDGETTVDGDVEELLLDLADDFITNVTSFACRLAKHRKSD 475

Query: 423 NLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSARVSK 475
           NLDVRDIQLHLERNWNIRIPGYAADE+RST+KWNPT +Y+QKLQGI+SAR +K
Sbjct: 476 NLDVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGISSARAAK 528

>Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar to
           Ashbya gossypii AGL195C
          Length = 529

 Score =  389 bits (998), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 208/374 (55%), Positives = 250/374 (66%), Gaps = 11/374 (2%)

Query: 111 TISSNIQNLLTPQQNEAYGRLIQSSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATV 170
           +++SNI+ LL PQQ EAY RL Q+ NE+ + IKGEY +LK+ IE+LD EIK R+ +P TV
Sbjct: 128 SVASNIKMLLNPQQREAYERLTQTFNESAKNIKGEYEFLKKNIEVLDTEIKNRQSEPITV 187

Query: 171 KQLEANKAEILNKLKGFSASYVALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRAN 230
           +QLE+ K E+L KL   +  +  L +K +EDKKKFYIECAATN NLK+FLQA++QQQRAN
Sbjct: 188 RQLESKKNELLMKLTSLNTQFQTLPKKFQEDKKKFYIECAATNMNLKKFLQATSQQQRAN 247

Query: 231 SA-TSQNASPLPTNSNGNQTSSXXXXXXXXXXXXXXN-------GTPGQTRS-AASSRSP 281
           +  T   +SP PT  +G+  +               N           Q RS +  SRSP
Sbjct: 248 TGNTGTTSSPAPTQPSGSVGTPNSAVPVSTNSVNTGNTATPQQSKQQPQQRSNSGISRSP 307

Query: 282 TQVTSVXXXXXXXXXXXXXXRRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSA 341
           TQVT V              R  IFKQPNPS+P+ E+++    T +  RSNRPTITGGSA
Sbjct: 308 TQVTPV--NAAANQNSNGAARPVIFKQPNPSIPIPESVSPISTTSVSYRSNRPTITGGSA 365

Query: 342 MNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXX 401
           MNAAALTTPVMTKLPPYEVD+ERVMSKRKLRELVKSV                       
Sbjct: 366 MNAAALTTPVMTKLPPYEVDSERVMSKRKLRELVKSVGIDDGDGETTIDGDVEELLLDLA 425

Query: 402 XXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASY 461
             FITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIR PGY+ADE+RST+KWN T +Y
Sbjct: 426 DDFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRTPGYSADEIRSTKKWNSTPAY 485

Query: 462 NQKLQGINSARVSK 475
            QK+Q I SA+ +K
Sbjct: 486 GQKMQVITSAKAAK 499

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 49/67 (73%), Gaps = 7/67 (10%)

Query: 5  SNSGQPIQGNNNVQGSPAQRFTPESMQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHI 64
          SN+GQ  QGN  V      + TP S+QQ+AYKFT   +EA+R+G+QTP+G ELLK+AS +
Sbjct: 2  SNNGQ--QGNGQVP-----QLTPPSLQQLAYKFTTLVDEAQRVGVQTPEGLELLKKASKV 54

Query: 65 KAVYDAY 71
          KA+Y+ Y
Sbjct: 55 KAIYETY 61

>KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} similar
           to uniprot|Q03761 Saccharomyces cerevisiae YDR145W,
          Length = 511

 Score =  387 bits (994), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/499 (44%), Positives = 288/499 (57%), Gaps = 48/499 (9%)

Query: 23  QRFTPESMQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAYXXX-------- 74
           Q  TP SMQQ+A +     NEAKRIG+ T +G+ELL+QA+ IKA+Y+AY           
Sbjct: 11  QNLTPASMQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQRQQQAQAQ 70

Query: 75  XXXXXGFDQNXXXXXXXXXXXXXXXXXRAPNGTAT-NTISSNIQNLLTPQQNEAYGRLIQ 133
                  + N                 +    TA+ N +++NI+ LLTPQQ EAY RL+Q
Sbjct: 71  AGAQGAVNNNATNVKSMDQQQQQQQQQQQQQATASSNNVTNNIKVLLTPQQREAYNRLVQ 130

Query: 134 SSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEILNKLKGFSASYVA 193
              ++G+ IKGE+ +LKR I +LD EI+ R G+  +V+QLE N+ E+L K++  SA Y  
Sbjct: 131 KYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALSAQYST 190

Query: 194 LNQKLREDKKKFYIECAATNPNLKRFLQASTQQQR---------ANSAT----------- 233
           L QK +ED++KFYIEC+ TN +L+R+LQA  Q+           AN+ T           
Sbjct: 191 LQQKYQEDRRKFYIECSQTNADLRRYLQAQQQKANAAKSQGTVAANAGTPGPQAGVSTPG 250

Query: 234 SQNASPLPTNSNGNQTSS---------------XXXXXXXXXXXXXXNGTPGQTRSAASS 278
           +   +P+PT+ N   + S                             +       +A+  
Sbjct: 251 TNTGTPIPTSLNKASSGSPPNAMAQRQNIPIQKTAATTATATNANPSSAAAAPNNTASDK 310

Query: 279 RSPTQVTSVXXXXXXXXXXXXXXRRAIFKQPNPSVPVSETITQKMPTLMVN-RSNRPTIT 337
            SP QVT+V              R  IFKQPNPS+P+SE +T   PT+ V+ RSNRPTIT
Sbjct: 311 SSPMQVTTVNAAANQTAQSNT--RPPIFKQPNPSIPISENVTAS-PTVSVSYRSNRPTIT 367

Query: 338 GGSAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXX 397
           GGS MNA ALTTPVMTKLPPYEVD ERVMSKRKLRELVK+V                   
Sbjct: 368 GGSGMNAPALTTPVMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETTIDGDVEELL 427

Query: 398 XXXXXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNP 457
                 FITNVT+FAC+LAKHRKSD+LDVRDIQ+HLERNWNIRIPG+A DE+RST+KWNP
Sbjct: 428 LDLADDFITNVTNFACKLAKHRKSDSLDVRDIQMHLERNWNIRIPGFANDEIRSTKKWNP 487

Query: 458 TASYNQKLQGINSARVSKT 476
           T SYNQ +  IN+ + ++T
Sbjct: 488 TPSYNQMVNAINNNKTART 506

>KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON}
           Anc_8.323 YDR145W
          Length = 484

 Score =  347 bits (891), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/452 (43%), Positives = 258/452 (57%), Gaps = 29/452 (6%)

Query: 30  MQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAYXXXXXXXXGFDQNXXXXX 89
           + +++ +F     EAK++G  TP+G+EL+ QAS +KA+YD Y           Q      
Sbjct: 28  LMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYNKQKQEAMAQAQARNNNA 87

Query: 90  XXXXXXXXXXXXRAPNGTATNTISSN-----IQNLLTPQQNEAYGRLIQSSNENGEKIKG 144
                            T+  + SS      I+  LTP+QN+ Y +L+Q+       IK 
Sbjct: 88  NTANVNSSSSANSTEANTSGRSGSSAQFATLIRQALTPEQNQQYDKLVQNFQTRANNIKD 147

Query: 145 EYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEILNKLKGFSASYVALNQKLREDKKK 204
           ++T+LK+ I+ L  EI+K + D A  KQL+  + E++  LK  S  Y  L Q+    KK 
Sbjct: 148 KHTFLKQNIDRLVQEIEK-QTDAAAKKQLDEKRIELMTNLKAISVEYTNLQQQYNNGKKA 206

Query: 205 FYIECAATNPNLKRFLQASTQ--QQRANSATSQNASPLPTNSNGNQTSSXXXXXXXXXXX 262
           FYIECA  NP+L+R LQ STQ  QQ+A S  +Q   P+ T +                  
Sbjct: 207 FYIECAKKNPDLQRLLQKSTQRVQQQAASPNAQQQPPVKTEAQPQPQPQQQ--------- 257

Query: 263 XXXNGTPGQTRS-----AASSRSPTQVTSVXXXXXXXXXXXXXXRRAIFKQPNPSVPVSE 317
                TP Q+ S     A+  RS +Q+T+V              +  IFKQ +P+VP+SE
Sbjct: 258 ----ATPSQSSSNANLAASKPRSQSQITNVNAAASNSSSSN---KSVIFKQSDPAVPISE 310

Query: 318 TITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKS 377
           +I+ K P  +  R NRPTI+GGSAMNAAAL TP+MTKLPPYE+D ERVMSKRKLRELVK+
Sbjct: 311 SISSKTPIPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELDTERVMSKRKLRELVKT 370

Query: 378 VXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNW 437
           +                         F+TNVTSFAC+LAKHRKSDNL+ +DIQLHLERNW
Sbjct: 371 IGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACKLAKHRKSDNLETKDIQLHLERNW 430

Query: 438 NIRIPGYAADEVRSTRKWNPTASYNQKLQGIN 469
           NIRIPGY+ADE+RSTRKWNPT SYNQKLQ IN
Sbjct: 431 NIRIPGYSADEIRSTRKWNPTQSYNQKLQSIN 462

>TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.323
           YDR145W
          Length = 510

 Score =  337 bits (865), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 208/495 (42%), Positives = 270/495 (54%), Gaps = 42/495 (8%)

Query: 14  NNNVQGSPAQRFTPESMQ--QMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAY 71
           N+  +GS +Q    +  Q  ++  KF    NEAK +G  TP+G+ELL +AS IKA+YD Y
Sbjct: 9   NSTAEGSASQGIGGQQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDNY 68

Query: 72  -XXXXXXXXGFDQ--NXXXXXXXXXXXXXXXXXRAPNGTATNT-------------ISSN 115
                     F Q  N                  A N   +++             +++ 
Sbjct: 69  NRQRQQAAQAFVQGRNGGTPGANPASSGSTGSVGAVNAAGSSSSGSSQQSRSSGSQLANI 128

Query: 116 IQNLLTPQQNEAYGRLIQSSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEA 175
           I+ +LTP+QN+ +  L Q+       I+ ++T+LK+ IE L+ E+ K+  D +  KQLE 
Sbjct: 129 IKQVLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSKQT-DASAKKQLEE 187

Query: 176 NKAEILNKLKGFSASYVALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANSATSQ 235
            K E+ N LK  +  Y AL Q+ +  KKKFY+ECA  NP L+R LQ STQQQR       
Sbjct: 188 KKTELANNLKMLNMEYGALQQEFQNGKKKFYVECARHNPALQRLLQRSTQQQRMAQQQQV 247

Query: 236 NASPLPTNSNGNQTSSXXXXXXXXXXXXXXNGTPG-----------QTRSAASS-----R 279
             S       G+                   GTP            Q RS ++S     R
Sbjct: 248 QPS------EGSPAGEAGSPGAAGNSAKAQQGTPANITTQKLPQQNQVRSQSTSSNTGSR 301

Query: 280 SPTQVTSVXXXXXXXXXXXXXXRRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGG 339
           + +QVT+V              + AIFKQ +P VP+SET+T K P+ +  ++NRPT+TGG
Sbjct: 302 AQSQVTNVNAAASMAYNNGAN-KSAIFKQSDPLVPISETVTAKTPSPVTYKTNRPTLTGG 360

Query: 340 SAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXX 399
           +AMNAAAL TP MTKLPPYEVD ERVMSKRKLRELVK+V                     
Sbjct: 361 TAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDVESLLLD 420

Query: 400 XXXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTA 459
               F++NVT FACRLAKHRKSDNLD RDIQLHLERNWNIRIPGY+ADE+RSTRKWNP  
Sbjct: 421 LADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKP 480

Query: 460 SYNQKLQGINSARVS 474
           SYNQK+Q INS + +
Sbjct: 481 SYNQKMQAINSDKAT 495

>Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W
           (REAL)
          Length = 525

 Score =  320 bits (821), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 203/510 (39%), Positives = 264/510 (51%), Gaps = 39/510 (7%)

Query: 1   MSANSNSGQPIQGNNNVQG-----SPAQR---FTPESMQQMAYKFTQCFNEAKRIGLQTP 52
           MS+N+ +   I GNN   G     + AQ+     P  +Q+M  KFT    EA+ +G  TP
Sbjct: 1   MSSNTENTAGIGGNNTSTGNASAATAAQQNMVLQPRQLQEMTAKFTALLTEARNVGETTP 60

Query: 53  QGQELLKQASHIKAVYDA-------------YXXXXXXXXGFDQNXXXXXXXXXXXXXXX 99
           +G+EL+ QA+ IK VYDA             Y          + N               
Sbjct: 61  RGKELMFQAAKIKQVYDALTLNKRRQQAAQAYRNASMGNTNSNSNNPVTMSTEKTSNSSQ 120

Query: 100 XXRAPNGTA-----TNTISSNIQNLLTPQQNEAYGRLIQSSNENGEKIKGEYTYLKRQIE 154
             +  +        +N  SS I+ +LTP++N+ Y +L Q+       IK + T+LK+ I+
Sbjct: 121 QHQQQHQQQQTRNNSNKFSSMIKQVLTPEENQEYEKLWQNFQARHTSIKEKETFLKQNID 180

Query: 155 ILDGEIKKREGDPATVKQLEANKAEILNKLKGFSASYVALNQKLREDKKKFYIECAATNP 214
            L+ EI K+  + A  +QL+  K E+LN  K     Y  L    +  KK FY+ECA  NP
Sbjct: 181 RLEQEINKQTEEGAK-QQLQEKKNELLNDWKVLKIEYTKLFNSYQNSKKTFYVECARHNP 239

Query: 215 NLKRFLQASTQQQRANSATSQNASPLPTNSNGN-----QTSSXXXXXXXXXXXXXXNGTP 269
            L +FLQ STQQQR      Q                 + SS              N  P
Sbjct: 240 ALHKFLQESTQQQRVQQQRVQQQQHQGQTPTNTSTNSTEISSTTALDASKPQQQQQNTLP 299

Query: 270 GQTRSAASSRSP------TQVTSVXXXXXXXXXXXXXXRRAIFKQPNPSVPVSETITQKM 323
           G      +  +P       +VT+V              + AIFKQ  P++P+SE I+ K 
Sbjct: 300 GTNTPRGNGNAPQTEQSKAKVTNVNATASMMNNVSSS-KSAIFKQTEPAIPISENISAKA 358

Query: 324 PTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVXXXXX 383
           P  +  RSNRPTITGGSAMNA+AL TP  TKLPPYE+D +RVMSKRKLRELVK+V     
Sbjct: 359 PAPVAYRSNRPTITGGSAMNASALNTPAATKLPPYEMDTQRVMSKRKLRELVKTVGIDEG 418

Query: 384 XXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPG 443
                               F+TNVT+F+CRLAKHR+SDNL+ RDIQLHLERNWNIRIPG
Sbjct: 419 DGETVIDGDVEELLLDLADDFVTNVTAFSCRLAKHRRSDNLEARDIQLHLERNWNIRIPG 478

Query: 444 YAADEVRSTRKWNPTASYNQKLQGINSARV 473
           Y+ADE+RSTRKWNP+ SYNQKLQ I S +V
Sbjct: 479 YSADEIRSTRKWNPSQSYNQKLQSITSDKV 508

>Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W
           (REAL)
          Length = 535

 Score =  317 bits (813), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 193/487 (39%), Positives = 258/487 (52%), Gaps = 41/487 (8%)

Query: 27  PESMQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAYXXXXXXXXGF----D 82
           P  +Q+M  KF     EA+ +G  TP+G+EL+ QA+ IK VYDA               +
Sbjct: 35  PRQLQEMTAKFRALLIEARNVGETTPRGKELMFQAAKIKQVYDALTLNKRRQQAAQAYKN 94

Query: 83  QNXXXXXXXXXXXXXXXXXRAPNGTA-------------TNTISSNIQNLLTPQQNEAYG 129
            +                 +APN +              +N  S+ I+ +LTP++N+ Y 
Sbjct: 95  ASMGNANPNPSNLASLPTDKAPNPSQQQQQQQQQQARNNSNKFSNMIKQVLTPEENQEYE 154

Query: 130 RLIQSSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEILNKLKGFSA 189
           +L Q+       IK    +LK+ ++ L+ EI K + D  T +QLE  K E+LN  K    
Sbjct: 155 KLWQNFQVRHTSIKEREAFLKQNVDRLEQEINK-QTDEGTKQQLEEKKNELLNDWKVLKI 213

Query: 190 SYVALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANS------------------ 231
            Y  L    +  KK FY+ECA  NP L +FLQ STQQQR                     
Sbjct: 214 EYTKLFNSYQNSKKTFYVECARHNPALHKFLQESTQQQRVQQQRAQQQQQQQQLHIQGQN 273

Query: 232 ---ATSQNASPLPTNSNGNQTSSXXXXXXXXXXXXXXNGTP-GQTRSAASSRSPTQVTSV 287
               ++ N++  P+ +  + + +                TP G   +  + +S  +VT+V
Sbjct: 274 QVKTSTTNSTETPSTAALDASKAQEQQQQQHQNPLPVTNTPKGNINAPQTEQSKAKVTNV 333

Query: 288 XXXXXXXXXXXXXXRRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAAL 347
                         + AIFKQ  P++P+SE I+ K P  +  RSNRPT+TGGSAMNA+AL
Sbjct: 334 NATASMMSNVSAN-KSAIFKQTEPAIPISENISTKAPAPVAYRSNRPTVTGGSAMNASAL 392

Query: 348 TTPVMTKLPPYEVDNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITN 407
            TPV TKLPPYE+D +RVMSKRKLRELVK+V                         F+TN
Sbjct: 393 NTPVTTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDVEDLLLDLADDFVTN 452

Query: 408 VTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQG 467
           VT+FACRLAKHRKSDNL+ RDIQLHLERNWNIRIPGY+ADE+RSTRKWNP+ SYNQKLQ 
Sbjct: 453 VTAFACRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQN 512

Query: 468 INSARVS 474
           I S +V+
Sbjct: 513 ITSDKVA 519

>YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subunit
           (61/68 kDa) of TFIID and SAGA complexes, involved in RNA
           polymerase II transcription initiation and in chromatin
           modification, similar to histone H2A
          Length = 539

 Score =  317 bits (812), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 193/494 (39%), Positives = 255/494 (51%), Gaps = 51/494 (10%)

Query: 27  PESMQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAYXXXXXXXXGFDQNXX 86
           P  +Q+MA KF     EA+ +G  TP+G+EL+ QA+ IK VYDA                
Sbjct: 35  PRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRQQAAQAYNN 94

Query: 87  XXXXXXXXXXXXXXXRAPNGTA------------TNTISSNIQNLLTPQQNEAYGRLIQS 134
                            PN +             +N  S+ I+ +LTP++N+ Y +L Q+
Sbjct: 95  TSNSNSSNPASIPTENVPNSSQQQQQQQQQTRNNSNKFSNMIKQVLTPEENQEYEKLWQN 154

Query: 135 SNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEILNKLKGFSASYVAL 194
                  IK + TYLK+ I+ L+ EI K + D    +QL+  K E+LN  K     Y  L
Sbjct: 155 FQVRHTSIKEKETYLKQNIDRLEQEINK-QTDEGPKQQLQEKKIELLNDWKVLKIEYTKL 213

Query: 195 NQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANSA---------------------- 232
               +  KK FY+ECA  NP L +FLQ STQQQR                          
Sbjct: 214 FNNYQNSKKTFYVECARHNPALHKFLQESTQQQRVQQQRVQQQQQQQQQQQQQQQQQQQQ 273

Query: 233 ------------TSQNASPLPTNSNGNQTSSXXXXXXXXXXXXXXNGTPGQTRSAASSRS 280
                       +S N++ +P+ +  +   S              N   G   ++ + +S
Sbjct: 274 QQQRQGQNQRKISSSNSTEIPSVTGPDALKSQQQQQNTITAT---NNPRGNVNTSQTEQS 330

Query: 281 PTQVTSVXXXXXXXXXXXXXXRRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGS 340
             +VT+V              + AIFKQ  P++P+SE I+ K P  +  RSNRPTITGGS
Sbjct: 331 KAKVTNVNATASMLNNISSS-KSAIFKQTEPAIPISENISTKTPAPVAYRSNRPTITGGS 389

Query: 341 AMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXX 400
           AMNA+AL TP  TKLPPYE+D +RVMSKRKLRELVK+V                      
Sbjct: 390 AMNASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDL 449

Query: 401 XXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTAS 460
              F+TNVT+F+CRLAKHRKSDNL+ RDIQLHLERNWNIRIPGY+ADE+RSTRKWNP+ +
Sbjct: 450 ADDFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQN 509

Query: 461 YNQKLQGINSARVS 474
           YNQKLQ I S +V+
Sbjct: 510 YNQKLQSITSDKVA 523

>NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.323
           YDR145W
          Length = 519

 Score =  312 bits (800), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 194/484 (40%), Positives = 257/484 (53%), Gaps = 42/484 (8%)

Query: 27  PESMQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAYXXXXXXXXGF----- 81
           P  ++++  KF    NEAK +G  T +G+ELL QAS +KA+YD Y               
Sbjct: 23  PNQIRELTAKFKALVNEAKEVGENTQRGKELLIQASKLKAMYDNYNRQRQQQLQQQQAVN 82

Query: 82  --------DQNXXXXXXXXXXXXXXXXXRAPNGTATNTISSNIQNLLTPQQNEAYGRLIQ 133
                   + N                    + +++  +++ ++ +LT +QN  + +L Q
Sbjct: 83  NKVQNPSNNDNVTTNNSFASPSSPPTSGSTISNSSSTQLANIMRQVLTDEQNANFDKLDQ 142

Query: 134 SSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEILNKLKGFSASYVA 193
           +       +K ++T+LK+ IE L  EI K+  +    KQLE  + E+L  LK  +  +  
Sbjct: 143 TFRSRASALKDKHTFLKQNIERLTQEINKQADNVNARKQLEEKRGELLRNLKAITMEHNT 202

Query: 194 LNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANSATSQNASP-------------- 239
           L QK +  KK FYIECA TNP+L++ LQ STQ Q+   A  Q                  
Sbjct: 203 LYQKYQNGKKAFYIECAKTNPDLQKLLQKSTQHQQQRLAQQQQQQQQQQQQQQQNVTQGQ 262

Query: 240 LPT-----------NSNGNQTSSXXXXXXXXXXXXXXNGTPGQTRSAASSRSPTQVTSVX 288
           +PT               + TS               N TP  T S  + +S  QVT+V 
Sbjct: 263 VPTANPVQHQPQPQPQPMDHTSMNRTNSSATSMTQKTN-TPNTTISDNAQKS--QVTNVN 319

Query: 289 XXXXXXXXXXXXXRRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALT 348
                        ++ IFKQ +P VPVS+TI+ K P  +  RSNRPT+TGGSAM+A+AL 
Sbjct: 320 AAASMSDSSNSS-KQTIFKQSDPMVPVSDTISTKQPIAVPYRSNRPTMTGGSAMSASALN 378

Query: 349 TPVMTKLPPYEVDNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNV 408
           TPVMTKLPPYE+D ERVMSKRKLRELVKS+                         FITNV
Sbjct: 379 TPVMTKLPPYELDTERVMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDMADDFITNV 438

Query: 409 TSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGI 468
           TSFACRLAKHRKSDNL+ RDIQLHLERNW+IRIPGY+ADE+RS RKWNP  +YNQKLQ I
Sbjct: 439 TSFACRLAKHRKSDNLEARDIQLHLERNWDIRIPGYSADEIRSIRKWNPAQTYNQKLQQI 498

Query: 469 NSAR 472
           N+ +
Sbjct: 499 NNDK 502

>Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa]
           {ON} YDR145W (REAL)
          Length = 541

 Score =  238 bits (606), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 112/170 (65%), Positives = 128/170 (75%)

Query: 305 IFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNER 364
           IFKQ  P++P+SE I+ K P  +  RSNRPTITGGSAMNA AL TPV TKLPPYE+D +R
Sbjct: 356 IFKQTEPAIPISENISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQR 415

Query: 365 VMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDNL 424
           VMSKRKLRELVK+V                         F+TNVT+FACRLAKHRKSDNL
Sbjct: 416 VMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLADDFVTNVTAFACRLAKHRKSDNL 475

Query: 425 DVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSARVS 474
           + RDIQLHLERNWNIRIPGY+ADE+RSTRKWNP+ SYNQKLQ INS +V+
Sbjct: 476 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDKVA 525

 Score = 98.6 bits (244), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 71/222 (31%), Positives = 109/222 (49%), Gaps = 15/222 (6%)

Query: 17  VQGSPAQRFTPESMQ--QMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAYXXX 74
           V  +P Q    +  Q  +M  KF    +EA+ +G  TP+G+EL+ QA+ IK+VYDA+   
Sbjct: 23  VAAAPQQNMMLQQKQLLEMTVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNRR 82

Query: 75  XXXXXGFDQNXXXXXXX--XXXXXXXXXXRAPNGTA----------TNTISSNIQNLLTP 122
                   +N                   + P+ +           +N  S+ I+ +LT 
Sbjct: 83  RQQAAQAYKNASVGNTTPNAGNPVSLPTEKPPSLSQQQQQQQARSNSNKFSNMIKQVLTS 142

Query: 123 QQNEAYGRLIQSSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEILN 182
           ++N+ Y +L Q+       +K + T+LK+ I+ L  E+ K + D AT KQLE  K E+LN
Sbjct: 143 EENQQYEKLWQNFQVRATSMKEKDTFLKQNIDRLVQEVNK-QTDEATKKQLEDKKNELLN 201

Query: 183 KLKGFSASYVALNQKLREDKKKFYIECAATNPNLKRFLQAST 224
             K     Y  L +  +  KK FY+ECA  NP L++FLQ ST
Sbjct: 202 NRKVLGIEYNNLLKGFQNSKKTFYVECARHNPALQKFLQEST 243

>ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some
           similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 558

 Score =  237 bits (605), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 109/171 (63%), Positives = 128/171 (74%)

Query: 302 RRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEVD 361
           + AIFKQ +P VP+SE +T K P+ +  +SNRPT+TGG+AMNA+ L TP +TKLPPYEVD
Sbjct: 366 KSAIFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVD 425

Query: 362 NERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKS 421
            ERVMSKRKLRELVK+V                         F+TNVT FACRLAKHRKS
Sbjct: 426 TERVMSKRKLRELVKTVGIDDGDGETVIDGDVEELLLDLADDFVTNVTGFACRLAKHRKS 485

Query: 422 DNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSAR 472
           DNLD RDIQLHLERNWNIRIPGY+ADE+RSTRKWNP+ SYNQK+Q IN+ +
Sbjct: 486 DNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDK 536

 Score =  102 bits (254), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/217 (31%), Positives = 103/217 (47%), Gaps = 27/217 (12%)

Query: 30  MQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAYXXXXXXXXGFDQNXXXXX 89
           + ++  KF Q   E+K +G  T +G+ELL QAS IKAVY  Y                  
Sbjct: 39  LLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSRQRQQA----AQAYEQA 94

Query: 90  XXXXXXXXXXXXRAPNGTAT----------------------NTISSNIQNLLTPQQNEA 127
                        A +G +T                      + +++ I+ +LTP+QN+ 
Sbjct: 95  RNGAAAGGSTPQSAGSGVSTVPAGSQSTGGSSSSGGQSTGGGSQLANIIKQVLTPEQNQQ 154

Query: 128 YGRLIQSSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEILNKLKGF 187
           Y  L+Q+       I+ ++ +L++ +E L+ EI K+  +PA  KQLE  K E+L  LK  
Sbjct: 155 YDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKT-EPAAKKQLEDKKMELLTNLKSL 213

Query: 188 SASYVALNQKLREDKKKFYIECAATNPNLKRFLQAST 224
           +  Y  L Q+    KKKFY+ECA  NP L+R LQ ST
Sbjct: 214 NMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250

>Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON}
           (145534..147291) [1758 nt, 586 aa]
          Length = 585

 Score =  233 bits (593), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 112/198 (56%), Positives = 138/198 (69%), Gaps = 1/198 (0%)

Query: 275 AASSRSPTQVTSVXXXXXXXXXXXXXXRRAIFKQPNPSVPVSETITQKMPTLMVNRSNRP 334
           +A+S + +QVT+V              + AIFKQ +PSVP+SE+IT K P  +   SNRP
Sbjct: 368 SATSANRSQVTNVNATASSANKNIQS-KSAIFKQSDPSVPISESITVKAPEAVSYISNRP 426

Query: 335 TITGGSAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVXXXXXXXXXXXXXXXX 394
           ++TGG+AMNA+ L TP +TKLPPYE+D ERVMSKRKLREL+KSV                
Sbjct: 427 SLTGGTAMNASVLNTPTITKLPPYEIDTERVMSKRKLRELIKSVGIDEGDGETVIDGDVE 486

Query: 395 XXXXXXXXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRK 454
                    F+TNVTSFACRLAKHRKSD+L+ RDIQLHLERNWNIRIPGY+ DE+RSTRK
Sbjct: 487 ELLLDLADDFVTNVTSFACRLAKHRKSDSLEARDIQLHLERNWNIRIPGYSGDEIRSTRK 546

Query: 455 WNPTASYNQKLQGINSAR 472
           W PT SY+QK+Q IN+ +
Sbjct: 547 WIPTQSYSQKMQSINNEK 564

 Score =  111 bits (277), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/210 (32%), Positives = 103/210 (49%), Gaps = 23/210 (10%)

Query: 36  KFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAYXXXXXX--------XXGFDQN--- 84
           KF +  NEAKR+G  T +G+ELL QAS++KAVYD Y                G  Q    
Sbjct: 33  KFKELVNEAKRVGQNTQRGKELLIQASNLKAVYDNYNKQRQALINQQQQQQAGSSQTPAG 92

Query: 85  -----------XXXXXXXXXXXXXXXXXRAPNGTATNTISSNIQNLLTPQQNEAYGRLIQ 133
                                          N +  + ++  I+ +LTP++N+ Y +L+Q
Sbjct: 93  TTNNADAASSSSAPAAAGASGANGTRKTAVANASGGSQLADLIKQVLTPEENQQYDKLLQ 152

Query: 134 SSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEILNKLKGFSASYVA 193
           +       IK ++T+LK+ I+ L  EI + + D A  KQLE N+AE+L  L+  +  Y  
Sbjct: 153 NFQSRASSIKDQHTFLKQHIDRLSQEINQ-QTDEAAKKQLEVNRAELLTNLRTLNTEYSN 211

Query: 194 LNQKLREDKKKFYIECAATNPNLKRFLQAS 223
           L + ++  KK FY+ECA  NP L+R LQ S
Sbjct: 212 LYEDIKNKKKAFYVECARQNPELQRLLQKS 241

>CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {ON}
           similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145w TAF61
          Length = 575

 Score =  217 bits (552), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 122/171 (71%)

Query: 302 RRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEVD 361
           + +IFK  +P+VP+++T++ K P  +  RSNRPTI+ GSAMNAAAL TPVMT LPPYE+D
Sbjct: 383 KSSIFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEID 442

Query: 362 NERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKS 421
            +RVMSKRKLRELVKS+                         F+TNVT FACRLAKHRKS
Sbjct: 443 TDRVMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDLADDFVTNVTGFACRLAKHRKS 502

Query: 422 DNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSAR 472
           DNL+  DIQLHLERNWNIRIPGY+ADE+RS  KWN + +Y QKL  IN+ +
Sbjct: 503 DNLEPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADK 553

 Score =  102 bits (254), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 109/211 (51%), Gaps = 17/211 (8%)

Query: 30  MQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAYXXXXXXXXGFDQ------ 83
           +Q++  +F Q   EAK++G  TP+G+ELL QA+ +KAVY+ Y           Q      
Sbjct: 35  IQELTARFKQLVTEAKKVGETTPRGKELLLQAAKLKAVYENYTRRQQALARAQQLQQQGS 94

Query: 84  NXXXXXXXXXXXXXXXXXRAPNGTATNT----------ISSNIQNLLTPQQNEAYGRLIQ 133
           N                    +G+A+ +          +++ I+ +LTP+QN+ Y +L+Q
Sbjct: 95  NTNAAASSGSSTTGTTGTANSSGSASTSGNNSSNSSAQLANIIKQVLTPEQNQQYEQLLQ 154

Query: 134 SSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEILNKLKGFSASYVA 193
           +       IK ++T++K+ I+ L  EI K+  + A  KQL   K E+L  +K     + A
Sbjct: 155 NFQVRASAIKDKHTFIKQNIDRLVVEINKQTDEEAK-KQLNEKKTELLRNIKAIRLEHQA 213

Query: 194 LNQKLREDKKKFYIECAATNPNLKRFLQAST 224
           L Q+L+  KK FY+ECA  NP L+R LQ ST
Sbjct: 214 LQQELQNGKKNFYLECARQNPALQRLLQRST 244

>NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {ON}
           Anc_8.323 YDR145W
          Length = 638

 Score =  218 bits (556), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 124/171 (72%)

Query: 302 RRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEVD 361
           +  +FK   P V +S+TI+ K P  +  RSNRP++TGGSAMNA+ALTTPV TKLPPYE+D
Sbjct: 436 KSIMFKPAEPIVNISDTISTKQPISVPYRSNRPSLTGGSAMNASALTTPVATKLPPYEID 495

Query: 362 NERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKS 421
            ERVMSKRKLRELVKS+                         F+TNVTSFACRLAKHR S
Sbjct: 496 TERVMSKRKLRELVKSIGVDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRNS 555

Query: 422 DNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSAR 472
           D+L+ RDIQLHLE+NWNIRIPGY+ADE+RS RKW+P  +YNQKLQ IN+ +
Sbjct: 556 DSLEPRDIQLHLEKNWNIRIPGYSADEIRSIRKWHPIQNYNQKLQHINNDK 606

 Score = 95.9 bits (237), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 101/240 (42%), Gaps = 40/240 (16%)

Query: 18  QGSPAQRFTPESMQQMAYKFTQCFNEAKRIGLQTPQ-GQELLKQASHIKAVYDAYXXXXX 76
           QG P     P  + +++ KF    NEAK++G    Q G+ELL QAS IKA+YD Y     
Sbjct: 29  QGGPPITLQPNQVIELSNKFKALVNEAKQLGGDNSQRGKELLIQASKIKAIYDTYNRQRQ 88

Query: 77  XXXGFDQNXXXXXXXXXXXXXXXXXRAPNGTATNT------------------------- 111
                                      P  TA N                          
Sbjct: 89  AAAAAAAAQARVQAQVQVQSSDVNKELPTSTANNNNIGATPSANTPTPNSIPISNSNTPS 148

Query: 112 ---------ISSN-----IQNLLTPQQNEAYGRLIQSSNENGEKIKGEYTYLKRQIEILD 157
                    +SSN     ++ +LTP+QN+ Y +L+ +       IK +++++K+ IE L 
Sbjct: 149 SLNANNGNRLSSNQLASIMKQVLTPEQNQEYDKLVSTFQTRAAAIKEKHSFVKQNIERLS 208

Query: 158 GEIKKREGDPATVKQLEANKAEILNKLKGFSASYVALNQKLREDKKKFYIECAATNPNLK 217
            E+ K   DP    QLE  K E+ N ++  +  +  L+Q+ +  +K FY+ECA  NP L+
Sbjct: 209 QELNKPNLDPNLKTQLENKKTELFNTIRAITVEHNTLHQQFQTGQKTFYVECAKNNPALQ 268

>TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {ON}
           Anc_8.323 YDR145W
          Length = 540

 Score =  213 bits (542), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 97/171 (56%), Positives = 125/171 (73%)

Query: 302 RRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEVD 361
           +  IFKQ +P+VP+S+ +T +   L+  +SNRP++TGG+AM+AAAL  P +T LPPYE+D
Sbjct: 351 KSVIFKQSDPTVPISDNVTLEPTELIPYKSNRPSLTGGAAMSAAALNVPPLTTLPPYEID 410

Query: 362 NERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKS 421
            ERVM+KRKLREL+K+V                         F+TNVTSFACRLAKHRKS
Sbjct: 411 TERVMAKRKLRELIKNVGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRKS 470

Query: 422 DNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSAR 472
           +NL+ RDIQLHLERNWNIRIPGY+ DE+RSTRKW PT +++QKLQ IN+ +
Sbjct: 471 ENLESRDIQLHLERNWNIRIPGYSGDEIRSTRKWLPTQAFSQKLQSINNDK 521

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 98/229 (42%), Gaps = 38/229 (16%)

Query: 30  MQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAYXXXXXXXXGFDQNXXXXX 89
           + ++  KF Q  NEAK +G  TP+G+ELL QAS +KA+Y+ +           Q      
Sbjct: 30  LIELTNKFKQLVNEAKAVGENTPRGKELLIQASKLKAIYENFTKQRQAQIQQLQQQQLQQ 89

Query: 90  XXXXXXXXXXXXRA-PNGTATNTISSNIQN------------------------------ 118
                          PN  A+N  ++NI N                              
Sbjct: 90  QQLQQQQQQTQNAIRPNTNASNVSNANIVNQSTPVGATPVSTTSSTPNTNTSSNSSTQIA 149

Query: 119 -----LLTPQQNEAYGRLIQSSNENGEKIKGEYTYLKRQIEILDGEI--KKREGDPATVK 171
                +LT +QN+ Y  L+++       IK ++ +LK+ I+ L  EI       D    K
Sbjct: 150 NIIKQILTAEQNQQYDNLVKNFLAKRTSIKDKHAFLKQNIDKLTQEINNNSNNNDVNVKK 209

Query: 172 QLEANKAEILNKLKGFSASYVALNQKLREDKKKFYIECAATNPNLKRFL 220
            LE  + E++  LK  S  +  ++++ + DKK FY+ECA  NP L++ L
Sbjct: 210 NLEIKRNELITNLKQLSLEFSKIHEEFKNDKKTFYVECAKQNPALQKLL 258

>TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.323
           YDR145W
          Length = 752

 Score =  212 bits (539), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 95/170 (55%), Positives = 122/170 (71%)

Query: 305 IFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNER 364
           IFKQ  P +P+SE +T K+P  +  R+NRPT+TGG+AMN + L TPV+TKLPPYE+D +R
Sbjct: 566 IFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQR 625

Query: 365 VMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDNL 424
           VM KRKL+E+V+SV                         F+T+VT+FAC++AKHRKSD+L
Sbjct: 626 VMLKRKLKEVVRSVGVDDGDGETVIGGDVEEALLDLADNFVTSVTTFACKIAKHRKSDSL 685

Query: 425 DVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSARVS 474
           DV DIQLHLE+NWNIRIP Y+ D +RS+RKWNPTASYNQKL  +N  + S
Sbjct: 686 DVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQKLNSLNPGKGS 735

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 60/110 (54%)

Query: 116 IQNLLTPQQNEAYGRLIQSSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEA 175
           I+ LLTP+QN+ Y +L+ +       IK ++ +LK+ I     E+ K         +LE 
Sbjct: 234 IKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDRVKLEK 293

Query: 176 NKAEILNKLKGFSASYVALNQKLREDKKKFYIECAATNPNLKRFLQASTQ 225
            K E+++ LK  S  Y  L Q+ +  KK FYI CA  NPNL+R LQ ++ 
Sbjct: 294 KKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTSH 343

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 27/42 (64%)

Query: 30  MQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAY 71
           + ++  KF    NEAK++G  T +G+ELL QA  IK +YD +
Sbjct: 61  LMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNF 102

>KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {ON}
           Anc_8.323 YDR145W
          Length = 508

 Score =  200 bits (509), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 116/173 (67%)

Query: 302 RRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEVD 361
           +  IFK+  PSVP+ E+I    P  +  + NRPTITGGS MNA AL TPV  K+P YE D
Sbjct: 320 KHKIFKESEPSVPIPESIDTVQPAQVAYKVNRPTITGGSGMNAPALNTPVNVKIPVYEAD 379

Query: 362 NERVMSKRKLRELVKSVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKS 421
            +RV+SKRKLRELV++V                         F+++VT+FACRLAKHR S
Sbjct: 380 TDRVLSKRKLRELVRTVGVDEGDGETVMDGDVEQLLLDLADDFVSDVTAFACRLAKHRGS 439

Query: 422 DNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSARVS 474
           D+L+ RD+QLHLERNWNIR+PGYA DE+RSTRKWN T++Y+QKL  I   R +
Sbjct: 440 DSLEARDVQLHLERNWNIRLPGYATDEIRSTRKWNGTSAYHQKLNAIAQDRTA 492

>TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {ON}
           Anc_8.323 YDR145W
          Length = 405

 Score =  117 bits (293), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 75/116 (64%), Gaps = 1/116 (0%)

Query: 358 YEVDNERVMSKRKLRELVKSVXXXXXXXXXXXXX-XXXXXXXXXXXXFITNVTSFACRLA 416
           YE+++ERV+SKRKLRELV+SV                          F++N+TSF+CRL+
Sbjct: 274 YELNSERVLSKRKLRELVRSVSIDEHDEKDLSIDGDVEELLLDMADEFVSNITSFSCRLS 333

Query: 417 KHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSAR 472
           +HR S+ ++ RDIQLH+ERNWNIR+PG+ ADE++S +KW  +  Y   L  +N A+
Sbjct: 334 RHRNSNMVNKRDIQLHVERNWNIRVPGFNADEIKSAKKWQSSNVYMHYLNSVNLAK 389

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 66/124 (53%), Gaps = 11/124 (8%)

Query: 112 ISSNIQNLLTPQQNEAYGRLIQSSNENGEKIKGEYTYLKRQIE----ILDGEIKKREGDP 167
           +S  I+N LTP+QNE+Y  L++       KIK E++ +K +I+    +L+ +   +E   
Sbjct: 107 LSMMIKNALTPEQNESYETLLKDFQIRAAKIKREHSDVKEKIDNISKLLNSKTNNQEA-- 164

Query: 168 ATVKQLEANKAEILNKLKGFSASYVALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQ 227
                L A + E L +LK  S  Y  L+Q+ + +KK FY++ A  N  L++ LQ S    
Sbjct: 165 -----LTAKRNEYLFQLKKLSKDYTELHQQFQNEKKNFYLKSAKQNSELQKVLQESHTSA 219

Query: 228 RANS 231
           R  S
Sbjct: 220 RTQS 223

>KNAG0C01270 Chr3 (245114..257437) [12324 bp, 4107 aa] {ON} Anc_1.216
            YKR054C
          Length = 4107

 Score = 33.5 bits (75), Expect = 1.5,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 32/51 (62%), Gaps = 4/51 (7%)

Query: 131  LIQSSNENGEKIKGEYTYLKRQIEILDGEIKKREGD----PATVKQLEANK 177
            +++   +N E++KG+Y+ L R  E++  E++K EGD     A V++L + K
Sbjct: 3245 MVEDLKQNVEQLKGKYSSLIRDTELIKSELEKVEGDLGRSVALVEKLASEK 3295

>Kwal_33.14525 s33 complement(706024..706926) [903 bp, 300 aa] {ON}
           YNL166C (BNI5) - bud neck protein [contig 102] FULL
          Length = 300

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%)

Query: 303 RAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAA 346
           R ++++P PS P S + T K PT        P + GG A ++AA
Sbjct: 145 RPLYQEPAPSAPSSVSTTPKAPTPPSPAVTLPKVRGGPAASSAA 188

>KLTH0D15554g Chr4 (1284597..1284968) [372 bp, 123 aa] {ON} similar
           to uniprot|P32463 Saccharomyces cerevisiae YKL192C ACP1
           Mitochondrial matrix acyl carrier protein involved in
           biosynthesis of octanoate which is a precursor to lipoic
           acid activated by phosphopantetheinylation catalyzed by
           Ppt2p
          Length = 123

 Score = 30.4 bits (67), Expect = 4.4,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 405 ITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRS 451
           ITN T FA    K    D+LD  ++ + +E  ++I IP   ADE++S
Sbjct: 66  ITNDTHFA----KDLGLDSLDTVELLVAIEEEFDIEIPDKVADEIKS 108

>Kwal_47.17140 s47 complement(269893..270264) [372 bp, 123 aa] {ON}
           YKL192C (ACP1) - mitochondrial acyl carrier protein
           [contig 212] FULL
          Length = 123

 Score = 30.4 bits (67), Expect = 4.6,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 405 ITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRK 454
           ITN T FA    K    D+LD  ++ + +E  ++I IP   ADE++S ++
Sbjct: 66  ITNDTHFA----KDLGLDSLDTVELLVAIEEEFDIEIPDKVADEIKSVKE 111

>YLR403W Chr12 (925568..927619) [2052 bp, 683 aa] {ON}
           SFP1Regulates transcription of ribosomal protein and
           biogenesis genes; regulates response to nutrients and
           stress, G2/M transitions during mitotic cell cycle and
           DNA-damage response, and modulates cell size; regulated
           by TORC1 and Mrs6p; sequence of zinc finger, ChIP
           localization data, and protein-binding microarray (PBM)
           data, and computational analyses suggest it binds DNA
           directly at highly active RP genes and indirectly
           through Rap1p at others; can form the [ISP+] prion
          Length = 683

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 4/71 (5%)

Query: 185 KGFSAS----YVALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANSATSQNASPL 240
           +G+S S    Y A    L +   K Y  C  + P L   L+   +   + S  + N S +
Sbjct: 178 RGYSISPQIAYTAYLPNLEKQYCKDYSCCGLSLPGLHDLLRHYEEAHISTSPNTTNMSQI 237

Query: 241 PTNSNGNQTSS 251
           P NS GN +SS
Sbjct: 238 PMNSAGNTSSS 248

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.124    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,083,588
Number of extensions: 1612664
Number of successful extensions: 5465
Number of sequences better than 10.0: 66
Number of HSP's gapped: 5626
Number of HSP's successfully gapped: 86
Length of query: 499
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 385
Effective length of database: 40,409,475
Effective search space: 15557647875
Effective search space used: 15557647875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)