Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.239148.322ON26526514170.0
KLTH0G12320g8.322ON2542438171e-110
SAKL0H15576g8.322ON2822595991e-76
TDEL0F044808.322ON2602585702e-72
Ecym_42538.322ON2582525432e-68
AGL194C8.322ON2562485171e-64
KLLA0D16346g8.322ON3012565184e-64
Kpol_1036.688.322ON2562485032e-62
TPHA0C008208.322ON2662645032e-62
ZYRO0F10362g8.322ON2512534996e-62
KAFR0H022708.322ON2682584964e-61
YLR128W (DCN1)8.322ON2692524608e-56
KNAG0G024408.322ON2652554477e-54
CAGL0M04257g8.322ON2732654461e-53
NDAI0G025908.322ON2862864402e-52
TBLA0A039308.322ON2662614312e-51
NCAS0C032708.322ON1841793712e-43
Suva_10.2218.322ON1781783397e-39
Skud_12.1978.322ON1791783363e-38
Smik_12.1918.322ON1251232242e-22
Ecym_46987.377ON39437910.005
NDAI0E042507.377ON39363810.091
CAGL0E06138g6.257ON188351770.40
SAKL0F12078g7.377ON38537750.43
KAFR0L016607.377ON37941740.69
ZYRO0E07766g6.257ON190851731.1
Smik_2.587.377ON42539711.7
KLLA0C15983g6.257ON189351702.4
Skud_16.476.257ON188351702.5
Kpol_1030.377.377ON36353692.5
YPL231W (FAS2)6.257ON188751702.5
Smik_6.4366.257ON188751702.6
Kwal_56.24252singletonOFF94151693.6
Ecym_21586.257ON189051693.7
Suva_16.756.257ON203951684.4
KNAG0D008906.257ON189051684.5
Kpol_1002.246.257ON189151684.6
TDEL0A067006.257ON189751684.7
KLTH0D14894g4.272ON21468664.8
NDAI0F013906.257ON189651684.9
KLTH0H03190g6.257ON189051675.3
NCAS0G012606.257ON189051675.3
YBL058W (SHP1)7.377ON42337666.0
Skud_2.467.377ON42637667.0
TPHA0H018606.257ON188351667.1
KLTH0G02442g3.497ON111340667.5
TBLA0C020106.257ON190648667.7
KAFR0F012006.257ON188848659.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23914
         (265 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W...   550   0.0  
KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315) ...   319   e-110
SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa] ...   235   1e-76
TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa...   224   2e-72
Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa] ...   213   2e-68
AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, ...   203   1e-64
KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 3...   204   4e-64
Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 ...   198   2e-62
TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 ...   198   2e-62
ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 a...   196   6e-62
KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON...   195   4e-61
YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {...   181   8e-56
KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.32...   176   7e-54
CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} simila...   176   1e-53
NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON...   174   2e-52
TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.32...   170   2e-51
NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON...   147   2e-43
Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W...   135   7e-39
Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W...   134   3e-38
Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W...    91   2e-22
Ecym_4698 Chr4 (1366090..1367274) [1185 bp, 394 aa] {ON} similar...    40   0.005
NDAI0E04250 Chr5 complement(956574..957755) [1182 bp, 393 aa] {O...    36   0.091
CAGL0E06138g Chr5 complement(611835..617486) [5652 bp, 1883 aa] ...    34   0.40 
SAKL0F12078g Chr6 complement(940018..941082,941150..941242) [115...    33   0.43 
KAFR0L01660 Chr12 complement(300456..301595) [1140 bp, 379 aa] {...    33   0.69 
ZYRO0E07766g Chr5 complement(604879..610605) [5727 bp, 1908 aa] ...    33   1.1  
Smik_2.58 Chr2 (105336..106613) [1278 bp, 425 aa] {ON} YBL058W (...    32   1.7  
KLLA0C15983g Chr3 (1389936..1395617) [5682 bp, 1893 aa] {ON} sim...    32   2.4  
Skud_16.47 Chr16 (82245..87896) [5652 bp, 1883 aa] {ON} YPL231W ...    32   2.5  
Kpol_1030.37 s1030 (81590..82681) [1092 bp, 363 aa] {ON} (81590....    31   2.5  
YPL231W Chr16 (108652..114315) [5664 bp, 1887 aa] {ON}  FAS2Alph...    32   2.5  
Smik_6.436 Chr6 complement(710034..715697) [5664 bp, 1887 aa] {O...    32   2.6  
Kwal_56.24252 s56 complement(922658..925483) [2826 bp, 941 aa] {...    31   3.6  
Ecym_2158 Chr2 (294821..300493) [5673 bp, 1890 aa] {ON} similar ...    31   3.7  
Suva_16.75 Chr16 (117692..123811) [6120 bp, 2039 aa] {ON} YPL231...    31   4.4  
KNAG0D00890 Chr4 (137292..142964) [5673 bp, 1890 aa] {ON} Anc_6....    31   4.5  
Kpol_1002.24 s1002 (69719..75394) [5676 bp, 1891 aa] {ON} (69719...    31   4.6  
TDEL0A06700 Chr1 complement(1169248..1174941) [5694 bp, 1897 aa]...    31   4.7  
KLTH0D14894g Chr4 (1219403..1220047) [645 bp, 214 aa] {ON} weakl...    30   4.8  
NDAI0F01390 Chr6 (340262..345952) [5691 bp, 1896 aa] {ON} Anc_6....    31   4.9  
KLTH0H03190g Chr8 (281852..287524) [5673 bp, 1890 aa] {ON} highl...    30   5.3  
NCAS0G01260 Chr7 (222367..228039) [5673 bp, 1890 aa] {ON} Anc_6....    30   5.3  
YBL058W Chr2 (111437..112708) [1272 bp, 423 aa] {ON}  SHP1UBX (u...    30   6.0  
Skud_2.46 Chr2 (95087..96367) [1281 bp, 426 aa] {ON} YBL058W (REAL)    30   7.0  
TPHA0H01860 Chr8 complement(430105..435756) [5652 bp, 1883 aa] {...    30   7.1  
KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] ...    30   7.5  
TBLA0C02010 Chr3 complement(469989..475709) [5721 bp, 1906 aa] {...    30   7.7  
KAFR0F01200 Chr6 (225381..231047) [5667 bp, 1888 aa] {ON} Anc_6....    30   9.0  

>Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W -
           Hypothetical ORF [contig 171] FULL
          Length = 265

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/265 (100%), Positives = 265/265 (100%)

Query: 1   MANAQLFMLQRDRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDR 60
           MANAQLFMLQRDRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDR
Sbjct: 1   MANAQLFMLQRDRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDR 60

Query: 61  PYSPELLKVFQKYKSEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISM 120
           PYSPELLKVFQKYKSEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISM
Sbjct: 61  PYSPELLKVFQKYKSEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISM 120

Query: 121 DTFIQSWHDRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETS 180
           DTFIQSWHDRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETS
Sbjct: 121 DTFIQSWHDRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETS 180

Query: 181 IAYWELLFSPAKPYAIKVPQERLQSWIQYLSGEVAKVHRDVWKMFLKFAVAFPDNEALKK 240
           IAYWELLFSPAKPYAIKVPQERLQSWIQYLSGEVAKVHRDVWKMFLKFAVAFPDNEALKK
Sbjct: 181 IAYWELLFSPAKPYAIKVPQERLQSWIQYLSGEVAKVHRDVWKMFLKFAVAFPDNEALKK 240

Query: 241 GYSEDDAWPLVIDEYYEYLVARGDV 265
           GYSEDDAWPLVIDEYYEYLVARGDV
Sbjct: 241 GYSEDDAWPLVIDEYYEYLVARGDV 265

>KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315)
           [765 bp, 254 aa] {ON} similar to uniprot|Q12395
           Saccharomyces cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 254

 Score =  319 bits (817), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 143/243 (58%), Positives = 192/243 (79%), Gaps = 2/243 (0%)

Query: 11  RDRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVF 70
           R++D+EEF+ALTK S+  A+ +LSNNNWAL+YALND+YDTV GGFT+  RP  P+LL +F
Sbjct: 2   RNQDIEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTS--RPPPPQLLTLF 59

Query: 71  QKYKSEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWHDR 130
            +YK  ++++I+  GL RFI DLGL+LEDP TLC+A+ M C+SL + +S + F+Q WHD 
Sbjct: 60  NEYKKGEEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDN 119

Query: 131 LCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIAYWELLFSP 190
           LCEN   +K  VKEL++KLR D +YFE IY++T+TLALEP +KQL LET+IAYW LLF  
Sbjct: 120 LCENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPT 179

Query: 191 AKPYAIKVPQERLQSWIQYLSGEVAKVHRDVWKMFLKFAVAFPDNEALKKGYSEDDAWPL 250
              YAI++PQ+RL SW  +L+  V+++H D+WKMFLKFA  FPDN+ LK+GY+EDDAWP+
Sbjct: 180 DGAYAIQIPQKRLCSWTAFLTRNVSRIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPV 239

Query: 251 VID 253
           +ID
Sbjct: 240 LID 242

>SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 282

 Score =  235 bits (599), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 116/259 (44%), Positives = 170/259 (65%), Gaps = 7/259 (2%)

Query: 5   QLFMLQRDRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRP--Y 62
            L M Q    + EF++LT C+K  A ++LS N+WAL YALN+YYD   GGF  + +P  Y
Sbjct: 20  NLSMAQPKETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFV-NKKPVKY 78

Query: 63  SPELLKVFQKYKSEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDT 122
           S EL++ F KY ++ K  IT+  L ++IEDLG  LED  T+CLAEL++C  + +DI+   
Sbjct: 79  SHELVETFDKY-ADSKRCITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQ 137

Query: 123 FIQSWHDRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIA 182
           F+ SW +  C+N   MK  +++LE++L  D  YF  IYNYT+ L +E  ++ L ++T+  
Sbjct: 138 FLSSWTEHGCKNMIHMKHELQDLEEQLHQDQDYFSHIYNYTYDLIVEESERHLNIDTAAE 197

Query: 183 YWELLFSPAKPYAIKVPQERLQSWIQYLSGEVAK--VHRDVWKMFLKFAVAFPDNEALKK 240
           YWEL F  +  YA+ +   RL++WI++ + +  +  V +D W MFLKF + FPD+E+L +
Sbjct: 198 YWELFFHNSH-YAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIR 256

Query: 241 GYSEDDAWPLVIDEYYEYL 259
           GY E DAWPLV DEYYEY+
Sbjct: 257 GYDEMDAWPLVFDEYYEYM 275

>TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa]
           {ON} Anc_8.322 YLR128W
          Length = 260

 Score =  224 bits (570), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 159/258 (61%), Gaps = 10/258 (3%)

Query: 8   MLQRDRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSP--- 64
           M Q+D  V EFV+LT+C  K A+ FL  N W L+YALNDYYD + GGF   + P++P   
Sbjct: 1   MPQKDDLVSEFVSLTQCESKTAKDFLRRNQWKLEYALNDYYDQMPGGFI--EEPHTPVTY 58

Query: 65  --ELLKVFQKYKSEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDT 122
             ELL ++ KY  ED+N I + G+ + IEDL  +LED VT+CLA+L+ C+ L + IS D 
Sbjct: 59  PEELLALYDKYVLEDQNKIDIDGMIQLIEDLDYKLEDLVTICLAKLLHCTRLADGISKDQ 118

Query: 123 FIQSWHDRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIA 182
           F+ +W+ + C     M+  + +L+ KL TD+ Y   IYNYTF LAL+  ++ L  +T+  
Sbjct: 119 FLHNWYMQGCSTLPQMRHVLDDLDTKLHTDLEYMTDIYNYTFDLALDQNKRDLDTDTAAE 178

Query: 183 YWELLFSPAKPYAIKVPQERLQSWIQYLSGEVAK-VHRDVWKMFLKFAVAFPDNEALKKG 241
           YW L F P    A+ V    L SW+ +L  E    V RD WKM L+F   FP   A+K  
Sbjct: 179 YWRLFFQPGT--AVHVNPALLNSWLAFLDSEQKTVVTRDTWKMLLEFFKQFPSLSAVKTS 236

Query: 242 YSEDDAWPLVIDEYYEYL 259
           Y+E DAWP +IDEYYEYL
Sbjct: 237 YNEADAWPYIIDEYYEYL 254

>Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa]
           {ON} similar to Ashbya gossypii AGL194C 1-intron
          Length = 258

 Score =  213 bits (543), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 164/252 (65%), Gaps = 5/252 (1%)

Query: 13  RDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           + +++F+++T  ++  A++FL++N W+LDYAL+D Y T    +   +R Y  EL   FQ 
Sbjct: 9   KQIKQFMSITSMNRATAEKFLNDNRWSLDYALDDLY-TRGTSYLNTERTYDAELYSTFQN 67

Query: 73  YKSEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWHDRLC 132
           Y SE+   +    L +++ DLG +LEDPVT+CLA+L++  +L  DI  + F+ +W D  C
Sbjct: 68  YASEN-GRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLGC 126

Query: 133 ENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIAYWELLFSPAK 192
            N NDM  ++  L+ KL  D  YF++IY+YTF++A++ +++QL ++T+I+YW LLF    
Sbjct: 127 SNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTLLFLD-H 185

Query: 193 PYAIKVPQERLQSWIQYL--SGEVAKVHRDVWKMFLKFAVAFPDNEALKKGYSEDDAWPL 250
            +A K+P+ RL+SW ++L    +   V RD W M  KFA+ FPD++ L   YSE  AWPL
Sbjct: 186 SFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEMGAWPL 245

Query: 251 VIDEYYEYLVAR 262
           ++DEYY ++  R
Sbjct: 246 IMDEYYGWIKER 257

>AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, 256
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR128W (DCN1); 1-intron
          Length = 256

 Score =  203 bits (517), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 151/248 (60%), Gaps = 5/248 (2%)

Query: 15  VEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQKYK 74
           + EF+A+T  +   A+ +L  N+W+LD+AL+D+Y    GG   +   YS EL+  F++Y 
Sbjct: 11  IREFLAVTSATSAAAETYLERNHWSLDHALDDFYTQSGGGGRAEQ--YSAELVATFERYA 68

Query: 75  SEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWHDRLCEN 134
           +    ++    L R++ DLG +LED  TLCLA L++   L  DIS   F+ +WH   C +
Sbjct: 69  A--GGAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWHGLGCSS 126

Query: 135 FNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIAYWELLFSPAKPY 194
             DM+  V  LE +LRTD +YF ++Y YTF L L+   ++L +ET+IAYW L F     Y
Sbjct: 127 LPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSLFFLD-HTY 185

Query: 195 AIKVPQERLQSWIQYLSGEVAKVHRDVWKMFLKFAVAFPDNEALKKGYSEDDAWPLVIDE 254
           A+ VP  RL+SW ++L      V RD W MF +FA  FPD+  L + Y+E  +WPLVIDE
Sbjct: 186 AVTVPAPRLRSWFEFLRAGDHSVSRDTWDMFPRFAQRFPDDTELLEHYNELASWPLVIDE 245

Query: 255 YYEYLVAR 262
           YYE++  R
Sbjct: 246 YYEWVKGR 253

>KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 301
           aa] {ON} similar to uniprot|Q12395 Saccharomyces
           cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 301

 Score =  204 bits (518), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 102/256 (39%), Positives = 160/256 (62%), Gaps = 20/256 (7%)

Query: 16  EEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVH--GGFTTDDRPYSPELLKVFQKY 73
           +EF+ LT C+  +AQ++L  N   ++YALNDYYD V   GG     + Y+P L+ +F+KY
Sbjct: 48  KEFMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGGMR---QSYNPSLVAIFEKY 104

Query: 74  KSEDKNSITMI-----GLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWH 128
                N ++       GL RFIEDLG+ +EDP+TLCL++++    L + +S + F+ +W 
Sbjct: 105 S----NGVSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWS 160

Query: 129 DRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIAYWELLF 188
           D  C+    MK ++  LE++L TD  YF+SIY+YTF L  +   + L  + +I YW + F
Sbjct: 161 DLCCDTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFF 220

Query: 189 SPAKPYAIKVPQERLQSWIQYLSGEVA-----KVHRDVWKMFLKFAVAFPDNEALKKGYS 243
              K YA+K+ +ERL SW+++++ + +      +  D+W MF KF   +P++E+LK+ Y 
Sbjct: 221 KDNK-YALKISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYD 279

Query: 244 EDDAWPLVIDEYYEYL 259
           E  AWPL+IDEYYE+L
Sbjct: 280 EMAAWPLLIDEYYEFL 295

>Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 aa]
           {ON} (188159..188161,188259..189026) [771 nt, 257 aa]
          Length = 256

 Score =  198 bits (503), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 98/248 (39%), Positives = 153/248 (61%), Gaps = 5/248 (2%)

Query: 15  VEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPE--LLKVFQK 72
            EEF+ LT C KK+A ++L  NNW L+YALN+YYD   G F  ++        L+++F+K
Sbjct: 5   TEEFIGLTNCDKKVATKYLKRNNWNLNYALNEYYDKEVGSFLVEEEVIEYPEELIQIFKK 64

Query: 73  YKSEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWHDRLC 132
           Y +++  SI   G  + I DL  +LED VT+CLAELM C SL   I+ D F+ +W+++ C
Sbjct: 65  YSNDNGESIDTDGFIQLINDLDYQLEDIVTICLAELMHCKSLSLPITKDQFLSTWYEQGC 124

Query: 133 ENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIAYWELLFSPAK 192
                MK+ + +L+ KL+ D+ Y+  IY Y+F L  +  +K +  + +I YW+L FS   
Sbjct: 125 SQLKHMKILLDDLDHKLQNDIRYYTHIYRYSFDLIRDSNEKCIEKDMAIEYWKLFFSSKC 184

Query: 193 PYAIKVPQERLQSWIQYLS-GEVAKVHRDVWKMFLKFAVAFPDNEALKKGYSEDDAWPLV 251
           P  I + + +L SWI++++  E+  + RDVW+  L++   +P  E L K Y+E D WP +
Sbjct: 185 P--ITINELQLNSWIEFINVNEIESITRDVWERLLEYFKKYPTLEILSKNYNELDPWPYI 242

Query: 252 IDEYYEYL 259
           +DEYYE+L
Sbjct: 243 MDEYYEFL 250

>TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 bp,
           266 aa] {ON} Anc_8.322 YLR128W
          Length = 266

 Score =  198 bits (503), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 159/264 (60%), Gaps = 14/264 (5%)

Query: 12  DRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTD-DRPYSPELLKVF 70
           D  V EF  LT  S K+A+++LS N+W L+YALN++YD   GGF  D  R Y  EL+++F
Sbjct: 2   DSIVREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGFVHDVPREYPAELIELF 61

Query: 71  QKYKS----------EDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISM 120
           ++Y +          E+   I   GL +FIEDLG ELED  TLCLA +M C++L + I+ 
Sbjct: 62  ERYNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITR 121

Query: 121 DTFIQSWHDRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETS 180
           + F+++W+++ C N  D+K  ++ + + LR+D++YF  IYNY+F L  E   K + ++T+
Sbjct: 122 NQFLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDTA 181

Query: 181 IAYWELLFSPAKPYAIKVPQERLQSWIQYLSGEVAK-VHRDVWKMFLKFAVAFPDNEALK 239
             YW+L F    P  + + +E+L +W ++L+    K + +D WKM L+F   FP     K
Sbjct: 182 KEYWKLFFGDGTP--LHIEKEQLDNWNKFLTISGKKTITKDEWKMILEFFKKFPTVTEFK 239

Query: 240 KGYSEDDAWPLVIDEYYEYLVARG 263
             Y   D WP ++DEY+EYL   G
Sbjct: 240 DEYDPMDPWPYIMDEYHEYLEENG 263

>ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 251

 Score =  196 bits (499), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 151/253 (59%), Gaps = 8/253 (3%)

Query: 15  VEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQKYK 74
           V  F +L +CS + A+ +L+ +NW ++ ALNDYYD+ H      D+ YSPEL ++F+KY 
Sbjct: 5   VATFKSLAQCSDRTARDYLNTHNWDVNQALNDYYDSEHD----QDQSYSPELPQLFRKYA 60

Query: 75  SEDKNSITMI--GLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWHDRLC 132
               +   M   GL R+I DLG E+++  T+CLA+L+ C  L + I+   F  +W    C
Sbjct: 61  VVTPHGFIMDTDGLIRYIGDLGYEIDNLATICLAQLLHCQRLTDGITEGQFSYNWQQNGC 120

Query: 133 ENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIAYWELLFSPAK 192
            + + M   V+ L+ KLRTD  Y   IYNYTF LAL+P  K L   T++ YW L F+  +
Sbjct: 121 TSLHQMGKLVQRLDHKLRTDQDYTAQIYNYTFELALDPGAKTLETHTAVQYWTLFFATGQ 180

Query: 193 PYAIKVPQERLQSWIQYLSGEVAKVHRDVWKMFLKFAVAFPDNEALKKGYSEDDAWPLVI 252
            Y + V Q+  Q WI ++  E + + RD W+M   F   F + ++++  Y+E DAWP +I
Sbjct: 181 -YPVIVEQQFFQLWISFVQQEQS-ISRDTWRMLFPFFNRFSNLQSVRDNYNEADAWPYII 238

Query: 253 DEYYEYLVARGDV 265
           DE+YEYL  +G++
Sbjct: 239 DEFYEYLADKGEI 251

>KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON}
           Anc_8.322 YLR128W
          Length = 268

 Score =  195 bits (496), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 100/258 (38%), Positives = 159/258 (61%), Gaps = 10/258 (3%)

Query: 15  VEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRP------YSPELLK 68
           +  F+  T+C   +A+++LS N W ++YALND+YD+  GGFT +         Y  EL++
Sbjct: 10  IVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRRAVYPKELVQ 69

Query: 69  VFQKYKSEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWH 128
           +F+ Y SED   I   G+ + I+D GL +ED  T+CLA ++   +LQ+ I  D F+Q   
Sbjct: 70  LFRDYCSED-TYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDFLQYLF 128

Query: 129 DRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLAL--EPQQKQLGLETSIAYWEL 186
           ++ C   ND+K+ +K+L +KL TD +YF +IYN++F L L  + + + + ++ +I YW+L
Sbjct: 129 EQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAIEYWKL 188

Query: 187 LFSPAKPYAIKVPQERLQSWIQYLSGEVAK-VHRDVWKMFLKFAVAFPDNEALKKGYSED 245
            F      ++++  E L  W Q+L+ E  K V +D+W+M L+F   F D E+LK+ Y E+
Sbjct: 189 FFLNESIQSVEISNELLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLESLKESYDEN 248

Query: 246 DAWPLVIDEYYEYLVARG 263
           D WP VIDE+YEYL   G
Sbjct: 249 DPWPFVIDEFYEYLQDTG 266

>YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {ON}
            DCN1Scaffold-type E3 ligase required for cullin
           neddylation and ubiquitin ligase activation; contains a
           ubiquitin-binding domain (UBA) for ubiquitin and Nedd8
           (Rub1p) interaction and a PONY domain involved in cullin
           binding and neddylation
          Length = 269

 Score =  181 bits (460), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 96/252 (38%), Positives = 145/252 (57%), Gaps = 11/252 (4%)

Query: 15  VEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFT----TDDRP--YSPELLK 68
           +E F +LTKC  K+++++L  N+W ++YALNDYYD   G FT    T   P  Y  EL +
Sbjct: 18  IESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEVSTVAHPPVYPKELTQ 77

Query: 69  VFQKYKSEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWH 128
           VF+ Y   + N   +  L +FIE+LG  LED  TLCLA L+    L+E +  + F+ +W 
Sbjct: 78  VFEHYI--NNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWF 135

Query: 129 DRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIAYWELLF 188
            + C   +DM+  +K L+ KL  D+ YF  IYNY F L L+P +K +  +  I YW+L F
Sbjct: 136 MQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFF 195

Query: 189 SPAKPYAIKVPQERLQSWIQYLSGE-VAKVHRDVWKMFLKFAVAFPDNEALKKGYSEDDA 247
            P   Y +++  + L++W ++L  E    + +D W+M L F   +P  + +   Y E  A
Sbjct: 196 QPE--YPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAA 253

Query: 248 WPLVIDEYYEYL 259
           WP +IDE+YE L
Sbjct: 254 WPFIIDEFYECL 265

>KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.322
           YLR128W
          Length = 265

 Score =  176 bits (447), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 99/255 (38%), Positives = 145/255 (56%), Gaps = 12/255 (4%)

Query: 15  VEEFVALTKC-SKKIAQQFLSNNNWALDYALNDYYDTVHGGF--TTDDRP-----YSPEL 66
           + +F+ LT+C  +K A+++L  ++W ++YALND+YD   G F  T  D P     Y PEL
Sbjct: 6   IHDFIELTQCRDRKKAERYLRESHWNVNYALNDFYDKEVGNFFSTYKDVPQDNVVYPPEL 65

Query: 67  LKVFQKYKSEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQS 126
           + VF +Y   +   IT  G+  +I DL L ++D VT+CLA+L+   +L   I+ + F+  
Sbjct: 66  IHVFDQYS--EAGVITFEGMITYIGDLSLSIDDLVTICLAQLLGWENLLAPITREQFLAQ 123

Query: 127 WHDRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIAYWEL 186
           W  + C   N+MK  + +L  KL  D  YF+ IY YTF L +EP Q +L   ++I YW+L
Sbjct: 124 WFLQGCSTINEMKTVLADLNGKLEKDRGYFKEIYMYTFPLLVEPDQNKLDAASTIEYWKL 183

Query: 187 LFSPAKPYAIKVPQERLQSWIQYLS--GEVAKVHRDVWKMFLKFAVAFPDNEALKKGYSE 244
            F   K Y + + QE L  W  YL    E   V  D+WKM  +F   F     +K+GY E
Sbjct: 184 FFDQEKKYPMIIDQELLDPWFVYLGEQSENMSVTEDIWKMVYQFFNRFRSLGDVKQGYDE 243

Query: 245 DDAWPLVIDEYYEYL 259
             AWP++IDE+ EYL
Sbjct: 244 MAAWPILIDEFIEYL 258

>CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} similar
           to uniprot|Q12395 Saccharomyces cerevisiae YLR128w
          Length = 273

 Score =  176 bits (446), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 105/265 (39%), Positives = 151/265 (56%), Gaps = 19/265 (7%)

Query: 15  VEEFVALTKCS-KKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDR-----PYSPELLK 68
           ++ F +LT C+ +  A+++LS NNW ++YALN+YYD   GGFT D        Y  EL+ 
Sbjct: 10  MKTFQSLTSCTDEGKAKRYLSANNWNINYALNEYYDKEVGGFTEDHMIRHQFKYPDELVS 69

Query: 69  VFQKYKS----EDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFI 124
           +F  Y +    +   SIT  GL  +I+DLG  LED VT+ LA  ++C +L+  I+   F+
Sbjct: 70  LFGHYAALIEEDGTQSITPDGLIDYIQDLGYNLEDLVTISLAHFLQCKNLENPITEKQFL 129

Query: 125 QSWHDRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIA-- 182
             W++  C     M+ ++++ E+KL  D  YF +IYNY+F L      KQ  +ET IA  
Sbjct: 130 YFWYNEGCYTLEQMRHYLEDCERKLCNDWKYFTTIYNYSFDL---NASKQGVVETDIAIE 186

Query: 183 YWELLFSPAKPY---AIKVPQERLQSWIQYLSGEVAK-VHRDVWKMFLKFAVAFPDNEAL 238
           YW+L F   +      IKV Q  L  W ++L  E  K +H+D W+M L F   FP  +A+
Sbjct: 187 YWKLFFEENRTKLSGIIKVDQAHLDLWCKFLQDEHKKLIHKDTWQMLLLFFKKFPSLDAI 246

Query: 239 KKGYSEDDAWPLVIDEYYEYLVARG 263
           K  Y+E DAWP  IDE+YEYL  R 
Sbjct: 247 KTEYNEADAWPYTIDEFYEYLEERN 271

>NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON}
           Anc_8.322 YLR128W
          Length = 286

 Score =  174 bits (440), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 154/286 (53%), Gaps = 48/286 (16%)

Query: 28  IAQQFLSNNNWALDYALNDYYDTVHGGFTT-------------DDRPYSPELLKVFQKYK 74
           +A+++LS NNW L+YALN+YYD   G F               D   Y  EL+ +F+KY 
Sbjct: 1   MAKKYLSRNNWRLNYALNEYYDKEIGSFIGDDDDDDGCKTILPDLNKYPQELIALFKKYS 60

Query: 75  SEDKNS----ITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWHDR 130
           S++ +S    I + GL  +I DL   LED VT+CLA+L+ C +L++ I+   F+ +W+ +
Sbjct: 61  SKNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQ 120

Query: 131 LCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALE--------------------- 169
            C     M+  + +L+ KL  D SYF  IYNYTF L ++                     
Sbjct: 121 GCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSN 180

Query: 170 -------PQQK--QLGLETSIAYWELLFSPAKPYAIKVPQERLQSWIQYLSGEVAK-VHR 219
                  P+ K   L +ET+IAYW++ F+  + Y +KV +E L  W Q+L+ E  K + +
Sbjct: 181 DTSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKEITK 240

Query: 220 DVWKMFLKFAVAFPDNEALKKGYSEDDAWPLVIDEYYEYLVARGDV 265
           D W+M L+F   F + E +K+ Y E  AWP +IDE+YEYL   G +
Sbjct: 241 DQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286

>TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.322
           YLR128W
          Length = 266

 Score =  170 bits (431), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 92/261 (35%), Positives = 141/261 (54%), Gaps = 10/261 (3%)

Query: 8   MLQRDRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELL 67
           M+  D+ ++EF++L       AQ++L  N W L+YALND+YD   G F   D     ++L
Sbjct: 1   MMASDQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKIL 60

Query: 68  KV--------FQKYKSEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDIS 119
            +           + + D   +   GL + ++DLG  ++  VTLCLA+L+ C      I 
Sbjct: 61  GIEYVRPLTELYNHYAIDSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPIL 120

Query: 120 MDTFIQSWHDRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLET 179
           +  FI S     C +  D+K  + E + KL+T+  Y+  IY+  F L LE  +K +  ET
Sbjct: 121 LSNFIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSET 180

Query: 180 SIAYWELLFSPAKPYAIKVPQERLQSWIQYLS-GEVAKVHRDVWKMFLKFAVAFPDNEAL 238
           +  YW+L F+  + Y IKV  ++ Q W +YLS   + ++ +D W M L+F   FP    L
Sbjct: 181 AQEYWDLFFA-CQNYPIKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSEL 239

Query: 239 KKGYSEDDAWPLVIDEYYEYL 259
           ++ YSED AWP + DEYYEYL
Sbjct: 240 QRKYSEDSAWPYIFDEYYEYL 260

>NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON}
           Anc_8.322 YLR128W
          Length = 184

 Score =  147 bits (371), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 75/179 (41%), Positives = 109/179 (60%), Gaps = 3/179 (1%)

Query: 83  MIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWHDRLCENFNDMKLHV 142
           M GL  ++ DLGL+LED VT+CL  L+ C ++++DI+ D F+ +W  + C +   MK  +
Sbjct: 1   MDGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVL 60

Query: 143 KELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIAYWELLFSPAKP-YAIKVPQE 201
            +L  KL +D  YF  IYNYTF L  +P  K L +ET++AYW+L   P +  + ++V   
Sbjct: 61  VDLNDKLHSDKQYFIDIYNYTFGLITDP-DKDLEVETAVAYWKLFLQPKEGEFPVRVDPT 119

Query: 202 RLQSWIQYLSGEVAK-VHRDVWKMFLKFAVAFPDNEALKKGYSEDDAWPLVIDEYYEYL 259
            L  W Q+L  E  K + +D W M + F   FP+   +K+GY E  AWP +IDEYYEYL
Sbjct: 120 LLNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYL 178

>Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W
           (REAL)
          Length = 178

 Score =  135 bits (339), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 71/178 (39%), Positives = 102/178 (57%), Gaps = 3/178 (1%)

Query: 83  MIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWHDRLCENFNDMKLHV 142
           M  L +FIEDLG  LED  TLCL  L+    L+E +  +TF+ +W  + C    +MK  V
Sbjct: 1   MDSLIKFIEDLGYNLEDLATLCLVHLLGYKKLEEPLDRETFLSAWFMQGCSTLPNMKKCV 60

Query: 143 KELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIAYWELLFSPAKPYAIKVPQER 202
           K L+ KL  D+ YF  IY+YTF L L+  +K +  E +I YW LLF P  P  I +    
Sbjct: 61  KGLDAKLHEDLQYFTEIYDYTFHLILDTNRKDIDTEEAIQYWTLLFQPEYP--IHMEPGL 118

Query: 203 LQSWIQYLSGEVAK-VHRDVWKMFLKFAVAFPDNEALKKGYSEDDAWPLVIDEYYEYL 259
           L++W ++L  E  + + +D W M L+F   +P   ++   Y E  AWP +IDE+YE+L
Sbjct: 119 LEAWFRFLHDEGKRTITKDAWHMLLQFFKQYPTIRSIIDDYDEAAAWPFIIDEFYEFL 176

>Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W
           (REAL)
          Length = 179

 Score =  134 bits (336), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 101/178 (56%), Gaps = 3/178 (1%)

Query: 83  MIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWHDRLCENFNDMKLHV 142
           M  L +FIEDLG  LED  TLCL +L+   +L+E +  +TF+ +W  + C    DM+  +
Sbjct: 1   MDSLVKFIEDLGYSLEDLATLCLVDLLGYKNLEEPLKRETFLSTWFMQGCSTLPDMQGCI 60

Query: 143 KELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIAYWELLFSPAKPYAIKVPQER 202
           K L+ KL  D+ Y+  +Y+Y F L L+  +K + ++ +I YW L F P  P  + +    
Sbjct: 61  KRLDVKLHEDLQYYTQVYDYAFRLILDSNRKNIDIDDAIQYWTLFFQPVYP--VHIESNL 118

Query: 203 LQSWIQYLSGEVAK-VHRDVWKMFLKFAVAFPDNEALKKGYSEDDAWPLVIDEYYEYL 259
           L+SW  +L  E    + +D W M L F   +   +++  GY E  AWP +IDE+YEYL
Sbjct: 119 LESWFHFLRDEGKTLISKDTWHMLLLFFQQYLTIQSIIDGYDETAAWPFIIDEFYEYL 176

>Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W
           (REAL)
          Length = 125

 Score = 90.9 bits (224), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 70/123 (56%), Gaps = 3/123 (2%)

Query: 138 MKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIAYWELLFSPAKPYAIK 197
           M+  +K L+ KLR ++ YF  IYNYTF L L+  +K + +   I YW+L F P  P  + 
Sbjct: 1   MQECMKRLDIKLRQNLQYFTLIYNYTFHLLLDSYRKDIDINECIQYWKLFFRPEYP--VS 58

Query: 198 VPQERLQSWIQYLSGE-VAKVHRDVWKMFLKFAVAFPDNEALKKGYSEDDAWPLVIDEYY 256
           + Q  L++W ++L  E    +++D W+M L F   +     +   Y E  AWP +IDE+Y
Sbjct: 59  IEQNLLEAWFRFLHDEGKMMINKDTWQMLLVFFKKYSTVREIMDDYDESAAWPFIIDEFY 118

Query: 257 EYL 259
           EYL
Sbjct: 119 EYL 121

>Ecym_4698 Chr4 (1366090..1367274) [1185 bp, 394 aa] {ON} similar
          to Ashbya gossypii ABR211C
          Length = 394

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 26/37 (70%)

Query: 12 DRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYY 48
          D+ +++F+ LT CS  +A QF++ +N  L+ A+N YY
Sbjct: 3  DQQIQQFMTLTNCSADVATQFINKSNGDLEDAINKYY 39

>NDAI0E04250 Chr5 complement(956574..957755) [1182 bp, 393 aa]
          {ON} Anc_7.377 YBL058W
          Length = 393

 Score = 35.8 bits (81), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 12 DRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQ 71
          D D+E+F+ALT  S  IA QFL     +++ A+N Y+ T     TT+D  Y    +   Q
Sbjct: 7  DDDIEQFIALTNSSPAIATQFL-KEFGSVNEAINSYFATQ----TTNDPNYRSPPVSAIQ 61

Query: 72 KYK 74
          + +
Sbjct: 62 RVQ 64

>CAGL0E06138g Chr5 complement(611835..617486) [5652 bp, 1883 aa]
           {ON} highly similar to uniprot|P19097 Saccharomyces
           cerevisiae YPL231w FAS2
          Length = 1883

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%)

Query: 22  TKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           T  S+K A+QF S+ NWA    L+ Y++ +HG     DR    E + +  +
Sbjct: 392 TSFSRKKARQFDSSWNWARQSLLSLYFEIIHGVLKNVDREVVTEAINIMNR 442

>SAKL0F12078g Chr6 complement(940018..941082,941150..941242) [1158
          bp, 385 aa] {ON} similar to uniprot|P34223
          Saccharomyces cerevisiae YBL058W SHP1 UBX (ubiquitin
          regulatory X) domain- containing protein that regulates
          Glc7p phosphatase activity and interacts with Cdc48p
          interacts with ubiquitylated proteins in vivo and is
          required for degradation of a ubiquitylated model
          substrate
          Length = 385

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 12 DRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYY 48
          D+D+++F+ALT  S  +AQQ+L+     L  ALN YY
Sbjct: 3  DQDIQQFIALTNSSFSVAQQYLT-EFGDLSNALNAYY 38

>KAFR0L01660 Chr12 complement(300456..301595) [1140 bp, 379 aa]
          {ON} Anc_7.377 YBL058W
          Length = 379

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 8  MLQRDRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYY 48
          M  + +D+E+FV+LT  S  +A+Q++      L+ ALN YY
Sbjct: 1  MSDQSQDIEQFVSLTSTSSGVAKQYIE-AFGGLESALNAYY 40

>ZYRO0E07766g Chr5 complement(604879..610605) [5727 bp, 1908 aa]
           {ON} highly similar to uniprot|P19097 Saccharomyces
           cerevisiae YPL231W FAS2 Alpha subunit of fatty acid
           synthetase which catalyzes the synthesis of long-chain
           saturated fatty acids contains beta-ketoacyl reductase
           and beta-ketoacyl synthase activities
          Length = 1908

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 22  TKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           T  S+K A+ F S+ NWA    L+ Y++ VHG     DR    E L +  +
Sbjct: 410 TSFSRKKARAFDSSWNWAKQSLLSLYFEIVHGVLKNVDREVVSEALNIMNR 460

>Smik_2.58 Chr2 (105336..106613) [1278 bp, 425 aa] {ON} YBL058W
          (REAL)
          Length = 425

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 12 DRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDT 50
          D  +++F+ALT  S  IA Q+LS     L+ ALN YY T
Sbjct: 6  DESIQQFMALTNVSHNIAVQYLS-EFGNLNEALNSYYAT 43

>KLLA0C15983g Chr3 (1389936..1395617) [5682 bp, 1893 aa] {ON}
           similar to uniprot|P19097 Saccharomyces cerevisiae
           YPL231W FAS2 Alpha subunit of fatty acid synthetase
           which catalyzes the synthesis of long-chain saturated
           fatty acids contains beta-ketoacyl reductase and
           beta-ketoacyl synthase activities
          Length = 1893

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%)

Query: 22  TKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           T  SKK A+ F S+ NWA    L  Y++ +HG     DR    E + +  +
Sbjct: 393 TSFSKKKARVFDSSWNWARQSLLTLYFEIIHGVLKNVDREVVTEAINIMNR 443

>Skud_16.47 Chr16 (82245..87896) [5652 bp, 1883 aa] {ON} YPL231W
           (REAL)
          Length = 1883

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 22  TKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           T  S+K A+ F S+ NWA    L+ Y++ +HG     DR    E + +  +
Sbjct: 388 TSFSRKKARTFDSSWNWAKQSLLSLYFEIIHGVLKNVDREVVSEAINIMNR 438

>Kpol_1030.37 s1030 (81590..82681) [1092 bp, 363 aa] {ON}
          (81590..82681) [1092 nt, 364 aa]
          Length = 363

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%)

Query: 14 DVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPEL 66
          +V++F+A+   S  +A+++L+  N  L  A+N YY       +  +R  SP+L
Sbjct: 5  NVQQFMAMANVSATVAEKYLNEYNGDLGDAINAYYAEQTETRSERNRSTSPKL 57

>YPL231W Chr16 (108652..114315) [5664 bp, 1887 aa] {ON}  FAS2Alpha
           subunit of fatty acid synthetase, which catalyzes the
           synthesis of long-chain saturated fatty acids; contains
           the acyl-carrier protein domain and beta-ketoacyl
           reductase, beta-ketoacyl synthase and
           self-pantetheinylation activities
          Length = 1887

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 22  TKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           T  S+K A+ F S+ NWA    L+ Y++ +HG     DR    E + +  +
Sbjct: 392 TSFSRKKARTFDSSWNWAKQSLLSLYFEIIHGVLKNVDREVVSEAINIMNR 442

>Smik_6.436 Chr6 complement(710034..715697) [5664 bp, 1887 aa] {ON}
           YPL231W (REAL)
          Length = 1887

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 22  TKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           T  S+K A+ F S+ NWA    L+ Y++ +HG     DR    E + +  +
Sbjct: 392 TSFSRKKARTFDSSWNWAKQSLLSLYFEIIHGVLKNVDREVVSEAINIMNR 442

>Kwal_56.24252 s56 complement(922658..925483) [2826 bp, 941 aa]
           {OFF} YPL231W (FAS2) - alpha subunit of fatty acid
           synthase [contig 165] FULL
          Length = 941

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 22  TKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           T  S+K A+ F S+ NWA    L+ Y++ +HG     DR    E + +  +
Sbjct: 393 TSFSRKKARVFDSSWNWAKQSLLSLYFEIIHGVLKNVDRELVAEAINIMNR 443

>Ecym_2158 Chr2 (294821..300493) [5673 bp, 1890 aa] {ON} similar to
           Ashbya gossypii AFL138W
          Length = 1890

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 22  TKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           T  S+K A+ F S+ NWA    L+ Y++ +HG     DR    E + +  +
Sbjct: 394 TSFSRKKARVFDSSWNWARQSLLSLYFEIIHGVLKNVDREVVTEAINIMNR 444

>Suva_16.75 Chr16 (117692..123811) [6120 bp, 2039 aa] {ON} YPL231W
           (REAL)
          Length = 2039

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 22  TKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           T  S+K A+ F S+ NWA    L+ Y++ +HG     DR    E + +  +
Sbjct: 545 TSFSRKKARVFDSSWNWAKQSLLSLYFEIIHGVLKNVDREVVSEAINIMNR 595

>KNAG0D00890 Chr4 (137292..142964) [5673 bp, 1890 aa] {ON} Anc_6.257
           YPL231W
          Length = 1890

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 22  TKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           T+ S+K A+ F S+ NWA    L  Y++ +HG     DR    E + +  +
Sbjct: 396 TQFSRKKARVFDSSWNWAKQSLLQLYFEIIHGVLKNVDREVVSEAINIMNR 446

>Kpol_1002.24 s1002 (69719..75394) [5676 bp, 1891 aa] {ON}
           (69719..75394) [5676 nt, 1892 aa]
          Length = 1891

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 22  TKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           T  S+K A+ F S+ NWA    L+ Y++ +HG     DR    E + +  +
Sbjct: 394 TSFSRKKARIFDSSWNWARQSLLSLYFEIIHGVLKNVDREVVTEAINIMNR 444

>TDEL0A06700 Chr1 complement(1169248..1174941) [5694 bp, 1897 aa]
           {ON} Anc_6.257 YPL231W
          Length = 1897

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 22  TKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           T  S+K A+ F S+ NWA    L+ Y++ +HG     DR    E + +  +
Sbjct: 400 TSFSRKKARVFDSSWNWAKQSLLHLYFEIIHGVLKNVDREVVSEAINIMNR 450

>KLTH0D14894g Chr4 (1219403..1220047) [645 bp, 214 aa] {ON} weakly
           similar to uniprot|Q06070 Saccharomyces cerevisiae
           YLR407W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cell
           periphery
          Length = 214

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 12/68 (17%)

Query: 39  ALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQKYKSEDKNSITMIGLTRFI------ED 92
           ALD   ++ Y+TV+G F T     +       Q+  SE++NS T + LTR +      ++
Sbjct: 35  ALDTESSEEYNTVNGLFDTGPSKGA------SQERTSEERNSSTSVTLTREMPLTDEEDE 88

Query: 93  LGLELEDP 100
           L  E+E+P
Sbjct: 89  LDSEVEEP 96

>NDAI0F01390 Chr6 (340262..345952) [5691 bp, 1896 aa] {ON} Anc_6.257
          Length = 1896

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 22  TKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           T  S+K A+ F S+ NWA    L+ Y++ +HG     DR    E + +  +
Sbjct: 395 TSFSRKKARVFDSSWNWAKQSLLHLYFEIIHGVLKNVDREVVSEAINIMNR 445

>KLTH0H03190g Chr8 (281852..287524) [5673 bp, 1890 aa] {ON} highly
           similar to uniprot|P19097 Saccharomyces cerevisiae
           YPL231W FAS2 Alpha subunit of fatty acid synthetase
           which catalyzes the synthesis of long-chain saturated
           fatty acids contains beta-ketoacyl reductase and
           beta-ketoacyl synthase activities
          Length = 1890

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 22  TKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           T  S+K A+ F S+ NWA    L+ Y++ +HG     DR    E + +  +
Sbjct: 394 TSFSRKKARVFDSSWNWAKQSLLSLYFEIIHGVLKNVDRELVAEAINIMNR 444

>NCAS0G01260 Chr7 (222367..228039) [5673 bp, 1890 aa] {ON} Anc_6.257
          Length = 1890

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 22  TKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           T  S+K A+ F S+ NWA    L+ Y++ +HG     DR    E + +  +
Sbjct: 393 TAFSRKKARVFDSSWNWAKQSLLHLYFEIIHGVLKNIDREVVSEAINIMNR 443

>YBL058W Chr2 (111437..112708) [1272 bp, 423 aa] {ON}  SHP1UBX
          (ubiquitin regulatory X) domain-containing protein that
          regulates Glc7p phosphatase activity and interacts with
          Cdc48p; interacts with ubiquitylated proteins in vivo
          and is required for degradation of a ubiquitylated
          model substrate
          Length = 423

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 12 DRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYY 48
          D  +++F+ALT  S  IA Q+LS     L+ ALN YY
Sbjct: 6  DETIQQFMALTNVSHNIAVQYLS-EFGDLNEALNSYY 41

>Skud_2.46 Chr2 (95087..96367) [1281 bp, 426 aa] {ON} YBL058W
          (REAL)
          Length = 426

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 12 DRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYY 48
          D  +++F+ALT  S  IA Q+LS     L+ ALN YY
Sbjct: 6  DETIQQFMALTNVSHNIAVQYLS-EFGDLNEALNSYY 41

>TPHA0H01860 Chr8 complement(430105..435756) [5652 bp, 1883 aa] {ON}
           Anc_6.257 YPL231W
          Length = 1883

 Score = 30.0 bits (66), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%)

Query: 22  TKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           T  S+K A+ F S+ NWA    L  Y++ +HG     DR    E + +  +
Sbjct: 387 TSFSRKKARVFDSSWNWARQSLLCLYFEVIHGVLKNVDRKVVSEAINIMNR 437

>KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa]
           {ON} similar to uniprot|P53280 Saccharomyces cerevisiae
           YGR134W CAF130 Part of the evolutionarily- conserved
           CCR4- NOT transcriptional regulatory complex involved in
           controlling mRNA initiation elongation and degradation
          Length = 1113

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query: 13  RDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVH 52
           R V+ + + T+    +   FL N+NWALDYA   +Y   H
Sbjct: 101 RMVKRWTSSTEHVGLLMDHFLRNDNWALDYA--SFYSPAH 138

>TBLA0C02010 Chr3 complement(469989..475709) [5721 bp, 1906 aa] {ON}
           Anc_6.257 YPL231W
          Length = 1906

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%)

Query: 25  SKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           S+K A+ F S+ NWA    L+ Y++ +HG     DR    E + +  +
Sbjct: 401 SRKKARVFDSSWNWAKQSLLSLYFEIIHGVLKNVDREVVAEAINIMNR 448

>KAFR0F01200 Chr6 (225381..231047) [5667 bp, 1888 aa] {ON} Anc_6.257
           YPL231W
          Length = 1888

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%)

Query: 25  SKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72
           S+K A+ F S+ NWA    L+ Y++ +HG     DR    E + +  +
Sbjct: 392 SRKKARVFDSSWNWAKQSLLSLYFEIIHGVLKNVDREVVSEAINIMNR 439

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,059,937
Number of extensions: 1404346
Number of successful extensions: 4253
Number of sequences better than 10.0: 68
Number of HSP's gapped: 4335
Number of HSP's successfully gapped: 68
Length of query: 265
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 157
Effective length of database: 41,097,471
Effective search space: 6452302947
Effective search space used: 6452302947
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)