Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.239098.321ON77677640890.0
KLTH0G12342g8.321ON77477425300.0
SAKL0H15598g8.321ON78778218970.0
ZYRO0F10340g8.321ON81880814510.0
YLR127C (APC2)8.321ON85381913781e-178
Smik_12.1908.321ON85081813501e-174
Suva_10.2208.321ON85482213431e-173
Skud_12.1968.321ON85482313431e-173
TDEL0F044708.321ON80979713301e-172
TPHA0C008308.321ON84285111131e-139
CAGL0M04235g8.321ON78376410201e-126
Ecym_42528.321ON6896869751e-120
AGL193W8.321ON7097199431e-116
TBLA0A039208.321ON7327048931e-108
NCAS0C032808.321ON8117938373e-99
KNAG0G024308.321ON7978018198e-97
KAFR0H022808.321ON8178327728e-90
Kpol_YGOB_Anc_8.3218.321ON5115086381e-73
NDAI0G026008.321ON9118846181e-67
KLLA0D16324g8.321ON6976464486e-46
KLLA0C18282g4.138ON7351461010.002
ADR106W7.296ON798141860.12
Skud_15.403.64ON49386790.76
AFR498W4.138ON727101781.2
YOL112W (MSB4)3.64ON49285752.5
TBLA0B087502.402ON105640743.7
NCAS0A051404.138ON759160716.9
Smik_15.403.64ON48885716.9
Suva_6.2861.127ON201477727.1
Suva_15.483.64ON49299708.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23909
         (776 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {...  1579   0.0  
KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} simi...   979   0.0  
SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} simi...   735   0.0  
ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {...   563   0.0  
YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON} ...   535   e-178
Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {...   524   e-174
Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {...   521   e-173
Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {...   521   e-173
TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {O...   516   e-172
TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.3...   433   e-139
CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa] ...   397   e-126
Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}...   380   e-120
AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic ho...   367   e-116
TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {O...   348   e-108
NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.3...   327   3e-99
KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {O...   320   8e-97
KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.3...   301   8e-90
Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 5...   250   1e-73
NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.3...   242   1e-67
KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]...   177   6e-46
KLLA0C18282g Chr3 complement(1614045..1616252) [2208 bp, 735 aa]...    44   0.002
ADR106W Chr4 (894779..897175) [2397 bp, 798 aa] {ON} Syntenic ho...    38   0.12 
Skud_15.40 Chr15 (71837..73318) [1482 bp, 493 aa] {ON} YOL112W (...    35   0.76 
AFR498W Chr6 (1337669..1339852) [2184 bp, 727 aa] {ON} Syntenic ...    35   1.2  
YOL112W Chr15 (106710..108188) [1479 bp, 492 aa] {ON}  MSB4GTPas...    33   2.5  
TBLA0B08750 Chr2 complement(2080873..2084043) [3171 bp, 1056 aa]...    33   3.7  
NCAS0A05140 Chr1 (1021439..1023718) [2280 bp, 759 aa] {ON} Anc_4...    32   6.9  
Smik_15.40 Chr15 (74711..76177) [1467 bp, 488 aa] {ON} YOL112W (...    32   6.9  
Suva_6.286 Chr6 (502176..508220) [6045 bp, 2014 aa] {ON} YJL207C...    32   7.1  
Suva_15.48 Chr15 (84625..86103) [1479 bp, 492 aa] {ON} YOL112W (...    32   8.8  

>Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {ON}
           YLR127C (APC2) - subunit of the anaphase promoting
           complex (APC) [contig 171] FULL
          Length = 776

 Score = 1579 bits (4089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 763/776 (98%), Positives = 763/776 (98%)

Query: 1   MIQRDEGHVLSEQLHELLRGHDITVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKI 60
           MIQRDEGHVLSEQLHELLRGHDITVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKI
Sbjct: 1   MIQRDEGHVLSEQLHELLRGHDITVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKI 60

Query: 61  LINENGNGPALTDILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLFNRE 120
           LINENGNGPALTDILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLFNRE
Sbjct: 61  LINENGNGPALTDILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLFNRE 120

Query: 121 EWAEEINGLRNYLISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLLTHLLV 180
           EWAEEINGLRNYLISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLLTHLLV
Sbjct: 121 EWAEEINGLRNYLISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLLTHLLV 180

Query: 181 DAVLSKVKAFALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTNEIYRC 240
           DAVLSKVKAFALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTNEIYRC
Sbjct: 181 DAVLSKVKAFALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTNEIYRC 240

Query: 241 FEEEFIRIRTQQAFKIFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEARMLNPS 300
           FEEEFIRIRTQQAFKIFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEARMLNPS
Sbjct: 241 FEEEFIRIRTQQAFKIFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEARMLNPS 300

Query: 301 ITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGLDASET 360
           ITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGLDASET
Sbjct: 301 ITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGLDASET 360

Query: 361 RGPKPTGAHASIASQLSAELKDSHQPIFRSALDKSAQSPVDDMASVNPKEPVYQQVINFY 420
           RGPKPTGAHASIASQLSAELKDSHQPIFRSALDKSAQSPVDDMASVNPKEPVYQQVINFY
Sbjct: 361 RGPKPTGAHASIASQLSAELKDSHQPIFRSALDKSAQSPVDDMASVNPKEPVYQQVINFY 420

Query: 421 LHWTPEPSDSIQANNSDTLMNKGLFDIIVELFDSKDIIIGEXXXXXXXXXXXXXGYRLEQ 480
           LHWTPEPSDSIQANNSDTLMNKGLFDIIVELFDSKDIIIGE             GYRLEQ
Sbjct: 421 LHWTPEPSDSIQANNSDTLMNKGLFDIIVELFDSKDIIIGEFLTLFTDKLLDLKGYRLEQ 480

Query: 481 NWVKSLKILKNRFDFKNYSNAQGVSNINNIDVMLRDVKHSEELCAQMHSVPEISREVIPM 540
           NWVKSLKILKNRFDFKNYSNAQGVSNINNIDVMLRDVKHSEELCAQMHSVPEISREVIPM
Sbjct: 481 NWVKSLKILKNRFDFKNYSNAQGVSNINNIDVMLRDVKHSEELCAQMHSVPEISREVIPM 540

Query: 541 FISYLFWNAGSKFSTLPKDCRLPSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLH 600
           FISYLFWNAGSKFSTLPKDCRLPSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLH
Sbjct: 541 FISYLFWNAGSKFSTLPKDCRLPSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLH 600

Query: 601 FADKRVMDFEVSMDKSSVLACVAETTGISRDKIVEATGLEKAQVDQNLRFWLDASVLRFD 660
           FADKRVMDFEVSMDKSSVLACVAETTGISRDKIVEATGLEKAQVDQNLRFWLDASVLRFD
Sbjct: 601 FADKRVMDFEVSMDKSSVLACVAETTGISRDKIVEATGLEKAQVDQNLRFWLDASVLRFD 660

Query: 661 SKTSLYSSLERQDTDNASEREAQMRAEDQARSAFDSQQQQFVESMEKVWPFIRGMLTNLG 720
           SKTSLYSSLERQDTDNASEREAQMRAEDQARSAFDSQQQQFVESMEKVWPFIRGMLTNLG
Sbjct: 661 SKTSLYSSLERQDTDNASEREAQMRAEDQARSAFDSQQQQFVESMEKVWPFIRGMLTNLG 720

Query: 721 TLKVEKIHSFLKVAVPKEIGFNATTAQLEAYLRLLVDENKLVCSANNAFKLVKEPR 776
           TLKVEKIHSFLKVAVPKEIGFNATTAQLEAYLRLLVDENKLVCSANNAFKLVKEPR
Sbjct: 721 TLKVEKIHSFLKVAVPKEIGFNATTAQLEAYLRLLVDENKLVCSANNAFKLVKEPR 776

>KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 774

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/774 (60%), Positives = 589/774 (76%), Gaps = 1/774 (0%)

Query: 1   MIQRDEGHVLSEQLHELLRGHDITVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKI 60
           M   DEG  LSEQLH LL   D +++DDLE +LTW+NPNEP SNHQ+RPPSLR+KSAIK 
Sbjct: 1   MTLSDEGRELSEQLHSLLHDVDSSLEDDLEGILTWVNPNEPGSNHQMRPPSLRVKSAIKS 60

Query: 61  LINENGNGPALTDILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLFNRE 120
           L+N      +  D+L +Y+IFQTRKHFF +Y SL +FKDVQKLERYYEFP R+V +F+ E
Sbjct: 61  LLNGVVTSESFIDLLGKYMIFQTRKHFFLNYQSLLYFKDVQKLERYYEFPTRYVNIFSSE 120

Query: 121 EWAEEINGLRNYLISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLLTHLLV 180
           EW +E++GLRNYLI +N     N +LRL QLV EDDF+MACK+YEWLC+AEGRLL  +LV
Sbjct: 121 EWCDEMSGLRNYLIRQNSGLKNNIQLRLEQLVHEDDFDMACKIYEWLCQAEGRLLPEILV 180

Query: 181 DAVLSKVKAFALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTNEIYRC 240
           D +LSKVK FA K+M  AW++RF  +E YNLF++ YWS   +MLQC EDDH++TNEIYRC
Sbjct: 181 DVLLSKVKLFASKNMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQCMEDDHEITNEIYRC 240

Query: 241 FEEEFIRIRTQQAFKIFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEARMLNPS 300
           FEEEFIRIRT Q F IFVTG+P ++PTLLELRSVLKT  KYT+L+TE L QFE++MLNPS
Sbjct: 241 FEEEFIRIRTSQVFDIFVTGFPTTKPTLLELRSVLKTSVKYTELITEFLYQFESKMLNPS 300

Query: 301 ITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGLDASET 360
           ITTAEILLSYV+AIKSIL +DVSFRYFQLLT+FVRP+LMER DTV TFLYAMLGLDAS+ 
Sbjct: 301 ITTAEILLSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERHDTVATFLYAMLGLDASDL 360

Query: 361 RGPKPTGAHASIASQLSAELKDSHQPIFRSALDKSAQSPVDDMASVNPKEPVYQQVINFY 420
                T  H SIASQLSAEL+ SHQPI  S  ++          S+NP EP YQQ+I++Y
Sbjct: 361 SSKNSTSTHMSIASQLSAELRGSHQPISSSTAERGNLPHGKHALSMNPYEPAYQQIIDYY 420

Query: 421 LHWTPEPSDSIQANNSDTLMNKGLFDIIVELFDSKDIIIGEXXXXXXXXXXXXXGYRLEQ 480
           LHW PEP+DSIQANN   L++K LFDIIVELFDSKD+I+ E             GY+LE 
Sbjct: 421 LHWNPEPADSIQANNDQALISKELFDIIVELFDSKDVIVREFLGLFTRKLLGLRGYKLES 480

Query: 481 NWVKSLKILKNRFDFKNYSNAQGVSNINNIDVMLRDVKHSEELCAQMHSVPEISREVIPM 540
           NWV+SLK++K + DFK YS+AQ  SNINNIDVMLRDVKHSEELC+ MH    +S  +IP 
Sbjct: 481 NWVQSLKVVKKKLDFKTYSSAQEFSNINNIDVMLRDVKHSEELCSLMHEKLGLSDRIIPK 540

Query: 541 FISYLFWNAGSKFSTLPKDCRLPSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLH 600
           F+SYLFWNA S FS LPKD  LP +LE++I  YK  Y  +K GRKLRLH EQS V LQL 
Sbjct: 541 FVSYLFWNAHSDFSALPKDHPLPKELEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLR 600

Query: 601 FADKRVMDFEVSMDKSSVLACVAETTGISRDKIVEATGLEKAQVDQNLRFWLDASVLRFD 660
            AD R +++EV++D++ VL+ ++     + ++IV+ T L+ +QV+++L+FW+ +S+LR+ 
Sbjct: 601 LADGRDLNYEVTLDEALVLSYLSSNGDGTVEEIVKQTNLDISQVEKSLKFWVKSSILRYS 660

Query: 661 SKTSLYSSLERQDTDNASEREAQMRAED-QARSAFDSQQQQFVESMEKVWPFIRGMLTNL 719
           ++TS YS  ERQ+ D     E Q  +E   A  + D QQQQF++SM+KV PFI+GMLTNL
Sbjct: 661 TETSRYSVEERQNVDVKHAVERQSSSEIVNATDSVDLQQQQFIDSMQKVLPFIKGMLTNL 720

Query: 720 GTLKVEKIHSFLKVAVPKEIGFNATTAQLEAYLRLLVDENKLVCSANNAFKLVK 773
           G+LK +KIHSFLK+AVPKEIG++AT +QL+ YL  LV+E+KLV + N AF+L K
Sbjct: 721 GSLKADKIHSFLKMAVPKEIGYSATPSQLQLYLNALVEESKLVKTPNGAFRLAK 774

>SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 787

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/782 (45%), Positives = 527/782 (67%), Gaps = 22/782 (2%)

Query: 10  LSEQLHELLRGHDITVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKILINENGNGP 69
           L+ QL E +  ++  ++D+L+ VLTW+NPNEP SNHQLRPPSLRLK+ IK+++N     P
Sbjct: 10  LNAQLREFVTTYNPNLEDELDGVLTWLNPNEPNSNHQLRPPSLRLKNGIKLVVNNEDVPP 69

Query: 70  ALTDILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLFNREEWAEEINGL 129
               +LRQ+++ QTR HFF+++ S+  FKD+Q+LE+YYEFPL+++ +F  +EW  E+NG 
Sbjct: 70  GFVHLLRQFVLLQTRIHFFSNFNSITSFKDIQRLEKYYEFPLKYINIFTPDEWFIEMNGF 129

Query: 130 RNYLISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLLTHLLVDAVLSKVKA 189
           R+YL+SKN +F  N + R+RQL++EDDF+MA K+Y WL    G  L  LL++ ++ K+  
Sbjct: 130 RHYLMSKNRIFGDNIKHRVRQLIMEDDFDMAWKIYTWLTETMGHQLVSLLLEILMDKIAD 189

Query: 190 FALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTNEIYRCFEEEFIRIR 249
           F+ ++M   W++RF+ +E +N FI+KYWST +Q L+CPEDDH++T EI+ CFE+EF++IR
Sbjct: 190 FSKQNMMGKWTQRFLVMETFNTFITKYWSTFAQALRCPEDDHEITTEIFHCFEKEFVKIR 249

Query: 250 TQQAFKIFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEARMLNPSITTAEILLS 309
           T + ++I V  YP S+P LLELR+V+KT A Y++L+ E LS+FE++++NPS+TT EILLS
Sbjct: 250 TSEIYEICVLEYPHSKPALLELRNVMKTSADYSKLMIEFLSKFESKLMNPSVTTTEILLS 309

Query: 310 YVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGLDASETRGPKPTGAH 369
           Y++ IKS LT+D + RY Q +T +++P+L ERRDTVV  LYAML LD SE         +
Sbjct: 310 YIRTIKSFLTVDPAGRYLQSVTAYIKPYLRERRDTVVHLLYAMLELDESEIDDAN-VSLN 368

Query: 370 ASIASQLSAELKDSHQPIFRSALDKSAQSPV---DDMASVNPKEPVYQQVINFYLHWTPE 426
             I ++LS ELKD    I   A  KS ++ +   D       ++P+ +QV+N++L WTPE
Sbjct: 369 MPILTELSKELKDPDFGI-EDADSKSRKNKLMVTDSSPVFKVEKPLCEQVLNYFLQWTPE 427

Query: 427 PSDSIQANNSDTLMNKGLFDIIVELFDSKDIIIGEXXXXXXXXXXXXXGYRLEQNWVKSL 486
           PSD      ++T +NK L DI++++FDSKD+ I E              Y+LE  W+K L
Sbjct: 428 PSDVAHRKPNNTFVNKSLLDILLDIFDSKDVFISEFLSLFTKKLLGLKYYKLETKWIKIL 487

Query: 487 KILKNRFDFKNYSNA--QGVSNINNIDVMLRDVKHSEELCAQMHSVPEISREVIPMFISY 544
           ++LK +F   ++     Q  SNINNID+MLRDVK S EL ++MH V  +   V P FISY
Sbjct: 488 RLLKKKFGHTSFPQHQFQDTSNINNIDIMLRDVKTSYELISKMHEVAGLDDRVFPKFISY 547

Query: 545 LFWNAGSKFSTLPKDCRLPSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLHFADK 604
           LFWN+  +  T   D +LP  LE+EI KY ++Y+Q+KPGR+L L+++Q TV L L F D 
Sbjct: 548 LFWNSALEAET--SDFQLPGWLETEIEKYSEVYSQLKPGRRLHLYKDQGTVELDLEFKDG 605

Query: 605 RVMDFEVSMDKSSVLACVAETT---GISRDKIVEATGLEKAQVDQNLRFWLDASVLRFDS 661
           R +  EV ++K++V++C  + T   G++ ++IV+   +EKA V   L+FW   + + +D 
Sbjct: 606 RKISCEVPLNKAAVISCFDQDTALKGLAVEQIVDNVKMEKALVTSILQFWCKKNAIYYDD 665

Query: 662 KTSLYSSLERQDTDNA----------SEREAQMRAEDQARSAFDSQQQQFVESMEKVWPF 711
           + + Y  LE  + ++A                +   D   +A D QQQ+F++SM K+WPF
Sbjct: 666 RYNTYRVLEYYEPNSALSASTVISSKGNTNGGINPMDDQDNAGDKQQQEFIQSMSKIWPF 725

Query: 712 IRGMLTNLGTLKVEKIHSFLKVAVPKEIGFNATTAQLEAYLRLLVDENKLVCSANNAFKL 771
           I+GMLTNLG++K EKIHSFLK+AVPK+IG+ AT  QLE+YL +LVDE+KL    N ++KL
Sbjct: 726 IQGMLTNLGSMKPEKIHSFLKMAVPKDIGYTATVNQLESYLNVLVDEDKLAAVPNGSYKL 785

Query: 772 VK 773
           VK
Sbjct: 786 VK 787

>ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {ON}
           similar to uniprot|Q7LGV7 Saccharomyces cerevisiae
           YLR127C
          Length = 818

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/808 (39%), Positives = 468/808 (57%), Gaps = 53/808 (6%)

Query: 13  QLHEL-LRGHDITVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKILIN-------- 63
           Q+ E+ LR H    +DDLES+LTWINPNEP SNHQ +PP+LRLK++IK+L+N        
Sbjct: 17  QIQEVALRTHP-NCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIKMLVNQYYNMELR 75

Query: 64  --ENGNGPALTDILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLFNR-- 119
             E   G     ++RQ+ ++Q R HFFA   +L  FKDVQ+L +YYEFPL++V +F    
Sbjct: 76  EDERDTGYLFIQLVRQFYVYQVRLHFFASLSNLHTFKDVQRLVKYYEFPLKYVYIFENCP 135

Query: 120 EEWAEEINGLRNYLISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLLT-HL 178
           EEW  E +GL +YL++++     N   RL+ LV+EDDF++A  + +WL  +   + +  L
Sbjct: 136 EEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVMEDDFDLAMDVVKWLNESNSNVSSMDL 195

Query: 179 LVDAVLSKVKAFALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTNEIY 238
           ++D ++ K+  F    M   W+ RF+ +E +N FI+ YWS    +L CPED+H++T  +Y
Sbjct: 196 MLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQFCLLLACPEDNHELTTVVY 255

Query: 239 RCFEEEFIRIRTQQAFKIFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEARMLN 298
             FE +F+++RT++ F I V  YP+S+PTLLELR VL     +TQ+V E LS FE ++LN
Sbjct: 256 HLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVLVKSKDFTQIVVEFLSNFERQILN 315

Query: 299 PSITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGLDAS 358
           PSI+T   LL+YVK +K+ LT+D + R    ++ FV+P+  ER D V   LYA+L L + 
Sbjct: 316 PSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERNDLVTVLLYAILELQSE 375

Query: 359 ETRGPKPTGAHASIASQLSAELKD-------SHQPIFRSALDKSAQSPVDDMASVNPKEP 411
           E  GP       +  +QLS ELKD       S + I ++ L     S     A ++P+ P
Sbjct: 376 EFEGPARAYLDTNSLNQLSQELKDPEFGIESSFETIPQADLLSRPASTATTAAMLDPRLP 435

Query: 412 VYQQVINFYLHWTPEPSDSIQANNSDTL-MNKGLFDIIVELFDSKDIIIGEXXXXXXXXX 470
            Y+ VI  +L WTPEP D+I  N S +L  ++ L DI++++F+SKD  + E         
Sbjct: 436 -YKSVIKNFLQWTPEPMDTISKNYSKSLSASRNLLDILMDMFESKDFFVSEFLSLLTRKL 494

Query: 471 XXXXGYRLEQNWVKSLKILKNRFDFKNYSNAQGV------------------SNINNIDV 512
                Y L++ W   L++LK +F     +                       SNINNIDV
Sbjct: 495 LTLKLYTLDRKWSHCLRLLKTKFGPAGAAAVVATGIGGGDGGSIDGVRGGDPSNINNIDV 554

Query: 513 MLRDVKHSEELCAQMHSVPEISREVIPMFISYLFWNAGSKFSTLPKDCRLPSQLESEIRK 572
           MLRDV+ S ELC +MH V  + + + P FIS L+WN  +  S+     +L  Q+  E+ K
Sbjct: 555 MLRDVRGSSELCKRMHQVAGLDQRIYPKFISPLYWNRDN--SSNGWTFQLDPQMALELDK 612

Query: 573 YKDMYAQIKPGRKLRLHQEQSTVVLQLHFADKRVMDFEVSMDKSSVL----ACVAETTGI 628
           Y  +Y++IKPGR L L+++Q  VVL L F D R    E ++++ SV+    A  A TTG+
Sbjct: 613 YCQVYSEIKPGRALHLYKDQGIVVLTLSFQDGRKKRCEATLEQCSVIQQFDASTATTTGL 672

Query: 629 SRDKIVEATGLEKAQVDQNLRFWLDASVLRFDSKTSLYSSLERQDTDNASEREAQM--RA 686
           +   I     ++ A+    L+ W+   VL +D     Y + E  D   A    A     A
Sbjct: 673 TEQMIGARLQMDPARARAALQHWVQEGVLYYDGNA--YKTREYLDDQPAENLPASKDSSA 730

Query: 687 EDQARSAFDSQQQQFVESMEKVWPFIRGMLTNLGTLKVEKIHSFLKVAVPKEIGFNATT- 745
             QAR+    +  +    +E+ WPFI+GMLTNLG LKV+KIHSFLKV  PKE+GF+  T 
Sbjct: 731 SSQARTMSPDRDSRLTSILEQTWPFIQGMLTNLGALKVKKIHSFLKVTTPKELGFSMVTP 790

Query: 746 AQLEAYLRLLVDENKLVCSANNAFKLVK 773
           +QLE+YL  LV+E +L+C+ N+ +KL K
Sbjct: 791 SQLESYLHSLVEEERLICTTNDTYKLPK 818

>YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON}
           APC2Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; component of the catalytic core of the
           APC/C; has similarity to cullin Cdc53p
          Length = 853

 Score =  535 bits (1378), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 303/819 (36%), Positives = 468/819 (57%), Gaps = 75/819 (9%)

Query: 27  DDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKILINENGNGPALTDI------------ 74
           DDL S+LTW++PN+  SNHQLRPPSLR+K+ IK+L   N      + I            
Sbjct: 32  DDLNSLLTWMSPNDAKSNHQLRPPSLRIKNIIKVLFPNNATTSPYSMINTSQANNSIVNE 91

Query: 75  --------------LRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLF--N 118
                         L+++ IFQ R HFF H+ ++ + KD+Q+ E YYEFPLR+V +F  N
Sbjct: 92  GNTNKELQLQLFSTLKEFYIFQVRYHFFLHFNNINYLKDIQRWENYYEFPLRYVPIFDVN 151

Query: 119 REEWAEEINGLRNYLISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLL-TH 177
             +WA E+N LR+YL+++N+ F  N R RL +L+++DDF++A  L +WL  A G L  T 
Sbjct: 152 VNDWALELNSLRHYLLNRNIKFKNNLRTRLDKLIMDDDFDLADNLIQWLKSANGSLSSTE 211

Query: 178 LLVDAVLSKVKAFALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTNEI 237
           L+V+A+ SK+  F   +M   W+KRF+ +E +N FI++YWS  S+++ CPEDDH++T  +
Sbjct: 212 LIVNALYSKINKFCEDNMSRVWNKRFMIMETFNKFINQYWSQFSKLVGCPEDDHELTTTV 271

Query: 238 YRCFEEEFIRIRTQQAFKIFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEARML 297
           + CFE  F+RIRT + F I V  YP+S+ TLLELR ++K    YT +VT  LS F+  +L
Sbjct: 272 FNCFESNFLRIRTNEIFDICVLAYPDSKVTLLELRKIMKDFKDYTNIVTTFLSDFKKYIL 331

Query: 298 NPSITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGLDA 357
           NPS+TT + LL YVK IK+ L +D + R    +T FV+P+  ER+  V   LYAML L  
Sbjct: 332 NPSVTTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAMLDLPE 391

Query: 358 SETRGPKPTGAHASIASQLSAELKDS--HQPIFRSALDKSAQSP------VDDMASVNPK 409
            E +              L   L DS  +Q    +  DK+ +SP      V     +N  
Sbjct: 392 EELKEKINFNVDMKALLSLVDTLHDSDINQDTNITKRDKNKKSPFLWNLKVKGKRELNKD 451

Query: 410 EPV-----YQQVINFYLHWTPEPSDSIQANNSDTLMNKGLFDIIVELFDSKDIIIGEXXX 464
            P+     Y+ ++N+Y+ W PEP+D I  N   + +   LF+++++LF+S++  I E   
Sbjct: 452 LPIRHAMLYEHILNYYIAWVPEPNDMIPGNIKSSYIKTNLFEVLLDLFESREFFISEFRN 511

Query: 465 XXXXXXXXXXGYRLEQNWVKSLKILKN---RFDFKNYSN--AQGV--------------- 504
                      Y L++ W + LK+++    +F   ++SN    G+               
Sbjct: 512 LLTDRLFTLKFYTLDEKWTRCLKLIREKIVKFTETSHSNYITNGILGLLETTAPAADADQ 571

Query: 505 SNINNIDVMLRDVKHSEELCAQMHSVPEISREVIPMFISYLFW--NAGSKFSTLPKDCRL 562
           SN+N+IDVML D+K SEELC +MH V  +   + P FIS L+W  N  ++ S       L
Sbjct: 572 SNLNSIDVMLWDIKCSEELCRKMHEVAGLDPIIFPKFISLLYWKYNCDTQGSN-DLAFHL 630

Query: 563 PSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLHFADKRVMDFEVSMDKSSVL--- 619
           P  LE E++KY D+Y+Q+KPGRKL+L +++  V +QL F D R +  +VS+++ SV+   
Sbjct: 631 PIDLERELQKYSDIYSQLKPGRKLQLCKDKGKVEIQLAFKDGRKLVLDVSLEQCSVINQF 690

Query: 620 -ACVAETTGISRDKIVEATGLEKAQVDQNLRFWLDASVLRFDSKTSLYSSLERQDTD-NA 677
            +   E   +S +++ E+  +   ++   L FW+   VL  ++ T  YS +E  + D + 
Sbjct: 691 DSPNDEPICLSLEQLSESLNIAPPRLTHLLDFWIQKGVLLKENGT--YSVIEHSEMDFDQ 748

Query: 678 SEREAQMRAEDQARSAFDSQ--QQQFVESMEKVWPFIRGMLTNLGTLKVEKIHSFLKVAV 735
           +++ A M  E+      +    ++++  ++++  PFI GMLTNLG +K+ KIHSFLK+ V
Sbjct: 749 AQKTAPMEIENSNYELHNDSEIERKYELTLQRSLPFIEGMLTNLGAMKLHKIHSFLKITV 808

Query: 736 PKEIGFNATT-AQLEAYLRLLVDENKLVCSANNAFKLVK 773
           PK+ G+N  T  QLE YL  L DE +L   AN ++++VK
Sbjct: 809 PKDWGYNRITLQQLEGYLNTLADEGRLKYIANGSYEIVK 847

>Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {ON}
           YLR127C (REAL)
          Length = 850

 Score =  524 bits (1350), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 290/818 (35%), Positives = 465/818 (56%), Gaps = 70/818 (8%)

Query: 24  TVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKIL---------------------- 61
           T+ DDL S+L W +PN+P SNHQLRPPSLR+K+ IK+L                      
Sbjct: 29  TIADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLFPNSASTSPYSVVNTGQTSNSI 88

Query: 62  INENGNGPALT----DILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLF 117
           +NE      L       L++Y IFQ R HFF+H+ ++ + KD+Q+ E YYEFPLR+V +F
Sbjct: 89  VNEGNTNKELQLQLLSTLKEYYIFQVRYHFFSHFENINYLKDIQRWENYYEFPLRYVPIF 148

Query: 118 NRE--EWAEEINGLRNYLISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLL 175
           + +   W+ E+N LR+YL+++N+ F  N R RL +L+++DDF++A  L +WL  A+G L 
Sbjct: 149 DLDINGWSLELNSLRHYLLNRNMKFKNNLRTRLDKLIMDDDFDLADNLIQWLNSADGSLS 208

Query: 176 T-HLLVDAVLSKVKAFALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVT 234
           +  L+V+A+ +K+  F    M   W+KRF+ +E +N FI++YWS  S+++ CPEDDH++T
Sbjct: 209 SMELIVNALFNKINKFCEDTMSGVWNKRFMIMETFNKFINQYWSQFSKLIGCPEDDHELT 268

Query: 235 NEIYRCFEEEFIRIRTQQAFKIFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEA 294
             ++ CFE  F+RIRT++ F I V  YP S+ TLLEL+ ++K    Y  +VT  LS F+ 
Sbjct: 269 TTVFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKKIMKDFKDYANIVTTFLSDFKK 328

Query: 295 RMLNPSITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLG 354
            +LNPSITT + LL YVK IK+ L +D + R    +T FV+P+  ER+  V   LYAML 
Sbjct: 329 YILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVDLLLYAMLD 388

Query: 355 LDASETRGPKPTGAHASIASQLSAELKDSHQPIFRSAL--DKSAQSPV--------DDMA 404
           L   E +              L   L DS    F + +  +K+ + P          +  
Sbjct: 389 LPEEELKEKITFKVDIKALISLVDTLHDSDISQFTNVMKRNKNKKGPFLWNLKVKGKNGP 448

Query: 405 SVNPKEPVYQQVINFYLHWTPEPSDSIQANNSDTLMNKGLFDIIVELFDSKDIIIGEXXX 464
           S   +  +YQ ++N+YL W PEP+D I  +   + +   LF+++++LF+S++  I E   
Sbjct: 449 SPTSQTMIYQHILNYYLTWVPEPNDMIPGSVKSSCIKTNLFEVLLDLFESREFFISEFRN 508

Query: 465 XXXXXXXXXXGYRLEQNWVKSLKILKNR-FDFKNYSNAQGV------------------- 504
                      Y+L+  W + LK+++ +   F+  S+   +                   
Sbjct: 509 LLTDRLFTLKFYKLDDKWTQCLKLIREKVVKFRETSHVNYITNGILGLPETTAPSADADQ 568

Query: 505 SNINNIDVMLRDVKHSEELCAQMHSVPEISREVIPMFISYLFWNAGSKF-STLPKDCRLP 563
           SN+N+IDVML D+K SEELC +MH V  +   + P FIS L+W       S+      LP
Sbjct: 569 SNLNSIDVMLWDIKCSEELCRKMHEVAGLDPAIFPKFISLLYWKYNCDMQSSNELTFHLP 628

Query: 564 SQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLHFADKRVMDFEVSMDKSSVL---- 619
             L+ E++KY D+Y+Q+KPGRKL+L ++Q  V ++L+F D R +  +VS+++ SV+    
Sbjct: 629 IHLKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELNFKDGRKLVLDVSLEQCSVINQFD 688

Query: 620 ACVAETTGISRDKIVEATGLEKAQVDQNLRFWLDASVLRFDSKTSLYSSLERQDTD-NAS 678
           +   ++  ++ +++ ++  +   ++   L FW+   V+    +  +YS +E  +TD +  
Sbjct: 689 STDNKSISLTLEQLSDSLNITPPRLVHLLDFWIQKGVI--SKENGVYSVIENCETDFDKV 746

Query: 679 EREAQMRAEDQARSAFD-SQQQQFVE-SMEKVWPFIRGMLTNLGTLKVEKIHSFLKVAVP 736
            ++  M  E+  R   + S+ ++  E ++++  PFI GML NLG +K+ KIHSFLK+ VP
Sbjct: 747 HKDIPMETENNNRGLRNESEAERKCELTLQRSLPFIEGMLANLGAMKLNKIHSFLKITVP 806

Query: 737 KEIGFN-ATTAQLEAYLRLLVDENKLVCSANNAFKLVK 773
           K+ G+N  +  QLE YL  L DE +L   AN ++++VK
Sbjct: 807 KDWGYNRVSLQQLEQYLSALADEGRLKYIANGSYEIVK 844

>Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score =  521 bits (1343), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 300/822 (36%), Positives = 454/822 (55%), Gaps = 76/822 (9%)

Query: 25  VDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKIL----------------------I 62
           + DDL S+L W++P++P SNHQLRPPSLR+K+ IK L                      +
Sbjct: 30  ITDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPNNACTSSYGAMNTAQANNSIV 89

Query: 63  NENGNGPAL----TDILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLF- 117
           NE      L        ++Y IFQ R HFF H+ S+ + KD+Q+ E YYEFPLR+V +F 
Sbjct: 90  NEGNTNKELQLQFISTFKEYYIFQVRYHFFLHFSSINYLKDIQRWENYYEFPLRYVSIFD 149

Query: 118 -NREEWAEEINGLRNYLISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLLT 176
            N   W  E+N LR+YL+++N  F  N R RL +L+++DDF++A  L  WL  A G L +
Sbjct: 150 LNVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLIIDDDFDLASNLIRWLNSANGSLSS 209

Query: 177 -HLLVDAVLSKVKAFALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTN 235
             L+V+A+  K+  F   +M   W+KRF+ +E +N FI++YWS  S+++ CPEDDH++T 
Sbjct: 210 MDLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFINQYWSQFSELIGCPEDDHELTT 269

Query: 236 EIYRCFEEEFIRIRTQQAFKIFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEAR 295
            ++ CFE  F+RIRT++ F I V  YP S+ TLLEL+ ++K    YT +VT  LS F+  
Sbjct: 270 TVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIMKDFKDYTNIVTTFLSDFKKH 329

Query: 296 MLNPSITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGL 355
           +LNPSITT + LLSYVK IK+ L +D + R    +T FV+P+  ER+  V   LYA+L L
Sbjct: 330 ILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAILDL 389

Query: 356 DASETRGPKPTGAHASIASQLSAELKDS------HQPIFRSALDKSAQSPVD-------- 401
              E +              L   L DS      + P  +   +K    P +        
Sbjct: 390 PEEELKEKISFKVDMKALLLLVETLHDSDIDQITNTPKSKDK-NKGGSFPWNLHVKGKKE 448

Query: 402 -DMASVNPKEPVYQQVINFYLHWTPEPSDSIQANNSDTLMNKGLFDIIVELFDSKDIIIG 460
            + +S   +  +Y+ ++N+YL W PEP+D I  N   + +   LF+++++LF+S++  I 
Sbjct: 449 KNGSSSITQSMLYEHILNYYLTWVPEPNDMIPGNIKSSSIKTNLFEVLLDLFESREFFIS 508

Query: 461 EXXXXXXXXXXXXXGYRLEQNWVKSLKILKNRFDFKNYSN-----AQGV----------- 504
           E              Y+L+  W + LK+++ +      +N     A G+           
Sbjct: 509 EFRNLLTDRLFTLKFYKLDNKWSRCLKLIREKIVKSTETNQTNYIANGIIGLPQTTAPAA 568

Query: 505 ----SNINNIDVMLRDVKHSEELCAQMHSVPEISREVIPMFISYLFW-NAGSKFSTLPKD 559
               SNIN+IDVML D+K SEELC +MH V  +   + P FIS L+W + G   +     
Sbjct: 569 DADLSNINSIDVMLWDIKCSEELCLKMHEVAGLDPAIYPKFISLLYWKHNGDTNNANELT 628

Query: 560 CRLPSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLHFADKRVMDFEVSMDKSSVL 619
             LP  LE+E++KY D+Y+Q+KPGRKL+L ++Q  + ++L F D R +  +VS+++ SV+
Sbjct: 629 FHLPGNLENELQKYSDIYSQLKPGRKLQLCKDQGKIEMELDFNDGRKLVLDVSLEQCSVI 688

Query: 620 ACVAETTG----ISRDKIVEATGLEKAQVDQNLRFWLDASVLRFDSKTSLYSSLERQDTD 675
                T G    +S +++ E   +  A++   L FW+   VL    +  +YS +E   TD
Sbjct: 689 NQFNSTDGEPIYLSLEQLSEPLNIAPARLLDLLNFWIQRGVL--SEENGVYSVIEYSRTD 746

Query: 676 -NASEREAQMRAEDQARSAFDSQ--QQQFVESMEKVWPFIRGMLTNLGTLKVEKIHSFLK 732
            N ++ E  M+ E+      D    +++    +E+  PFI GML NLG +K+ KIHSFLK
Sbjct: 747 FNQTQIEFPMKNENNNNELRDETEVERKCELILERSLPFIEGMLANLGAMKLNKIHSFLK 806

Query: 733 VAVPKEIGFNATT-AQLEAYLRLLVDENKLVCSANNAFKLVK 773
           + VPK  G+N  T  QLE YL +L DE KL    N +++L K
Sbjct: 807 ITVPKNWGYNRITLLQLEKYLNVLADEGKLKYITNGSYELEK 848

>Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score =  521 bits (1343), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 298/823 (36%), Positives = 463/823 (56%), Gaps = 76/823 (9%)

Query: 24  TVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKILINEN------------------ 65
            + DDL S+L W++PN+P SNHQLRPPSLR+K+ IK+L   N                  
Sbjct: 29  NIADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPNNVSTSSYGVINSGQTINAV 88

Query: 66  -GNGPA-------LTDILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLF 117
            G G         L   L++Y +FQ R HFF  +  + + KD+Q+ E YYEFPLR+V +F
Sbjct: 89  AGEGNTNKELQLQLLSTLKEYYVFQVRYHFFLRFNDIIYLKDIQRWENYYEFPLRYVPIF 148

Query: 118 NR--EEWAEEINGLRNYLISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLL 175
           +    +W+ E+N LR+Y++++N+ F  N R+RL +L+++DDF++A  L  WL  A G L 
Sbjct: 149 DLSVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIMDDDFDLAGNLIRWLNFANGSLS 208

Query: 176 T-HLLVDAVLSKVKAFALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVT 234
           +  L+V+A+ +K++ F   +M   W+KRF+ +E +N FI++YWS   +++ CPEDDH++T
Sbjct: 209 SMELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFINQYWSQFCELICCPEDDHELT 268

Query: 235 NEIYRCFEEEFIRIRTQQAFKIFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEA 294
             ++ CFE  F+RIRT++ F I V  YP+S+  LLEL+ ++K    YT +VT+ LS F+ 
Sbjct: 269 TTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKIMKDFKDYTNIVTKFLSDFKK 328

Query: 295 RMLNPSITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLG 354
            +LNPSITT + LL YVK IK+ L +D + R    +  FV+P+  ER+  V   LYAML 
Sbjct: 329 YILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQERKHLVNVLLYAMLD 388

Query: 355 LDASETRGPKPTGAHASIASQLSAELKD---SHQPIFRSALDKSAQSPVDDMASVNPKEP 411
           L   E +              L   L D           + DK+ +SP      V  K+ 
Sbjct: 389 LPEEELKEKITFKVDMKALLSLVDILHDYDIGQNTDAHKSKDKNKRSPFLWNLKVKGKKE 448

Query: 412 -----------VYQQVINFYLHWTPEPSDSIQANNSDTLMNKGLFDIIVELFDSKDIIIG 460
                      +Y+ V+N YL W PEP+D I  +   + +   LF+I+++LF+S++  I 
Sbjct: 449 TNEDPLARQTMLYEHVLNHYLTWVPEPNDIIPGSVKSSYIKTNLFEILLDLFESREFFIS 508

Query: 461 EXXXXXXXXXXXXXGYRLEQNWVKSLKILKNR---FDFKNYSN--AQGV----------- 504
           E              Y+L+  W + LK+++ R   F   N++N    G+           
Sbjct: 509 EFRNLLTDRLSSLKFYKLDDKWSQCLKLIRERIVKFTETNHANYITNGILGLPETTAPAA 568

Query: 505 ----SNINNIDVMLRDVKHSEELCAQMHSVPEISREVIPMFISYLFWNAGSKFSTLPKDC 560
               SN+N+IDVML D+K SEELC +MH V  +   V P FIS L+W         PKD 
Sbjct: 569 DADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPTVFPKFISLLYWKHNGDTQN-PKDS 627

Query: 561 --RLPSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLHFADKRVMDFEVSMDKSSV 618
             R+P+ LE E++KY D+Y+Q+KPGR+L+L ++Q  V ++L F D R +  +VS+++ SV
Sbjct: 628 KFRIPADLERELQKYSDIYSQMKPGRRLQLCKDQGKVEMELSFRDGRKLVLDVSLEQYSV 687

Query: 619 L----ACVAETTGISRDKIVEATGLEKAQVDQNLRFWLDASVLRFDSKTSLYSSLERQDT 674
           +    +   E   +S  ++ E+  +  +++ Q L FW+   VL    +  +YS +E  DT
Sbjct: 688 MNQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVL--SEEGEVYSVIEYSDT 745

Query: 675 D-NASEREAQMRAEDQARSAFD-SQQQQFVE-SMEKVWPFIRGMLTNLGTLKVEKIHSFL 731
             + ++++  M+  +      D S+ ++  E ++++  PFI GML NLG +K+ KIHSFL
Sbjct: 746 GFSQTQKDVLMKNVNNNNELRDESEVEKKCELTLQRSLPFIEGMLANLGAMKLNKIHSFL 805

Query: 732 KVAVPKEIGFNATT-AQLEAYLRLLVDENKLVCSANNAFKLVK 773
           K+ VPK+ G+N  T  QLE YL  L DE KL   AN ++++ K
Sbjct: 806 KITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIANGSYEIAK 848

>TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {ON}
           Anc_8.321 YLR127C
          Length = 809

 Score =  516 bits (1330), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 294/797 (36%), Positives = 458/797 (57%), Gaps = 54/797 (6%)

Query: 18  LRGHDITVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKILINENGN---------- 67
           LR H    +DDLE++LTW+NPNE  SNH +RPP LRLK AIK+ +N+  N          
Sbjct: 21  LRLHP-GCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIKLFVNQYYNSGYISGSDGE 79

Query: 68  ---GPA--LTDILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLFNRE-- 120
              GP   L + LRQ+ I+Q R HFF  +  +  FKD+Q+LE+YY  PL ++ LF     
Sbjct: 80  INKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRLEKYYVSPLAYIHLFESSGY 139

Query: 121 EWAEEINGLRNYLISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLLTH-LL 179
           EW  E +GLR+YL+++N+ F+ N + R+  L ++DDFE   ++ +W+ +A   L +  +L
Sbjct: 140 EWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQDDFEYVAEMLDWVEKAHTSLSSKDIL 199

Query: 180 VDAVLSKVKAFALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTNEIYR 239
           +D +++KVK F   HM   + K ++ ++ +N FI KYWS  +Q+L CP+DDH +TN +Y 
Sbjct: 200 LDLIIAKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNFAQLLGCPQDDHGLTNVVYT 259

Query: 240 CFEEEFIRIRTQQAFKIFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEARMLNP 299
           CFE++FIRIRTQ+ F IFV  +P S+PT++E+R ++     +  +V   LS FE ++LNP
Sbjct: 260 CFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHSTDFKTIVIAFLSTFEKKVLNP 319

Query: 300 SITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGLDASE 359
           S+TT + LL+YVK++K+ LT+D S RY Q +  FV+    ER D VV  LYA+L L    
Sbjct: 320 SVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQERSDLVVILLYAILDLQLDG 379

Query: 360 TRGPKPTGAHASI----ASQLSAELKDSHQPIFRSAL-DKSAQSPVDDMASVNPKEPV-Y 413
                  G+H  +       L++EL+D    I      D +  +    MA +N +  + Y
Sbjct: 380 L-----VGSHIQVDPVCLKALASELRDPELGIENDIYPDDNLANVATGMAKLNYEGCLPY 434

Query: 414 QQVINFYLHWTPEPSD-SIQANNSDTLMNKGLFDIIVELFDSKDIIIGEXXXXXXXXXXX 472
           ++V+  +L W P+P D + +A +  +  +  L DI++ELF+SKD  + E           
Sbjct: 435 EEVMQRFLSWNPDPRDMAPRAISKQSPSHMSLLDILMELFESKDFFVSEFLKLLTKRLLS 494

Query: 473 XXGYRLEQNWVKSLKI-------------LKNRFDFKNYSNAQGVSNINNIDVMLRDVKH 519
              Y L++NW K L++             L       N       SNIN+ DVML DVK 
Sbjct: 495 LKFYNLDRNWSKCLQLLKKKLARGAPNISLAPTGQQNNSERGDDYSNINSNDVMLWDVKL 554

Query: 520 SEELCAQMHSVPEISREVIPMFISYLFWNAGSKFSTLPKDCRLPSQLESEIRKYKDMYAQ 579
           S ELC QMH V  + + + P FISYL+WN   +      D  +P  L SE  KY  +Y++
Sbjct: 555 SYELCKQMHQVSGLDQRIYPKFISYLYWNCQLESKN---DFEIPEPLNSEFEKYSRVYSE 611

Query: 580 IKPGRKLRLHQEQSTVVLQLHFADKRVMDFEVSMDKSSVLACVAETTGISR---DKIVEA 636
           +K GR L+L ++Q  + L L F D RV+  +V++++ +V+    E +  +R   + I   
Sbjct: 612 VKAGRALKLLKDQGVIELDLEFKDGRVLQCDVTLEQYAVIQQFDEDSYANRLMAETISLY 671

Query: 637 TGLEKAQVDQNLRFWLDASVLRFDSKTSLYSSLE-RQDTDNASEREAQMRAEDQARSAFD 695
             +E ++V   L+FW++  VL      + Y++ E RQD++  + +   + +  +      
Sbjct: 672 LNMEISRVKSALQFWVEKGVLY--QVDAFYATQESRQDSNIKTAKSDSVGSFFEKNETII 729

Query: 696 SQQQQFVESMEKVWPFIRGMLTNLGTLKVEKIHSFLKVAVPKEIGFNATT-AQLEAYLRL 754
            ++    +++  +WPF++GMLTNLG+LK  KIHSFLKV VPKE+G+   T +QLE+YL  
Sbjct: 730 EEETTLSKTLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQSQLESYLNS 789

Query: 755 LVDENKLVCSANNAFKL 771
           LV+E +L C+ + ++KL
Sbjct: 790 LVEEERLACTTSGSYKL 806

>TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.321
           YLR127C
          Length = 842

 Score =  433 bits (1113), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 270/851 (31%), Positives = 442/851 (51%), Gaps = 92/851 (10%)

Query: 2   IQRDEGHVLSEQLHELLRGHDITVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIK-I 60
           +Q  E   +   ++EL+        DD++S+L W+NPN+P SNHQL+PP++RLK  IK I
Sbjct: 1   MQYTEVDSIVGNIYELVDSKSCGSSDDIDSLLDWLNPNDPKSNHQLKPPTIRLKKVIKKI 60

Query: 61  LINENGNGP-----ALTDILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVR 115
           L++ N  G       L  +LR Y IFQ R +FF++  S+ +FKD+ KLE+YYEFP+  V 
Sbjct: 61  LLDVNTLGDYDSIETLNSLLRYYYIFQVRLNFFSNLQSITYFKDIIKLEKYYEFPILHVP 120

Query: 116 LF--NREEWAEEINGLRNYLISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGR 173
           +F  N   W  E+N +R+YL+  NL F  N   RL++LV EDDF++A ++ +W   A   
Sbjct: 121 IFLNNNYIWETELNKIRHYLLRTNLTFRSNLINRLKKLVKEDDFDLAQEIIKWSNEANFS 180

Query: 174 LLT--HLLVDAVLSKVKAFALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDH 231
           LL+   ++++A+L K+  +A K    AWS+RF+ +E YN FI+KYWS  + +L C EDDH
Sbjct: 181 LLSSKQIILNALLDKITMYADKQFTNAWSQRFIIMETYNKFINKYWSNFAVLLNCAEDDH 240

Query: 232 DVTNEIYRCFEEEFIRIRTQQAFKIFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQ 291
           ++T  +Y+ FE++F+RIR+++ F I V  YP+S+PT++ELR +L      T ++  LLS+
Sbjct: 241 EITKVLYKYFEKQFLRIRSEEIFDICVISYPDSKPTIMELRGLLTQSKISTNILIRLLSE 300

Query: 292 FEARMLNPSITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYA 351
           F+ ++LN SI T  IL++Y+K +KS+L +D + RY Q  T F  P+L ++ D +   L+A
Sbjct: 301 FQLKVLNLSIPTCTILIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKSDIIYILLFA 360

Query: 352 MLGLDASETRGPKPTGAHASIASQLSAELKDSHQPIFRSALDKSAQSPVD---------- 401
           +L L   + +         ++   LS EL++SH   F   L+ S     D          
Sbjct: 361 ILDLRTDDIKTNPIVKVDQNLLKLLSEELRESH---FGINLNFSDVDISDNLENGNNNKN 417

Query: 402 ----DMASVNPKEPVYQQVINFYLHWTPEPSDSIQANNSDTLM-NKGLFDIIVELFDSKD 456
               D A     + +Y Q++N  L W PE S  +  N S  +M  K L DI+  +FD  +
Sbjct: 418 ISQLDYAGQESSQLLYSQILNRALTWLPE-SKLVSPNKSIKMMRKKNLLDILFAIFDDHE 476

Query: 457 IIIGEXXXXXXXXXXXXXGYRLEQNWVKSLKILKNRFDFKNYSNAQGVSNI--------- 507
           + +               GY LE++WV+ L++ K +F   +  +A   +N+         
Sbjct: 477 LFLKRFVELLKQKLFVIKGYNLEESWVQCLRLFKTKFSPNSLDDAPTSTNLETLTGNNDS 536

Query: 508 ---NNIDVMLRDVKHSEELCAQMHSVPEISREVIPMFISYLFWNAGSK-------FSTLP 557
               NIDVML D++ S++L  QMH + E+   +    IS L+W    K       +  L 
Sbjct: 537 MYMTNIDVMLWDMRGSKKLTEQMHLIDELDNRINLKIISSLYWQYDMKNEKRKTYYGLLN 596

Query: 558 KDCRLPSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLHFADKRVMDFEVSMDKSS 617
           K   +   L +++ KY  +Y+++KPGR L L  +QST+ +  +F D R +  E + +   
Sbjct: 597 K---MDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTVTCECTFENYM 653

Query: 618 VLACVAETTGISRD-----KIVEATGLEKAQVDQNLRFWLDASVLRFDSKTSLYSSLERQ 672
            +    E  G S        I+ + GLE  ++  +L+FWLD  +L FD KT  Y  LE  
Sbjct: 654 SICPFLENEGTSSYTLEELSIITSFGLEDLKI--SLKFWLDQKILYFDGKT--YRPLEYL 709

Query: 673 D-------TDNASEREAQMRAEDQARSAF----------DSQQQQFV------------- 702
           D       +  ++   + M   +   + F          D   Q+ +             
Sbjct: 710 DRSEIIIESPESNNVNSVMSITNNPLNGFAILGKGNDTIDRPSQENITKCTPDHDKTFNA 769

Query: 703 --ESMEKVWPFIRGMLTNLGTLKVEKIHSFLKVAVPKEIGFNATTAQLEAYLRLLVDENK 760
             + + K+  ++  +LTNLG   +EK+++ L+           ++  LE  +  LV+  +
Sbjct: 770 TSQEVSKIKEYVLSILTNLGEQNIEKLYNVLQTTSHDTAIKKVSSVTLENIVTELVENGQ 829

Query: 761 LVCSANNAFKL 771
           ++C  N  ++L
Sbjct: 830 ILCLPNGLYQL 840

>CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa]
           {ON} similar to uniprot|Q12440 Saccharomyces cerevisiae
           YLR127c APC2 component of the anaphase promoting complex
          Length = 783

 Score =  397 bits (1020), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 245/764 (32%), Positives = 420/764 (54%), Gaps = 41/764 (5%)

Query: 32  VLTWINPNEPTSNHQLRPPSLRLKSAIKILINENGNGPALTDILRQYLIFQTRKHFFAHY 91
           +L W++P     NHQL+PP+L +K+ I+ L+  + +   L++I + Y  +Q R +F+  Y
Sbjct: 33  LLQWLDP-AGKKNHQLKPPNLLVKTMIEKLLLGSNDYQLLSNI-QDYYCWQCRVYFYNEY 90

Query: 92  YSLCHFKDVQKLERYYEFPLRFVRLFNREEWAE-EINGLRNYLISKNLVFNRNARLRLRQ 150
             +    +++++ER+  FPL+++ +F      E E+    NYL+  N      A  RLR 
Sbjct: 91  KRIETLNELKRIERHVLFPLKYIPIFEGNNRVENEVRLFGNYLLKTNKKVMSRAVERLRN 150

Query: 151 LVLEDDFEMACKLYEWL--CRAEGRLLTHLLVDAVLSKVKAFALKHMEEAWSKRFVTVEL 208
            +LEDDFE+A ++ ++   C+ +    T +++D +L K++ F   H    W+KR++ +E 
Sbjct: 151 RMLEDDFELATEIVDYFDYCQTDS---TSIVLDIILDKIEQFCQLHYTRKWNKRYLIMET 207

Query: 209 YNLFISKYWSTLSQMLQCPEDDHDVTNEIYRCFEEEFIRIRTQQAFKIFVTGYPESEPTL 268
           +N FIS+YW  LS +L C ED+H +TN +Y+ FE++FI IRT + F I ++     +PTL
Sbjct: 208 FNQFISQYWDQLSSLLFCQEDNHTITNTLYKYFEKQFISIRTNEIFDICISNPASVQPTL 267

Query: 269 LELRSVLKTPAKYTQLVTELLSQFEARMLNPSITTAEILLSYVKAIKSILTIDVSFRYFQ 328
           LELR  + T   +  +V ELLS+F  +++NPSI TA+ L  Y++ IK+   +D S RY Q
Sbjct: 268 LELRKEISTVNDFNCVVVELLSKFNLKVINPSIVTADALFLYIRTIKTFSILDPSGRYLQ 327

Query: 329 LLTDFVRPFLMERRDTVVTFLYAMLGLDASETRGPKPTGAHASIASQLSAELKDSHQPIF 388
            ++ +V+P   +R+D V   L++MLGLD ++     P+       + L+ ELKD+     
Sbjct: 328 TISSYVKPHFRQRKDLVHLLLFSMLGLDETDQLNTMPSQVSEEKLTALTNELKDTEI--- 384

Query: 389 RSALDKSAQSPVDDMASVNPKEP---VYQQVINFYLHWTPE-PSDSIQANNSDTLMNKGL 444
             +  + +   VD M     KE    V +QVI  Y+ W PE P+   +   SD  ++  L
Sbjct: 385 -CSYTEESDDVVDPMIGSFSKEEDSMVLEQVIKRYMEWIPEVPTSFGKGILSDHKLD--L 441

Query: 445 FDIIVELFDSKDIIIGEXXXXXXXXXXXXXGYRLEQNWVKSLKILKNRFDFKNYS--NAQ 502
           FDI++EL +SK+ ++ E             GY L++ W K L +LK RFD ++    + +
Sbjct: 442 FDILLELLESKETLVIEFKNLLTKKLLDLRGYTLDKKWSKFLSLLKKRFDNRSTETMDEE 501

Query: 503 GVSNINNIDVMLRDVKHSEELCAQMH-SVPEISREVIPMFISYLFWNAGSKFSTLPKDCR 561
            ++NIN ID+MLRD+  S ++   M   +   + +V P  +S L+W+  S   +   D  
Sbjct: 502 DLNNINTIDIMLRDIYKSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDTQSKAGDFE 561

Query: 562 LPSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLHFADKRVMDFEVSMDKSSVLAC 621
           +  +LE  +  Y   Y+Q + G+KL L ++  +V L L F D R +  + S+ + SVL  
Sbjct: 562 MDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYSVLTL 621

Query: 622 VAE--------TTGISRDKIVEATGLEKAQVDQNLRFWLDASVLRF-DSKTSLYSSLE-- 670
                      T G++  ++   +G++  Q+   LR+W+   VL F D K   Y +LE  
Sbjct: 622 FKSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWVSKDVLYFSDGK---YRTLEFL 678

Query: 671 --RQDTDNASEREAQMRAEDQARSAFDSQQQQFVESMEKVWPFIRGMLTNLGTLKVEKIH 728
             + D+  A+  +    +  +  S  + +Q+  V   E+  P+I+ +L NLGTLK++K+H
Sbjct: 679 RWKGDSTYAAIPDVLEESVVERSSQHEDKQENHV---ERALPYIKDILLNLGTLKIDKLH 735

Query: 729 SFLKVAVPKEIGFNATT-AQLEAYLRLLVDENKLVCSANNAFKL 771
           + L+ A+PK+  ++     QL+ YL  LV+E  L  ++N+++KL
Sbjct: 736 ALLQSAMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKL 779

>Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGL193W
          Length = 689

 Score =  380 bits (975), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 240/686 (34%), Positives = 374/686 (54%), Gaps = 35/686 (5%)

Query: 13  QLHELLRGHDITVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKILINENGNGPALT 72
           QL   L  +D  + DDLE++LTWINPN+  +NHQ+R PSLR+K++IK+L  ++     L 
Sbjct: 13  QLISALPENDEALRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLDDAEQVFLL 72

Query: 73  DILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLFNREEWAEEINGLRNY 132
            +LRQ+ + Q R HFF ++ SL  +KD+ +LERYYEFPL++V LF  EE + E+ GLR Y
Sbjct: 73  QLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLFTAEELSNELIGLRKY 132

Query: 133 LISKNLVFNRNARLRLRQLVL-EDDFEMACKLYEWLCRAEGRLLTHLLVDAVLSKVKAFA 191
           L+++N  F  N   R+R L+L EDDFEM+ KLY+W+ +  G  +   ++D + +K++ F 
Sbjct: 133 LLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGHPMVKFVIDLLTNKIELFC 192

Query: 192 LKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCP-EDDHDVTNEIYRCFEEEFIRIRT 250
              ME    ++ V  E++N FI K W+   Q+LQ P EDD ++ N IYRCFE +FI ++T
Sbjct: 193 KSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNNLIYRCFENKFIEMKT 252

Query: 251 QQAFKIFVTGYPESEPTLLELRSVLKTPA-KYTQLVTELLSQFEARMLNPSITTAEILLS 309
           ++ F   +  +P S+P+LLE++SV+K    +  +LV ++ + F + +L PS+TT EILL 
Sbjct: 253 KELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICNDFHSELLIPSVTTIEILLY 312

Query: 310 YVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGLDASETR---GPKPT 366
           YVKAIK ++ +D + R     T  ++P + ER D + T L A+L L   E          
Sbjct: 313 YVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAILELTKDEIHEVISKNTL 372

Query: 367 GAHASIASQLSAELKDSHQPIFRSALDKSAQSPVDDMASVNPKEPVYQQVINFYLHWTPE 426
             +  +  QLS ELK+S    F S     +++ +  +A    + P+ +Q    +L WTPE
Sbjct: 373 TENPQLLDQLSKELKNSTALNFHSVTTIKSKAAIYSVAQ-ERQNPLVKQ----FLEWTPE 427

Query: 427 PS----DSIQANNSDT-------LMNKGLFDIIVELFDSKDIIIGEXXXXXXXXXXXXXG 475
           P     D  +  N+DT        + K + +++ ++FDS +I+I E             G
Sbjct: 428 PGPFNEDISKLGNNDTDDTTETLELPKDVLEVVFQVFDSPEILINEFIKLITNHMLQMEG 487

Query: 476 YRLEQNWVKSLKILKNRFDFKNYSNAQGV------SNINNIDVMLRDVKHSEELCAQMHS 529
           Y L   W + LK L  ++ FKN  N Q +      SN+ N+ VM  D++ S         
Sbjct: 488 YILSAKWSQLLKTLMKKY-FKN--NKQVLKSICEESNLVNVFVMWSDLEKSASFQNWSTK 544

Query: 530 VPEISREVIPMFISYLFWNAGSKFSTLPKDCRLPSQLESEIRKYKDMYAQIKPGRKLRLH 589
           +  I   V P  ISYL+W    K  +L  D R+ S L    ++ +  +    PGRKLR  
Sbjct: 545 LQLIPSNVYPKIISYLYWKISRK--SLYGDYRISSALAIIFQQMEKAFEMKSPGRKLRFQ 602

Query: 590 QEQSTVVLQLHFADKRVMDFEVSMDKSSVLACVAETT-GISRDKIVEATGLEKAQVDQNL 648
            +Q TV + L F D R    +VS+ K +V+    +   G+    IV+ T + +  V+  +
Sbjct: 603 NDQGTVEIALTFDDGRHWSNKVSLPKYTVIELFQKVPRGLRTADIVQQTDMAQHHVEAIV 662

Query: 649 RFWLDASVLRFDSKTSLYSSLERQDT 674
           ++W    VL + +    Y  LER D 
Sbjct: 663 QYWCQEHVL-YSTGDDCYRILERADV 687

>AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR127C (APC2)
          Length = 709

 Score =  367 bits (943), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 236/719 (32%), Positives = 385/719 (53%), Gaps = 37/719 (5%)

Query: 1   MIQRDEGHVLSEQLHELLRGHDITVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKI 60
           M+   E     +Q+ + +   D ++ D++E+VL W++PN+  +NHQ+RPPSLR+K++I++
Sbjct: 1   MMYSQEAVGCQQQVVDAVCTWDPSLKDEIEAVLEWMDPNDDHNNHQMRPPSLRIKNSIRL 60

Query: 61  L-INENGNGPALTDILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLFNR 119
           L + E   G  +  +LRQ  + Q R+HFF H+  L  + D+ KLERYYEFPLR+V +F  
Sbjct: 61  LRLGEQAPGTTV-GLLRQCAVSQMRQHFFRHWERLEQYTDMVKLERYYEFPLRYVAVFTE 119

Query: 120 EEWAEEINGLRNYLISKNLVFNRNARLRLRQLVLE-DDFEMACKLYEWLCRAEGRLLTHL 178
           +E A E+ GLR YL++ N  F  N   R+R L+L+ DDFE A +LY+W+ +  G  +   
Sbjct: 120 DEVAAELVGLRKYLLNGNPGFRANMEARIRALILQDDDFETAARLYKWIVQGLGHPMVKF 179

Query: 179 LVDAVLSKVKAFALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCP-EDDHDVTNEI 237
           +++ +  K+  F    M+    +R++ +E++N FI++ W+   Q+LQ P  DD ++ N I
Sbjct: 180 VIEVLTQKIALFCRNRMDGNVDQRYLIMEVFNSFIARCWAQFIQLLQFPTADDPELNNLI 239

Query: 238 YRCFEEEFIRIRTQQAFKIFVTGYPESEPTLLELRSVLKT-PAKYTQLVTELLSQFEARM 296
           YRCFE++FI ++TQ+ F   +  +P S+P LLE++SV+K   A+  +LV ++ + F   +
Sbjct: 240 YRCFEKKFIELKTQELFHQIIPKFPMSKPALLEMKSVIKGDTAELDRLVAQIYNDFHKEL 299

Query: 297 LNPSITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGLD 356
           L PS+TT EILL YVK IK ++ +D + R     T  ++P + ER D +++ L A+L LD
Sbjct: 300 LVPSVTTVEILLYYVKTIKCLMVVDPTGRSMNRFTSKLKPKIKERSDLIISVLCAILELD 359

Query: 357 ASETR---GPKPTGAHASIASQLSAELKDSHQPIFRSALDKSAQSPVDDMASVNPKEPVY 413
           + E            +  + SQLS ELK+S    F S      ++ +  +A         
Sbjct: 360 SDEIHEVISKNTLTENPQLLSQLSKELKNSTALTFHSMSTSKGKAAIYSVAFER-----Q 414

Query: 414 QQVINFYLHWTPEP----SDSIQANNSD-----TL-MNKGLFDIIVELFDSKDIIIGEXX 463
            Q++  +L WTPEP    +D  +A NSD     TL + K + +++ ++FDS +++I E  
Sbjct: 415 DQLVKQFLEWTPEPGPFTADDAKALNSDDDGAETLELPKDVLEVVFQVFDSPEVLINEFI 474

Query: 464 XXXXXXXXXXXGYRLEQNWVKSLKILKNRFDFKNYSNAQGV------SNINNIDVMLRDV 517
                      GY L   W + LK +  ++ FKN  N Q +      SN+ N+ VM  D+
Sbjct: 475 QLVTNHMLQMDGYVLNAKWSQLLKTVMKKY-FKN--NKQVLKSMCEESNLVNVFVMWSDL 531

Query: 518 KHSEELCAQMHSVPEISREVIPMFISYLFWNAGSKFSTLPKDCRLPSQLESEIRKYKDMY 577
           + S         +  +   V P  ISYL+W  G +      D  +   L +   + +  +
Sbjct: 532 EKSATFQTWSTKLQLVPPNVYPKIISYLYWKIGRRSPY--GDYAVAPGLAAIFDQMEKAF 589

Query: 578 AQIKPGRKLRLHQEQSTVVLQLHFADKRVMDFEVSMDKSSVLACVA-ETTGISRDKIVEA 636
               PGRKLR  ++Q +V LQL F D R     VS+ K +V+     +   +S   I   
Sbjct: 590 ETRSPGRKLRFQKDQGSVDLQLVFEDGRHWSSRVSLPKYTVIDLFQRQACPLSVTDIAAH 649

Query: 637 TGLEKAQVDQNLRFWLDASVLRFDSKTSLYSSLERQDTDNAS-EREAQMRAEDQARSAF 694
           T +    V+  ++FW    VL  + K  LY  LE  ++  AS + +A + A     SA+
Sbjct: 650 TNMSPRLVEDIIQFWCHEHVLHLN-KNDLYEILENHNSAIASRQSQASVPAFHPVSSAY 707

>TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {ON}
           Anc_8.321 YLR127C
          Length = 732

 Score =  348 bits (893), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 209/704 (29%), Positives = 368/704 (52%), Gaps = 67/704 (9%)

Query: 25  VDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKILINE--------NGNGPALTDILR 76
           + D+LE++L W++PN+P SNH L PP+L+LK+ IK +           N     + + L+
Sbjct: 29  ISDELETLLIWLDPNDPNSNHHLHPPTLQLKTIIKQITPSSDIYKDPSNSIKNNIQNWLK 88

Query: 77  QYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLFNREEWAEEINGLRNYLISK 136
            + ++Q R +FF    ++  +KD+ KLE+YY+FPL+F+ LF  +EW  E+  LR+Y++ +
Sbjct: 89  LFYVYQVRTYFFKKIDNIRQYKDMIKLEKYYQFPLQFIPLFTFQEWCFELLSLRHYILHQ 148

Query: 137 NLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLLT-HLLVDAVLSKVKAFALKHM 195
           N  F +   L LRQL+ E+DFE +  +  W+   +  LL+ + ++D +L K+  +  + M
Sbjct: 149 NKEFTQKIILELRQLIKEEDFETSLDIVTWIREVDSNLLSENFILDILLEKITLYCEQTM 208

Query: 196 EEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTNEIYRCFEEEFIRIRTQQAFK 255
           +  W++R++ +E YN F+  YW   +Q+L C ED+H +TN +++ FE++FI+IR Q+ FK
Sbjct: 209 KGNWTRRYLVMETYNTFMMNYWLNFTQLLNCKEDNHKITNILFKYFEKQFIKIRIQEIFK 268

Query: 256 IFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEARMLNPSITTAEILLSYVKAIK 315
           I +  YP+++PTLLELR++L T   + +LV   LS FE  +L P+I T + LL+Y++ +K
Sbjct: 269 ICILSYPDTKPTLLELRNLLVTYNFFQKLVVNFLSAFERIVLTPTINTIDCLLAYIRTVK 328

Query: 316 SILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGLDASETRGPKPTGAHASIASQ 375
           S   +D S RY   +T+++ P   ER+      L+A+L L   +          +SI+ +
Sbjct: 329 SFQILDPSGRYLYSITNYINPHFRERKMLAPILLHAILALPKIDLENAIYPIKVSSISLK 388

Query: 376 LSA-ELKDSHQPIFRSALDKSAQSPVDDMASVNPKE----------P------------- 411
           L   EL+D    I  ++  K++    +++ S  PK           P             
Sbjct: 389 LIINELEDPELGIENTSTKKNSIKKFNEILS--PKRFNNHNSSEYLPDLLQNTSSEDSNS 446

Query: 412 --VYQQVINFYLHWTPEPSDSIQANNSDTLMNK-GLFDIIVELFDSKDIIIGEXXXXXXX 468
             + Q+V+  +L W P P+D I  N++  L +   L DI++ +F+SK+ ++ E       
Sbjct: 447 TLLVQKVVKQFLTWVPIPND-IATNDTKKLYSSTNLLDILLNIFESKEFLLTEFSKLLSK 505

Query: 469 XXXXXXGYRLEQNWVKSLKILKNRF-------------DFKNYSNAQGVSNINNIDVMLR 515
                  Y+LE  W   L++L+ RF             D  N  N + +  I N++VML 
Sbjct: 506 RLLITKNYKLEGKWGACLQLLRKRFSSGSDNYTNTNLADTDNLVNGENLK-ITNMNVMLS 564

Query: 516 DVKHSEELCAQMHSVPEISREVIPMFISYLFW------NAGSKFSTLPKDCRLPSQLESE 569
           D+ +S ELC   H    ++  V P FIS  +W      N  +  +      ++P  L   
Sbjct: 565 DLNYSSELCKIFHHANGVNTRVYPKFISSHYWVDLDDENVSNGPNEETNHFQIPPSLLGY 624

Query: 570 IRKYKDMYAQIKPGRKLRLHQEQSTVVLQLHFADKRVMDFEVSMDKSSVLACVAETT--- 626
             +Y  +Y  +  GRK+ +   +  + ++L F D RV++ + ++ + ++L  + E     
Sbjct: 625 FEEYAKLYEDLNEGRKVDIWPNEGVIEIKLSFEDGRVLEIDATLPQYALLQYIQEKNAIM 684

Query: 627 ----GISRDKIVEATGLEKAQVDQNLRFWLDASVL-RFDSKTSL 665
               G + +++     L    V + + FWL  +VL + D K S+
Sbjct: 685 QNNQGFTVNELSVPLNLSLQNVTELVDFWLKKNVLKKVDDKYSI 728

>NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.321
           YLR127C
          Length = 811

 Score =  327 bits (837), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 244/793 (30%), Positives = 388/793 (48%), Gaps = 60/793 (7%)

Query: 29  LESVLTWINPNEPTSNHQLRPPSLRLKSAIKILINENGNGPALTDILRQYLIFQTRKHFF 88
           LES+L W++PN      Q +PP+L LK  I +L             LR+Y ++  + HF 
Sbjct: 26  LESLLLWLDPNSSKGTRQNKPPTLELKDCINLLRAGYSQDEKFKMWLREYYLYVVKFHFM 85

Query: 89  AHYYSLCHFKDVQKLERYYEFPLRFVRLFNREEWAEEINGLRNYLISKNLVFNRNARLRL 148
            +   +   KD + LE  Y +PL+F+ L +  + +  +   ++YLI KN+ F +N   + 
Sbjct: 86  KNVDEISVLKDFKLLEMIYIYPLQFMDLVDSTDISNLVKSFKHYLIDKNVTFRKNLITKF 145

Query: 149 R-------QLVLEDDFEMACKLYEWLCRAEGRL-LTHLLVDAVLSKVKAFALKHMEEAWS 200
           +       Q   E +F    ++  W+  +EG L  T L++DA L+K++ FA + M    +
Sbjct: 146 KDCFLVGNQFEFEYEFANIVEIIHWIQDSEGVLSATDLILDASLTKIEIFAREQMIGKLN 205

Query: 201 KRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTNEIYRCFEEEFIRIRTQQAFKIFVTG 260
           ++F+ +E +N FI  YW  L+Q++   EDDHD+TN IY+ FE +FI+IR ++   I V  
Sbjct: 206 QKFIVMETFNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQD 265

Query: 261 YPESEPTLLELRSVLKTPAKYT---------------QLVTELLSQFEARMLNPSITTAE 305
           YP+++PT+LEL+S+L      T               +L+ + L  F+   LNP I T +
Sbjct: 266 YPQTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTID 325

Query: 306 ILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERR-DTVVTFLYAMLGL---DASETR 361
           +L +YVKA KS L +D S      +  FV+P+L     + V   LYA+L L   D  E  
Sbjct: 326 VLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIELN 385

Query: 362 GPKPTGAHASIASQLSAELKDSHQPIFRSALDKSAQSPVDDMASVNPKEPVYQQVINFYL 421
             K T    SI   LS EL + H       +D    SP       N   P Y+QV   +L
Sbjct: 386 CEKTTYDMRSI-ELLSKELSNDHSK-HAGDVDYKKFSPEGTNEFENSTLP-YEQVYTDFL 442

Query: 422 HWTPEPSDSIQANNSDTLMNKGL----FDIIVELFDSKDIIIGEXXXXXXXXXXXXXGYR 477
           +W P  +   +++N D   + G      D +    +SKD +I E             GY 
Sbjct: 443 NWKPSITPISESSNDDEFASLGKNITPIDYVFNALESKDKLISEFLKLLTIKLLHMKGYE 502

Query: 478 LEQNWVKSLKILKNRFDF-KNYSNAQGV-SNINNIDVMLRDVKHSEELCAQMHSVPEISR 535
           +E  W K LKIL+++    KN  N + + S+IN I +ML D+  S+E   +  S  + S 
Sbjct: 503 VEDRWQKCLKILQDKVTSDKNIVNDESITSDINTILIMLHDISISKESSNEKISEFQNSS 562

Query: 536 E--VIPMFISYLFWNAGSKFSTLPK-DCRLPSQLESEIRKYKDMYAQIKPGRKLRLHQEQ 592
           E  + P FIS L+W    KF    +    L S+L  ++ KY   Y    PG KL+L    
Sbjct: 563 EMQLFPKFISKLYW----KFKRQSEYQFPLDSKLRKKLSKYMKSYHHSHPGMKLKLVNGT 618

Query: 593 STVVLQLHFADKRVMDFEVSMDKSSVLACVAE-----TTGISRDKIVEATGLEKAQVDQN 647
               L L F D R +  + + ++ +VL+         +  +S +++     ++  +V  +
Sbjct: 619 GICSLNLTFKDGRKLSVDATFEQYTVLSAFHNDKDDSSQVLSINQLSTMLKMDPERVRAH 678

Query: 648 LRFWLDASVLRFDSKTSLYSSLERQDTDNASEREAQMRAE----DQARSAFDSQQQQFV- 702
           L+FW++  VL    +   Y+  E  +    S     + +      Q R  F       V 
Sbjct: 679 LQFWINKKVLC--HQNDYYTIQEYLNNQELSSGPTVITSSILPLSQERMPFKRSVPTNVL 736

Query: 703 ----ESMEKVWPFIRGMLTNLGTLKVEKIHSFLKVAVPKEIGFN-ATTAQLEAYLRLLVD 757
               E + +V+P+I  M TNLG+LKV+KIHSFL ++VP+ + ++  T  QLEAYL  LV+
Sbjct: 737 NDPKEILHRVYPYINDMFTNLGSLKVDKIHSFLNMSVPRGLHYSKVTVTQLEAYLDQLVE 796

Query: 758 ENKLVCSANNAFK 770
           E +L+   + +FK
Sbjct: 797 EEQLIVLPDGSFK 809

>KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {ON}
           Anc_8.321 YLR127C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 797

 Score =  320 bits (819), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 231/801 (28%), Positives = 382/801 (47%), Gaps = 102/801 (12%)

Query: 27  DDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKILINENGNGPALTDILRQYLIFQTRKH 86
           DDLE V+ WI+P      H   PPSLR+K AI+ ++   G    L    + Y I   ++ 
Sbjct: 23  DDLERVMGWIHPQA----HACHPPSLRMKKAIRSVL---GKASELDRQFKIYYIDVIKQE 75

Query: 87  FFAHYYSLC-----HFKDVQKLERYYEFP---LRFVRLFNREEWAEEINGLRNYLISKNL 138
           +      LC      FK +Q LE    +P   L F+ + ++    + I  LR+YL+  + 
Sbjct: 76  Y------LCDQVKREFKHIQVLESKLVYPVTYLPFLSISDQLAIEQTICSLRHYLVDNDD 129

Query: 139 VFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLLT--HLLVDAVLSKVKAFALKHME 196
               +       L+ +DDFE   ++ EWL  A  +LL   +L +D ++SK+       M 
Sbjct: 130 NLRNSLVAEFETLMQDDDFESGYQIIEWLYTANAKLLRPWNLALDTIVSKISTLCDNEMR 189

Query: 197 EAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTNEIYRCFEEEFIRIRTQQAFKI 256
             W  +F+ +  +N FI+ YWS L++ L   ED+HD T  +Y+CFE+EF+RIRT++ F+I
Sbjct: 190 RNWEAKFLVMNTFNKFINLYWSHLAKFLHLSEDNHDFTKVLYKCFEKEFVRIRTEEIFEI 249

Query: 257 FVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEARMLNPSITTAEILLSYVKAIKS 316
            V  Y  ++ T+LELR+ +    + ++LV + L QF+ ++LNPS+ T E L+++++++K 
Sbjct: 250 VVESYQAAKTTILELRTFMSGYERLSKLVNQFLKQFKIKVLNPSVNTVEALVAFIRSVKC 309

Query: 317 ILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGL-DAS-ETRGPKPTGAHASIAS 374
            + +D   R+   +T+FV+PF  +R D V   LYA+L L D   E  G  P        S
Sbjct: 310 FVILDPRARHMHTITNFVKPFFHQRGDAVQIILYAILDLRDVDFEKMGVSPVKG----LS 365

Query: 375 QLSAELKD---------------SHQPIFRSALDKSAQSPVDDMASVNPKEPVYQQVINF 419
           +LS EL++               S   I    L+ S+   VDD       + VY+QV+N 
Sbjct: 366 ELSHELREDPYVNINAKCQTPTPSPSKISSPHLNDSSSMDVDDKLDDGTTDLVYKQVLNQ 425

Query: 420 YL----HWTPEPSDSIQANN---SDTLMNKGLFDIIVELFDSKDIIIGEXXXXXXXXXXX 472
           +     H T + +      N   S       L D + ELFD KD ++             
Sbjct: 426 FXXRGHHETNQGTRDYVGVNVKFSQRSNRTNLLDPLFELFDKKDELLSCFLKLLTLKLFK 485

Query: 473 XXGYRLEQNWVKSLKILKNRFDFKNYS-----------------NAQGVSNINNIDVMLR 515
             GY LE NW +  +++K +    +                   N Q + ++N IDVML 
Sbjct: 486 LSGYTLEPNWNECYQLIKRKVTKGDVGDGGPLSRDTADAPVSSNNEQVLLSLNKIDVMLH 545

Query: 516 DVKHSEELCAQMHSVPEISREVIPMFISYLFWN--------AGSKFSTLPKDCRLPSQLE 567
           D++ + ++  ++H    ++  V P FIS  +W+        AG++        ++   LE
Sbjct: 546 DLRENAKITRRLHRTSMLNGNVFPKFISSQYWSYRDDTFTKAGNR-----DQIKIDPVLE 600

Query: 568 SEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLHFADKRVMD-FEVSMDKSSVL---ACVA 623
           ++I +Y   + ++K GR +RL +E++   ++L   D  V   F+V   K SV+   A   
Sbjct: 601 TDILQYGGRFCELKYGRMVRLCKEKTIFEIELTVNDGEVPQVFKVDAMKYSVIEKYATGG 660

Query: 624 ETTGISRDKIVEATGLEKAQVDQNLRFWLDASVLRFDSKTSLYSSLERQDTDNASEREAQ 683
              G +  ++ E  G++ A V  +L +W++A +LR  S     S+ E     N       
Sbjct: 661 PRAGYTPTELCELCGMDIADVQTSLTYWVNAGLLRLSSSGYYESTSETGPPPNRG----- 715

Query: 684 MRAEDQARSAFDSQQQQFVESMEKVWPFIRGMLTNLGTLKVEKIHSFLKVAVPKEIGFNA 743
                   +  ++  ++F++ +  VW FIRGML +LGTL   +IH +L   VP  I +  
Sbjct: 716 --------TPLEASTREFLDGV--VWTFIRGMLESLGTLSCAEIHEYLAATVPATIRYQE 765

Query: 744 TTA--QLEAYLRLLVDENKLV 762
           T    QL+ YL   V    L+
Sbjct: 766 TVTMLQLQGYLDYNVQSTHLL 786

>KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.321
           YLR127C
          Length = 817

 Score =  301 bits (772), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 225/832 (27%), Positives = 389/832 (46%), Gaps = 117/832 (14%)

Query: 27  DDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKILINENGNGPALTDILRQYLIFQTRKH 86
           +DL+ +L W++P E    HQ +PPSLR+K +I+ +          T+ L +  I   R  
Sbjct: 18  EDLDRLLLWLSPAE----HQCKPPSLRIKKSIQRIRECFQLSSDFTNCLVKLYIDLIRFE 73

Query: 87  FFAHY---YSLCHFKDVQKLERYYEFPLRFVRLFNRE---EWAEEINGLRNYLISKNLVF 140
           F ++     +   F DV KLE   E P    RLF  E   E+ + ++ LR+YL+  +  F
Sbjct: 74  FISYMKENANCLKFNDVLKLENRIEHP----RLFIPELEFEYFKNLHMLRHYLLDSDKSF 129

Query: 141 NRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLLT--HLLVDAVLSKVKAFALKHMEEA 198
                  +  L++EDDF  A  + +W+  A    L+   L++D ++ K+       +  +
Sbjct: 130 KTALCTSIENLIMEDDFYSATIILDWIDSAYSIDLSPKDLVLDMLVKKIAGICSGSIRGS 189

Query: 199 WSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTNEIYRCFEEEFIRIRTQQAFKIFV 258
           W++RF+ +E +N FI  YWS  +Q+L+CPE+DH++T  +++CFE EFI IR  + F+IF 
Sbjct: 190 WTRRFIVIETFNDFIEVYWSHFAQLLKCPENDHELTKTVFKCFEREFINIRINEIFEIFT 249

Query: 259 TGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEARMLNPSITTAEILLSYVKAIKSIL 318
           + YPES+PT+LELR V+K P    +L    L  F+  MLNP +TT + L SY+KAIK  L
Sbjct: 250 SAYPESKPTILELRKVMKAPKDLQRLTYTFLDTFKDEMLNPCVTTIDALTSYLKAIKGFL 309

Query: 319 TIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGLDASETRGPKPTGAHASIASQLSA 378
            +D + RY  L+T FV+P+  ++ D +   LYA+L L   +        ++    ++LS 
Sbjct: 310 LLDPAGRYLNLVTTFVKPYFQDKSDLINILLYAILDLKPKDFEDLNI--SYIPGLNKLSL 367

Query: 379 ELKDSHQPIFR----SALDKSAQSPVDDMASVNPKE------PVYQQVINFYLHWTPEPS 428
           ++++   P F        D + +  V ++ S+           +   ++  ++ W PEP+
Sbjct: 368 DMRE--DPEFSIENVEPNDNNYKRTVPNLESIGANSLHDKGTLIQDHIMKQFMMWVPEPN 425

Query: 429 -----------DSIQANNSDT------LMNKGLFDIIVELFDSKDIIIGEXXXXXXXXXX 471
                      +  + +N+D         N  L DI+++LF+SK+I IG+          
Sbjct: 426 MNNLENDHDNGNDFEEDNNDVTAVNSIFYNVNLLDILLDLFESKEIFIGKFVNLLTIKFF 485

Query: 472 XXXGYRLEQNWVKSLKILKNRFDFKNYSN--------AQGVSN----------------- 506
               YR++ NW K L+++ ++F+  N S         A G  N                 
Sbjct: 486 KLQNYRVDPNWQKCLELINSKFNSSNISMDEKMEEDVAIGTVNPTNENYVDEKRKTNASN 545

Query: 507 --------INNIDVMLRDVKHSEELCAQMHSVPEISR--------EVIPMFISYLFWNAG 550
                   +N I+VML D++HSE+   Q+ S  E++R         + P FIS L+W+  
Sbjct: 546 DMEEIQISLNKIEVMLNDIRHSEKFSFQISS--ELNRYGLRSNNVGIKPKFISPLYWDYE 603

Query: 551 SK---FSTLPKDCRLPSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLHFADKRVM 607
                 +   K+     +    I +Y   Y  I  G  L   + +  + +++ F D  + 
Sbjct: 604 DNELGVNNFLKENVFDEECTKAILQYASEYCSINKGFALHYCKGKEMIEVEISFNDGAIK 663

Query: 608 DFEVSMDKSSVLACVAETTGISRDKIVEATGLEKAQVDQN-----LRFWLDASVLRFDSK 662
            F V+  +  VL      TG  +  I       +A+  +N     L+FW++ +VL ++  
Sbjct: 664 GFLVNASQYYVLTLF--DTGNEKLTIESILTAGEAKRSKNEIIDALKFWVEKNVLVYEG- 720

Query: 663 TSLYSSLERQDTDNASEREAQMRAEDQARSAFDSQQQQFVESMEKVWPFIRGMLTNLGTL 722
              Y S +    +N S+     R +D                +++  P+I+ ML + G L
Sbjct: 721 -GYYYSRDLHSIEN-SKGNTTTRTDDLL--------------VKEALPYIKTMLESFGNL 764

Query: 723 KVEKIHSFLKVAVPKEIGFNATTAQLEAYLRLLVDENKLVCSANNAFKLVKE 774
              +I +FLK  +P     +     + + L  LV +  L  +++ ++KL  E
Sbjct: 765 SASRIQNFLKATLPAAQDSDHIITDIHSVLDTLVSDGILFKNSSGSYKLADE 816

>Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 511
           aa] {ON} ANNOTATED BY YGOB -
          Length = 511

 Score =  250 bits (638), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 166/508 (32%), Positives = 267/508 (52%), Gaps = 36/508 (7%)

Query: 297 LNPSITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGLD 356
           +NPSITT + L++YVK +KS LT+D S +Y   ++ FV P+L ER D V   LYA+L L 
Sbjct: 1   MNPSITTVDALIAYVKTVKSFLTLDPSGKYLHSISTFVNPYLQERNDLVSVLLYAILDLQ 60

Query: 357 ASETRGPKPTGAHASIASQLSAELKDSHQPI---FRSALDKSAQSPVDDMASVNPKEPVY 413
           +   +        A     LS EL+D    I       LDK+  +      S      +Y
Sbjct: 61  SENFQEEAQNILDADSLVILSDELRDPEFGIEGELNIDLDKNELTGQPSNKS-GDSSLLY 119

Query: 414 QQVINFYLHWTPEPSDSIQANNSDTLMNKGLFDIIVELFDSKDIIIGEXXXXXXXXXXXX 473
           +QVI   L+W PE S           + K L DI++E+F++ ++ I E            
Sbjct: 120 RQVITQMLNWVPESSKIDSKRQKMIGLRKNLLDILLEIFENNEVFIAEFLKLLTKKLLKL 179

Query: 474 XGYRLEQNWVKSLKILKNRFDFK---------NYSNAQG--VSNINNIDVMLRDVKHSEE 522
             Y+L+  W K LK+LK +F            N  N  G  +  INNIDVML D+K S +
Sbjct: 180 KYYKLDSRWSKCLKLLKEKFKGNSAGTTSISTNIGNVTGSDLVYINNIDVMLWDLKTSGD 239

Query: 523 LCAQMHSVPEISREVIPMFISYLFWNAGSKFSTL---PKDCRLPSQLESEIRKYKDMYAQ 579
           L ++MH +  + R + P FIS L+W+   +  +     K  ++   L +++ KY  +Y++
Sbjct: 240 LTSRMHQIEGLDRRIQPKFISSLYWDQAKESKSKGNNAKQTQIDPLLSTQLEKYIRVYSE 299

Query: 580 IKPGRKLRLHQEQSTVVLQLHFADKRVMDFEVSMDKSSVLACVAETT---GISRDKIVEA 636
           +KPGR L L ++  TV L+  F D R +  + ++++S+++   +E     G+S +++   
Sbjct: 300 LKPGRTLHLLKDHGTVELEFTFEDGRTISCDATLEQSNIINYFSEAVSENGLSLEQLHIL 359

Query: 637 TGLEKAQVDQNLRFWLDASVLRFDSKTSLYSSLERQDTD----NASEREAQMRAEDQARS 692
           +G+E   + + L+FW+D  VL FD +  LY  LE  D       +     ++  E+Q  +
Sbjct: 360 SGIESTGLKKILQFWVDEKVLYFDGQ--LYRILEYLDQPEIIVQSLTHTGEVLKEEQKLN 417

Query: 693 AFDS--------QQQQFVESMEKVWPFIRGMLTNLGTLKVEKIHSFLKVAVPKEIGFNA- 743
              S        Q  +  E++  VWP+I+GMLTNLG+LK+EKIHSFL+  VPK++ +N+ 
Sbjct: 418 PLSSSSITSDIDQMNKIHETLNNVWPYIKGMLTNLGSLKLEKIHSFLRATVPKDVNYNSI 477

Query: 744 TTAQLEAYLRLLVDENKLVCSANNAFKL 771
           T + LE YL  LV+++ L   A+ +++L
Sbjct: 478 TVSSLEVYLNSLVEDDVLELLASGSYRL 505

>NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.321
           YLR127C
          Length = 911

 Score =  242 bits (618), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 229/884 (25%), Positives = 397/884 (44%), Gaps = 147/884 (16%)

Query: 29  LESVLTWINPNEPTSNHQLRPPSLRLKSAIKILINENGNGPALTDILRQYLIFQTRKHFF 88
           L+++L W+NPNE T+       ++ LK+ I I+++  G    +  + ++Y  F  + HF 
Sbjct: 30  LQTMLLWLNPNETTT-QSATTMTIDLKNCINIIVSTYGKDDQIRLLFKKYYSFVIKLHFM 88

Query: 89  AHY--YSLCHFKDVQKLERYYEFPLRFV-RLFNREEWAEEINGLRNYLISKNLVFNRNAR 145
                 ++   ++  KLE  Y  PLRF   L +  E    IN  + YLI+ N  F +N  
Sbjct: 89  KDNRPKNMTSIREFHKLENLYLTPLRFTYDLIDTNEMQSLINIFKRYLINNNFTFRKNVL 148

Query: 146 LRLRQLVL-EDDFEMACKLYE------WLCRAEGRLL-THLLVDAVLSKVKAFALKHMEE 197
             +  L L ED FE    +        WL  A G +    LL+D +L K++ F  + M  
Sbjct: 149 HSMETLFLTEDQFEFQYNMNSLNEIVIWLNDANGNVSPIDLLLDLLLRKIEKFCQREMAG 208

Query: 198 AWSKRFVTVELYNLFISKYWSTLSQMLQCP-------EDDHDVTNEIYRCFEEEFIRIRT 250
            W+ RF+ +E +NLFI++YW  +S++           E+DH +TN IY  F ++FI+IR 
Sbjct: 209 LWNGRFIIMEKFNLFINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYFFTQQFIKIRI 268

Query: 251 QQAFKIFVTGYPESEPTLLELRSVLKTPA---------------------KYTQL-VTEL 288
            ++ KI V+ +P S PT++EL++VL T +                     +Y +L V + 
Sbjct: 269 NESLKIMVSNFPISTPTIIELKNVLITSSMPRENVSTTATTTFRDTNLSEEYLKLFVKKF 328

Query: 289 LSQFEARMLNPSITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERR--DTVV 346
           L  F+ + LNP I T  ++ + VK   S L +D   +    +   ++P L++RR  D V 
Sbjct: 329 LKDFQRKFLNPCIPTIPLIRALVKMTNSFLILDPRGQLLTTIILTLKP-LIQRRTTDIVN 387

Query: 347 TFLYAMLGLDASETRGPKPTGAHASIASQLSAELKDSHQPIFRSALDKSAQSP------- 399
             LYAML L+  E       G +     +    L     P    +++++  +P       
Sbjct: 388 ILLYAMLNLNEMELH---KLGCNIDFDIESFNILVSELYPTIIKSMNQNQNNPSVVPYTT 444

Query: 400 ---------------------VDDMASVN---------PKEPVYQQVINFYLHWTPEPSD 429
                                V DMA+ N         P+   +  +   YL W P  + 
Sbjct: 445 AGTGTTCSNERITNDDIPYQNVKDMANANTMEYLARRKPETKPFFDLFKQYLEWVPPMNK 504

Query: 430 SIQANNSDTLMN---------KGLFDIIVELFDSKDIIIGEXXXXXXXXXXXXXG-YRLE 479
              + + +T+++         +   D +   FDS D+++ E               Y L+
Sbjct: 505 IYDSTSKNTVVDDEETSRIRSRHAIDYLFRFFDSIDLLLSEYLKLLTEKFIHSKNYYTLD 564

Query: 480 QNWVKSLKILKNRFDFKNYSNAQGVSNINNIDVMLRDVKHSEELCAQMHSVPE---ISRE 536
            NW+  L +LK + +  N  +    S IN ID+ML D+K S           E   +  +
Sbjct: 565 NNWLWCLNLLKEKSNSSNVPDENVKSTINTIDIMLNDMKRSASYGKDKKHTKENNMVQGD 624

Query: 537 V--IPMFISYLFW------------NAGSKFSTLPKDCRLPSQLESEIRKYKDMYAQI-K 581
           +   P  +S L+W            N    F  L K  +      +   K    + ++ +
Sbjct: 625 IGFYPKEVSKLYWKINSTNIAKWRMNMKGDFFHLLKYSKTAEPNHTMDIKLNRFFNELGR 684

Query: 582 PGRKLRLHQEQSTVVLQLHFADKRVMDFE-VSMDKSSVLA--CVAETTGISRDKIVE-AT 637
            G+K+ L++++S + +++ F D R + F+ +++++  VL+   V +    + +K  +  +
Sbjct: 685 KGKKMELYKDKSLMEMKISFDDGRELFFDNITIEQYDVLSLFTVEKGAAFTLEKAYDFFS 744

Query: 638 GLE--KAQVDQNLRFWLDASVLRFDSKTSLYSSLERQD-TDNASERE------------- 681
           GL+  K ++++ ++FW+D  VL  D     Y  LER    D   +R+             
Sbjct: 745 GLKRGKQKLEECIQFWVDKKVLYLDDDDGCYKVLERLTFLDEIKQRKKMQEETVIKSDAR 804

Query: 682 -------AQMRAEDQARSAFDSQQ-------QQFVESMEKVWPFIRGMLTNLGTLKVEKI 727
                   Q  AED   + F++ +        +    +++++PFI GML NLG++K+EKI
Sbjct: 805 MGIDHDYVQEAAEDDDIAGFETHKDVISRANDEIKNILDRIFPFINGMLENLGSMKLEKI 864

Query: 728 HSFLKVAVPKEIGFN-ATTAQLEAYLRLLVDENKLVCSANNAFK 770
           HSFLK+ VP++  +N     QLE YL  LV++ KL  + + AFK
Sbjct: 865 HSFLKMTVPRDFEYNRIAIHQLENYLNGLVEDEKLETTTDGAFK 908

>KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]
           {ON} weakly similar to uniprot|Q7LGV7 Saccharomyces
           cerevisiae YLR127C
          Length = 697

 Score =  177 bits (448), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 166/646 (25%), Positives = 296/646 (45%), Gaps = 53/646 (8%)

Query: 14  LHE-LLRGHDITVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKILINENGNGPALT 72
           LHE +L      ++++++ VL W+NP       Q + P+LR+K  +K+++ ++       
Sbjct: 11  LHEKILLNLASNLEEEVDMVLAWLNPT-----FQPQIPTLRIKQCLKVVLEQSDERTRF- 64

Query: 73  DILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLFNREEWAEEINGLRNY 132
            ++ QY +   R HFF  +  + ++KD+ KLE+ Y   + F+   +     EE+   +  
Sbjct: 65  -LIEQYYLTLIRTHFFLQFDDIVNWKDMIKLEKLYISKVEFMFGTSVYWIKEEMISFKRL 123

Query: 133 LISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLLTHLLVDAVLSKVKAFAL 192
           L+ KN  F +    +L   +L++D     ++Y+WL  A         V  +  KV   + 
Sbjct: 124 LMKKNNEFRKQLHAKLESHILDNDLVRFDQMYQWLAPAFDGQEIEFNVRIINLKVDQMSQ 183

Query: 193 KHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTNEIYRCFEEEFIRIRTQQ 252
           K M+     R++ +  YN FI  +WS  S++L   EDDH++T  IY+ FE+ +I+ +  +
Sbjct: 184 KLMKNKIDDRYLVMNTYNHFIKDFWSKFSKLL-IIEDDHELTAIIYQSFEKNYIKYKCDE 242

Query: 253 AFKIFVTGYPESEPTLLELRSVLKTPAKY--TQLVTELLSQFEARMLNPSITTAEILLSY 310
            +   V  +P S   LLELRS+L    K   T+++  L   F +R L  S+ T EIL  Y
Sbjct: 243 FYTDIVPKFPASRKCLLELRSILNKDIKTVGTKVLETLYHGFVSRFLTSSLLTCEILYYY 302

Query: 311 VKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGLD-------ASETRGP 363
           +K +K +  ID      + L+  VR +L  R D + T L  +           AS T G 
Sbjct: 303 IKTVKCLKIIDPMGICLRSLSKAVRVYLNPRPDIIKTLLLGIFPFQNNERFKIASSTDG- 361

Query: 364 KPTGAHASIASQLSAELKD-SHQPIFRSALDKSAQSPVDDMASVNPKEPVYQQVINFYLH 422
             +  H     Q S E+ D S  P   +AL    Q P     + +  + + +Q    YL+
Sbjct: 362 --SSVHLEKLEQFSREVGDFSMGPELPTALPWFNQ-PHLPRCTYDGDDQLLKQ----YLN 414

Query: 423 WTPEPSDSIQANNSDTLMNKG-------LFDIIVELFDSKDIIIGEXXXXXXXXXXXXXG 475
           W PEP   I+ +  D   N G       L  +++++ +SK  ++ +              
Sbjct: 415 WVPEPP-RIKLDVEDFADNDGKYVPPVDLIHVLLDVLESKRTLVDDLLGVVSGKFIESEE 473

Query: 476 YRLEQNWVKSLKILKNRFDFKN----YSNAQGVSNINNIDVMLRDVKHSEELCAQMHSVP 531
           Y L+  W + + I+ N  +        S    ++++N++D+ML D++ S +   Q+    
Sbjct: 474 YSLDPEWQRIMDIILNHLEGTRKGTVTSEEADLTHLNDVDIMLEDLRLSSQFRNQVAHKN 533

Query: 532 EISREVIPM--FISYLFW----NAGSKFSTLPKDCRLPSQLESEIRKYKDMYAQIKPGRK 585
               E  P    +S L+W    N   +  T     +  S++E  I+K   +Y ++  GR 
Sbjct: 534 NSHFENFPHIKILSKLYWRHYQNLNGRLVT--TKYKWDSEMEPLIQKLTKVYERLNTGRT 591

Query: 586 LRLHQEQSTVV---LQLHFADKRVMDFEVSMDKSSVLACVA-ETTG 627
           L+     S+ V   +     ++R   F+V+M++  V++    ET G
Sbjct: 592 LKFDTGSSSRVSINIVTKSGERRF--FKVTMEQYLVISHFQNETNG 635

>KLLA0C18282g Chr3 complement(1614045..1616252) [2208 bp, 735 aa]
           {ON} similar to uniprot|P53202 Saccharomyces cerevisiae
           YGR003W
          Length = 735

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 503 GVSNINNIDVMLRDVKHSEELCAQMHSVPEISREVIPMFISYLFWNAGSKFSTLPKDCRL 562
           G S  + +  MLRD+ HS     Q +     +R++    ++ +FW      S + +D  +
Sbjct: 456 GTSYTSKLRGMLRDL-HSSNTFMQKNGKLSKTRDISVNVLTNMFWPLQG--SDMNRDVIV 512

Query: 563 PSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLHFADKRVMDFEVSMDKSSVLACV 622
           P    +   +Y++ YA+   GR L  +   STV +   F +    +  + M    +    
Sbjct: 513 PDSFAAIRNEYENRYAKTHSGRLLEWNYHLSTVEIAYQFRNS-YHELSMPMFSGIIFMLF 571

Query: 623 AETTGISRDKIVEATGLEKAQVDQNL 648
            E   ++ D+IVE T L + +V +NL
Sbjct: 572 KEHESLTFDEIVELTNLPQQEVRKNL 597

>ADR106W Chr4 (894779..897175) [2397 bp, 798 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL132W (CDC53)
          Length = 798

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 64/141 (45%), Gaps = 6/141 (4%)

Query: 510 IDVMLRDVKHSEELC----AQMHSVPEISREVIPMFISYLFWNAGSKFSTLPKDCRLPSQ 565
           I  M +DV+ S++L     +Q+ S P+ S+E  P F  ++       F     + +LP +
Sbjct: 513 ITKMFQDVRLSKQLGQEFDSQIKSEPDYSKERYPEFQPFVLAETMWPFPYQEVEFKLPQE 572

Query: 566 LESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLHFA--DKRVMDFEVSMDKSSVLACVA 623
           L +E +K  D+Y +   GR L+     S   L+       +    F V++ + ++L    
Sbjct: 573 LVAEHQKLVDLYVKKHSGRVLKWLWPLSRSELRADIGRPGRPPFHFTVTLFQMAILLMFN 632

Query: 624 ETTGISRDKIVEATGLEKAQV 644
           E   +S ++I E T L    +
Sbjct: 633 ENDTLSFEQIQEGTNLTTQHI 653

>Skud_15.40 Chr15 (71837..73318) [1482 bp, 493 aa] {ON} YOL112W
           (REAL)
          Length = 493

 Score = 35.0 bits (79), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 47/86 (54%), Gaps = 6/86 (6%)

Query: 237 IYRCFEEEFIRIRTQQAFKIFVTGYP-----ESEPTLLELRSVLKTPAKYTQLVTELLSQ 291
           I +  E EF+  ++Q+ F+ + + YP     +++ T  +L++ +KT  +    + +++  
Sbjct: 378 ILKLSESEFLESKSQKLFRQY-SSYPFGSGADTDSTFKKLKNKIKTQEEADMEILQVIQN 436

Query: 292 FEARMLNPSITTAEILLSYVKAIKSI 317
           F  R+LNP+    ++L+    A+ SI
Sbjct: 437 FPKRLLNPNEIFEKVLMKKKMALNSI 462

>AFR498W Chr6 (1337669..1339852) [2184 bp, 727 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR003W (CUL3)
          Length = 727

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 45/101 (44%), Gaps = 2/101 (1%)

Query: 503 GVSNINNIDVMLRDVKHSEELCAQMHSVPEISREVIPM-FISYLFWNAGSKFSTLPKDCR 561
           G+   +N++ MLRDVK S+   A+  +    +     M  ++  FW    +  TL +D  
Sbjct: 451 GIHYTSNLEGMLRDVKLSQGYSAKFSAPAAAAGAAYQMDVLTPTFW-PFQQVETLAQDIT 509

Query: 562 LPSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLHFA 602
           L  +L +    Y+ +Y     GR+L+      +V +   F 
Sbjct: 510 LSDELAAARSSYEGLYVSQHSGRRLKWEYNLGSVRIGHQFG 550

>YOL112W Chr15 (106710..108188) [1479 bp, 492 aa] {ON}
           MSB4GTPase-activating protein of the Ras superfamily
           that acts primarily on Sec4p, localizes to the bud site
           and bud tip, has similarity to Msb3p; msb3 msb4 double
           mutation causes defects in secretion and actin
           organization
          Length = 492

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 44/85 (51%), Gaps = 4/85 (4%)

Query: 237 IYRCFEEEFIRIRTQQAFKIFVT----GYPESEPTLLELRSVLKTPAKYTQLVTELLSQF 292
           I +  E EF+  ++Q+ F+ + +    G  +S+ T   L++ +KT  +    + +++  F
Sbjct: 378 ILKLSESEFLESKSQKLFRQYSSYTFGGSNDSDSTFKRLKNKIKTQEEADMEILQVIQNF 437

Query: 293 EARMLNPSITTAEILLSYVKAIKSI 317
             R+LNP+    ++L+    A+  I
Sbjct: 438 PKRLLNPNDIFEKVLMKKKVALNGI 462

>TBLA0B08750 Chr2 complement(2080873..2084043) [3171 bp, 1056 aa]
           {ON} Anc_2.402 YLR039C
          Length = 1056

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 5/40 (12%)

Query: 92  YSLCHFKDVQKLERY--YEFPLRFVRLFNREE---WAEEI 126
           Y LCH KD   +ER   Y FPL+ +R  N E+   W  EI
Sbjct: 539 YLLCHIKDAHDIERLRCYRFPLQGLRAENVEDYLFWEYEI 578

>NCAS0A05140 Chr1 (1021439..1023718) [2280 bp, 759 aa] {ON}
           Anc_4.138 YGR003W
          Length = 759

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 70/160 (43%), Gaps = 5/160 (3%)

Query: 492 RFDFKNYSNAQGVSNINNIDVMLRDVKHSEELCAQMHSV--PEISR-EVIPMFISYLFWN 548
           R+  K      GV   + ++ MLRD+  S +L     +    +I   E IP  ++   W 
Sbjct: 462 RWLIKRIKEEMGVFFTSKLEGMLRDIATSNDLSNNFKNAYADDIGNIEYIPQILTITSW- 520

Query: 549 AGSKFSTLPKDCRLPSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLHFADKRVMD 608
             S    L +D   PSQL+     ++ +Y++    R L+   + S V +   F +K   +
Sbjct: 521 PFSNSPALEEDIIFPSQLQQLKLDFEALYSKKYNQRSLKWDYQLSLVEIGYQF-EKSYHE 579

Query: 609 FEVSMDKSSVLACVAETTGISRDKIVEATGLEKAQVDQNL 648
             +S+  + +L    + + ++ + I + T + K ++   L
Sbjct: 580 LSMSVYGALILLLFEDRSSLTTEMIEDLTHIPKQELHNQL 619

>Smik_15.40 Chr15 (74711..76177) [1467 bp, 488 aa] {ON} YOL112W
           (REAL)
          Length = 488

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 44/85 (51%), Gaps = 4/85 (4%)

Query: 237 IYRCFEEEFIRIRTQQAFKIFVT----GYPESEPTLLELRSVLKTPAKYTQLVTELLSQF 292
           I +  E EF+  ++Q+ F+ + +    G  +   T  +L++ +KT  +    + +++  F
Sbjct: 378 ILKLSESEFLESKSQKLFRQYSSYTFGGNSDPVSTFKKLKNKIKTQEEADMEILQVIQNF 437

Query: 293 EARMLNPSITTAEILLSYVKAIKSI 317
             R+LNP+    ++L+    A+ SI
Sbjct: 438 PKRLLNPNDIFEKVLMKKKVALNSI 462

>Suva_6.286 Chr6 (502176..508220) [6045 bp, 2014 aa] {ON} YJL207C
           (REAL)
          Length = 2014

 Score = 32.3 bits (72), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 2/77 (2%)

Query: 294 ARMLNPSITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAML 353
           ++ L+  ++ ++I   Y  + KS+ T+    RYFQ + +F+ P L +   T V  LY +L
Sbjct: 359 SKYLDTVLSLSQIFSDYEVSNKSMNTLTRYLRYFQHMHEFILPHLSDAAKTQV--LYHIL 416

Query: 354 GLDASETRGPKPTGAHA 370
           G   S     K   A +
Sbjct: 417 GCSDSYLNSSKTDSAKS 433

>Suva_15.48 Chr15 (84625..86103) [1479 bp, 492 aa] {ON} YOL112W
           (REAL)
          Length = 492

 Score = 31.6 bits (70), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 50/99 (50%), Gaps = 6/99 (6%)

Query: 237 IYRCFEEEFIRIRTQQAFKIFVT----GYPESEPTLLELRSVLKTPAKYTQLVTELLSQF 292
           I +  E EF+  ++Q+ F+ + +    G  +++ +   L++ +KT  +    + +++  F
Sbjct: 378 ILKLSESEFLESKSQKLFRQYSSYTFGGGNDADSSYKRLKNKIKTQEEADMEILQVIQNF 437

Query: 293 EARMLNPSITTAEILLSYVKAIKSI--LTIDVSFRYFQL 329
             R+LNP+    +IL+    ++ SI   TID    Y  +
Sbjct: 438 PKRLLNPNEIFEKILMKKKISLNSINQETIDRGREYVAM 476

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,495,753
Number of extensions: 3432961
Number of successful extensions: 11179
Number of sequences better than 10.0: 50
Number of HSP's gapped: 11325
Number of HSP's successfully gapped: 54
Length of query: 776
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 658
Effective length of database: 39,950,811
Effective search space: 26287633638
Effective search space used: 26287633638
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 70 (31.6 bits)