Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.239028.318ON62953527110.0
Kwal_26.7254singletonON57053716990.0
KLTH0G12386g8.318ON58053714020.0
CAGL0M04191g8.318ON60154311211e-145
YLR120C (YPS1)8.318ON56952411071e-144
SAKL0H15664g8.318ON55651210981e-142
Suva_10.2118.318ON56651010881e-141
NCAS0B035608.318ON58655610791e-139
Skud_12.1928.318ON56952110701e-138
Smik_12.1868.318ON57251710641e-137
KNAG0I009108.318ON56951610331e-133
Suva_2.3058.318ON59750710061e-128
KLLA0E04049g8.318ON5895349911e-126
Smik_4.3888.318ON5975499901e-126
YDR144C (MKC7)8.318ON5965109861e-125
Skud_4.4038.318ON5905439781e-124
ZYRO0F10274gsingletonON5725249671e-123
NDAI0J010308.318ON6525349741e-123
ZYRO0F10230g8.318ON5805399611e-122
TDEL0F044508.318ON5245129411e-119
TBLA0H012908.318ON6675819451e-118
CAGL0E01419g8.318ON5915519061e-113
TBLA0D00140singletonON6075378981e-112
KNAG0G024108.318ON5305248861e-111
ZYRO0G02904gsingletonON5315268811e-110
ZYRO0F10252gsingletonON5514908811e-110
TPHA0A015808.318ON6003698851e-110
Kwal_33.14239singletonON6515348651e-107
Kpol_543.618.318ON5884328481e-105
ZYRO0F10318g8.319ON4865498371e-104
KNAG0E03220singletonON5405368291e-102
KLTH0F06754gsingletonON7674968451e-102
TBLA0A039108.318ON5965458251e-101
NCAS0C033008.318ON5593678161e-100
KAFR0B057108.318ON5753388171e-100
TBLA0E02630singletonON6893448231e-100
Suva_10.2128.319ON7455048057e-97
Skud_12.1938.319ON4973457841e-96
Ecym_42518.318ON5025367851e-96
KAFR0B06530singletonON5383447854e-96
KNAG0I009008.319ON5315107732e-94
Smik_12.1878.319ON5073477608e-93
KAFR0I01700singletonON5525217612e-92
YLR121C (YPS3)8.319ON5083477572e-92
SAKL0C02970gsingletonON5925427614e-92
NDAI0G026208.318ON5904367606e-92
KAFR0H023008.318ON5214397425e-90
ZYRO0E02266gsingletonON5065087222e-87
AGL192W8.318ON4993437162e-86
CAGL0E01749gsingletonON4824837082e-85
ZYRO0F10296gsingletonON5285227033e-84
CAGL0E01771gsingletonON5194846798e-81
CAGL0E01793gsingletonON5164836702e-79
KAFR0E03940singletonON6385246572e-76
CAGL0E01881gsingletonON5084836456e-76
CAGL0E01815gsingletonON5194856325e-74
Suva_9.13singletonON4645026181e-72
CAGL0E01859gsingletonON5055126184e-72
SAKL0F07172g7.182ON5424656198e-72
Suva_16.14singletonON5405136189e-72
YIR039C (YPS6)singletonON5374626092e-70
KNAG0I01200singletonON6773446015e-68
NCAS0A124607.182ON5404675909e-68
Smik_65.1singletonON3423205531e-64
CAGL0E01837gsingletonON5213665557e-63
CAGL0E01727gsingletonON5394705567e-63
KLLA0D15917g7.182ON5114705531e-62
Suva_34.1singletonON3873255422e-62
Ecym_43947.182ON5184715461e-61
SAKL0E15356gsingletonON5574855314e-59
Skud_9.1547.182ON5164825172e-57
KAFR0B06700singletonON5313425102e-56
NDAI0B017207.182ON5474994893e-53
Smik_9.1757.182ON5934814923e-53
TPHA0C008408.318ON10003485043e-53
YIL015W (BAR1)7.182ON5874394871e-52
SAKL0H00330gsingletonON5784444651e-49
Smik_5.7singletonON3042414276e-47
ZYRO0D15554g7.182ON5213534207e-44
TDEL0H026507.182ON5523494209e-44
CAGL0J02288g7.182ON5413174084e-42
KNAG0H027607.182ON5633464077e-42
AGR240W7.182ON4523303781e-38
Suva_79.1singletonON2272343294e-34
Kpol_1063.227.182ON3362232783e-26
TBLA0D045807.182ON3954372513e-22
Suva_9.1877.182ON3331652333e-20
Suva_9.186singletonOFF5431652322e-19
KLTH0D11264g8.677ON4173192106e-17
Kwal_26.88028.677ON4123182024e-16
SAKL0H06512g8.677ON4043261982e-15
KNAG0J017108.677ON4153181963e-15
ZYRO0F07392g8.677ON4183161936e-15
TBLA0B038308.677ON4133181937e-15
NDAI0E021058.677ON4083181921e-14
Smik_5.6singletonON1231121761e-14
NCAS0C013608.677ON4063171902e-14
YPL154C (PEP4)8.677ON4053181892e-14
Skud_16.1288.677ON4053181883e-14
Smik_6.3518.677ON4053181883e-14
Suva_16.1568.677ON4063181849e-14
YDR349C (YPS7)5.401ON5963141832e-13
Skud_4.6185.401ON5862861823e-13
KLLA0D05929g8.677ON4093261794e-13
KLTH0E02596g5.401ON5962241771e-12
Smik_4.6135.401ON5963131762e-12
TDEL0E022305.401ON5732281742e-12
TPHA0D012608.677ON4193151713e-12
KAFR0H024208.677ON4163091696e-12
Suva_62.1singletonON2522131647e-12
Ecym_23968.677ON4153111661e-11
Suva_2.5205.401ON5983041681e-11
KLLA0F22088g5.401ON5582451572e-10
TDEL0A062308.677ON4083211553e-10
Kpol_1072.158.677ON3993201553e-10
AGR407CsingletonON2682961471e-09
Kwal_55.200345.401ON5932611493e-09
Ecym_13245.401ON5762761441e-08
ZYRO0A06578g5.401ON7201261431e-08
ACR144W8.677ON4083141393e-08
TPHA0E019205.401ON6242561369e-08
ACR143WsingletonON3933091313e-07
CAGL0A02431g5.401ON5873311305e-07
Kpol_1013.68.677ON4023161261e-06
SAKL0G07524g5.401ON6322231281e-06
TBLA0H016805.401ON6092471271e-06
NDAI0C046105.401ON6091971252e-06
YGL258W-AsingletonON77431122e-06
KAFR0E040805.401ON5964671224e-06
NCAS0F031505.401ON6454751208e-06
Kpol_1059.335.401ON6621261162e-05
CAGL0M02211g8.677ON4153231135e-05
KNAG0C051405.401ON5982581126e-05
Smik_67.1singletonON11052992e-04
ACR150W5.401ON5532631082e-04
YGL259W (YPS5)singletonON16544830.078
SAKL0D01408gna 1ON50627699.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23902
         (629 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {...  1048   0.0  
Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C...   659   0.0  
KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} simi...   544   0.0  
CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa] ...   436   e-145
YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON} ...   431   e-144
SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} simi...   427   e-142
Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {...   423   e-141
NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {O...   420   e-139
Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {...   416   e-138
Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {...   414   e-137
KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON}              402   e-133
Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON...   392   e-128
KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} simila...   386   e-126
Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON...   385   e-126
YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}  ...   384   e-125
Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON...   381   e-124
ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {...   377   e-123
NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON}             379   e-123
ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {...   374   e-122
TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {O...   367   e-119
TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.3...   368   e-118
CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} simila...   353   e-113
TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON}                350   e-112
KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {O...   345   e-111
ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} simila...   343   e-110
ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {...   343   e-110
TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.3...   345   e-110
Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144...   337   e-107
Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {O...   331   e-105
ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {...   327   e-104
KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {O...   323   e-102
KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly...   330   e-102
TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {O...   322   e-101
NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON}              318   e-100
KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa] ...   319   e-100
TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {O...   321   e-100
Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {...   314   7e-97
Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {...   306   1e-96
Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}...   306   1e-96
KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON}            306   4e-96
KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON}              302   2e-94
Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {...   297   8e-93
KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {O...   297   2e-92
YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON} ...   296   2e-92
SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some s...   297   4e-92
NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A   297   6e-92
KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.3...   290   5e-90
ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {...   282   2e-87
AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic ho...   280   2e-86
CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {...   277   2e-85
ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {...   275   3e-84
CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {...   266   8e-81
CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {...   262   2e-79
KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON}              257   2e-76
CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} simila...   253   6e-76
CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {...   248   5e-74
Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)   242   1e-72
CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {...   242   4e-72
SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {...   243   8e-72
Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C (...   242   9e-72
YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}  ...   239   2e-70
KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON}              236   5e-68
NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa] ...   231   9e-68
Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)       217   1e-64
CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {...   218   7e-63
CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} simila...   218   7e-63
KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]...   217   1e-62
Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR0...   213   2e-62
Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar t...   214   1e-61
SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weak...   209   4e-59
Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W ...   203   2e-57
KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa] ...   201   2e-56
NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {O...   192   3e-53
Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W ...   194   3e-53
TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8....   198   3e-53
YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspart...   192   1e-52
SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON...   183   1e-49
Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)       169   6e-47
ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]...   166   7e-44
TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.1...   166   9e-44
CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa] ...   161   4e-42
KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.1...   161   7e-42
AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic ...   150   1e-38
Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C...   131   4e-34
Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON} (50979....   111   3e-26
TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa] ...   101   3e-22
Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W ...    94   3e-20
Suva_9.186 Chr9 (310161..310220,310267..310332,310362..310451,31...    94   2e-19
KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly...    86   6e-17
Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C...    82   4e-16
SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {...    81   2e-15
KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8....    80   3e-15
ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly...    79   6e-15
TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {O...    79   7e-15
NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}     79   1e-14
Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)        72   1e-14
NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {O...    78   2e-14
YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON} ...    77   2e-14
Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {...    77   3e-14
Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C ...    77   3e-14
Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {...    75   9e-14
YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}...    75   2e-13
Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {...    75   3e-13
KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly...    74   4e-13
KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly...    73   1e-12
Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {...    72   2e-12
TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.4...    72   2e-12
TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.6...    70   3e-12
KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {O...    70   6e-12
Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C...    68   7e-12
Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}...    69   1e-11
Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON...    69   1e-11
KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weak...    65   2e-10
TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON} Anc_8...    64   3e-10
Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {O...    64   3e-10
AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON} ...    61   1e-09
Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349...    62   3e-09
Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}...    60   1e-08
ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} simila...    60   1e-08
ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic ho...    58   3e-08
TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.4...    57   9e-08
ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic ho...    55   3e-07
CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {...    55   5e-07
Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON} (10059.....    53   1e-06
SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} simila...    54   1e-06
TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.4...    54   1e-06
NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa] ...    53   2e-06
YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protei...    48   2e-06
KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.4...    52   4e-06
NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {O...    51   8e-06
Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON} (70588....    49   2e-05
CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa] ...    48   5e-05
KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5....    48   6e-05
Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)        43   2e-04
ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic ho...    46   2e-04
YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein wit...    37   0.078
SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly...    31   9.9  

>Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {ON}
           YLR120C (YPS1) - GPI-anchored aspartic protease [contig
           171] FULL
          Length = 629

 Score = 1048 bits (2711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/535 (97%), Positives = 519/535 (97%)

Query: 1   MRISSSTAILGLAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKR 60
           MRISSSTAILGLAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKR
Sbjct: 1   MRISSSTAILGLAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKR 60

Query: 61  VKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKS 120
           VKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKS
Sbjct: 61  VKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKS 120

Query: 121 KHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTD 180
           KHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTD
Sbjct: 121 KHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTD 180

Query: 181 VPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQD 240
           VPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQD
Sbjct: 181 VPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQD 240

Query: 241 VKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKS 300
           VKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKS
Sbjct: 241 VKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKS 300

Query: 301 AYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXX 360
           AYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLH     
Sbjct: 301 AYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHGLGIT 360

Query: 361 XXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSD 420
                      PFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSD
Sbjct: 361 LNDTNTTITTTPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSD 420

Query: 421 ELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYD 480
           ELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYD
Sbjct: 421 ELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYD 480

Query: 481 LENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535
           LENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFTI
Sbjct: 481 LENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/25 (100%), Positives = 25/25 (100%)

Query: 605 VAGVMLPESYSVLSGLFFLVAAILT 629
           VAGVMLPESYSVLSGLFFLVAAILT
Sbjct: 605 VAGVMLPESYSVLSGLFFLVAAILT 629

>Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C
           (YPS1) - GPI-anchored aspartic protease [contig 47] FULL
          Length = 570

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/537 (62%), Positives = 396/537 (73%), Gaps = 27/537 (5%)

Query: 1   MRISSSTAILGLAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKR 60
           M+ S+S A L ++GLVSSTA+S +    QD SK+V++SFDKLRGD  E+AR G +PR + 
Sbjct: 1   MKFSASAAFLAISGLVSSTAVSLQEIEPQDVSKYVRISFDKLRGDTAEDARVGLMPRAEL 60

Query: 61  VKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKS 120
           VKR DG+ + +I NQ+ FYSV +GVGSPAQ+VTLLIDTGSSD+WVMGSNNP+CEGSS  S
Sbjct: 61  VKRADGSETIKIKNQNNFYSVEVGVGSPAQNVTLLIDTGSSDMWVMGSNNPFCEGSSRSS 120

Query: 121 KHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTD 180
           KHVLL E+ G ED+T  KDF+S   S LTAT T+  S S  A                  
Sbjct: 121 KHVLLGENIGLEDETVKKDFFSSFRSLLTATATSTVSASAVA------------------ 162

Query: 181 VPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQD 240
            P+ TS+ +  AT+SCS YGTFAT SSSSFKSN T F IQYGDL+YALG WG DDVTLQD
Sbjct: 163 -PSRTSVAASDATLSCSSYGTFATGSSSSFKSNNTDFYIQYGDLTYALGTWGHDDVTLQD 221

Query: 241 VKVSDISLAVANISNSTFGVLGIGLPGLEVTN--ALAESPSDAYTYKNFPAMLVDQGKIR 298
           + VSD+S+AVAN SNSTFGVLGIGL GLEVTN  +L  S   AYTY+N PA+LVDQGKI 
Sbjct: 222 ITVSDLSMAVANESNSTFGVLGIGLTGLEVTNVGSLVSSSRSAYTYQNLPALLVDQGKIH 281

Query: 299 KSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXX 358
           ++AYSLF++DL+A HGSVLFGAVDHSKYTG L T+PLVN  KS+  P PIQ DVTL    
Sbjct: 282 QNAYSLFLDDLDAEHGSVLFGAVDHSKYTGNLYTVPLVNIYKSSGFPDPIQLDVTLQGLG 341

Query: 359 XXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISD 418
                        P PALLDSGTT T+LP  +V +IA++L+A+Y  + G+Y  +C E+SD
Sbjct: 342 MSANKTNITFTTTPIPALLDSGTTLTYLPSSMVQSIARRLSAQYSYDVGYYVLECSEVSD 401

Query: 419 SDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVV 478
           SDELVFDFGGFHIKSKL NF +         ++ CAL L+P +    ILGDNFLTAAYVV
Sbjct: 402 SDELVFDFGGFHIKSKLQNFLIKA------SSNFCALGLVPQSSSRAILGDNFLTAAYVV 455

Query: 479 YDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535
           YDLENLE+SMAQAN DGGSEDIE I ST+P AVKAPGYSSTW+S IPISTGGNIFT+
Sbjct: 456 YDLENLEVSMAQANYDGGSEDIEVISSTIPGAVKAPGYSSTWSSRIPISTGGNIFTV 512

 Score = 34.3 bits (77), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 17/23 (73%)

Query: 606 AGVMLPESYSVLSGLFFLVAAIL 628
           AGVM P +YSVLSGLF  V A L
Sbjct: 547 AGVMTPGTYSVLSGLFLFVGAAL 569

>KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/537 (55%), Positives = 374/537 (69%), Gaps = 17/537 (3%)

Query: 1   MRISSSTAILGLAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKR 60
           M++ S++  L   GL S+  +S+  + +Q  SKFVK+SFDKLRGD  E+A AG +     
Sbjct: 1   MKLLSTSTFLAACGLASAAVVSSRDEGAQSASKFVKVSFDKLRGDTAEDATAGAVAHGVL 60

Query: 61  VKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCE-GSSGK 119
            KR DG+ +  I NQ TFYSV +GVGSPAQ+VTLLIDTGSSD+WVMGSNNPYCE GSSG 
Sbjct: 61  AKRADGSETVVIKNQQTFYSVELGVGSPAQNVTLLIDTGSSDMWVMGSNNPYCEGGSSGN 120

Query: 120 SKHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDT 179
           SKHVLL +     D+   +D++S L S+LTAT TA  + +  AT +              
Sbjct: 121 SKHVLLGDHVDSRDEEVNRDWFSTLRSFLTATATATATATATATGSA---------DSGG 171

Query: 180 DVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQ 239
           + P+ TS++S  AT++CS YGTFATDSSSSF+SN T F I+YGD +YALG WGRD+VTLQ
Sbjct: 172 NAPSRTSVNSQYATLTCSSYGTFATDSSSSFQSNNTAFYIEYGDSTYALGTWGRDNVTLQ 231

Query: 240 DVKVSDISLAVANISNSTFGVLGIGLPGLEVTN-ALAESPSDAYTYKNFPAMLVDQGKIR 298
           D+ +S IS+AVAN SNSTFGVLGIGL  LEVTN     +  ++YTY+N PA +V +G I 
Sbjct: 232 DITLSGISMAVANESNSTFGVLGIGLAALEVTNVGTLATRGNSYTYENLPAKMVSEGIIH 291

Query: 299 KSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXX 358
           K+AYSLF++ L+A  GSVLFGAVDHSKYTG+L T+PL NS KS     PIQ +VTL    
Sbjct: 292 KNAYSLFLDSLDAKEGSVLFGAVDHSKYTGSLYTLPLSNSYKSMGYSDPIQLEVTLQGFG 351

Query: 359 XXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISD 418
                        P  ALLDSGTT T+LP  LV  +A K  A Y    G+Y   C ++ D
Sbjct: 352 MTANNTNSTFTTTPLTALLDSGTTLTYLPTTLVRQVAAKYGARYDSSYGYYLLSCSDVKD 411

Query: 419 SDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVV 478
           +DELVFDFGGFHI SK++NF +         +++CAL LIP +   +ILGDNFLTAAYVV
Sbjct: 412 TDELVFDFGGFHINSKVENFLIRA------TSNICALGLIPQSSSSLILGDNFLTAAYVV 465

Query: 479 YDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535
           YDL+NLEIS+AQAN DGGS +IE I S+VPSAVK P YSSTW++++PISTGGNIFT+
Sbjct: 466 YDLDNLEISLAQANYDGGSSNIEVISSSVPSAVKGPSYSSTWSTSVPISTGGNIFTV 522

>CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa]
           {ON} similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 601

 Score =  436 bits (1121), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 255/543 (46%), Positives = 335/543 (61%), Gaps = 37/543 (6%)

Query: 12  LAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKRV-KRDDGTASF 70
           L  L S  A S  AK   D S +VKL FDK  G+  E A+ G+     RV KR +G    
Sbjct: 6   LCMLASVAAHSKAAKNVADLS-YVKLDFDKYYGETFETAKRGRSQADIRVNKRANGYEEV 64

Query: 71  EIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKS-KHVLLHED- 128
           +I NQ++FYSVT+ VG+P Q V +L+DTGSSD+W+ GS+NPYC GS+G S K++LL  + 
Sbjct: 65  QITNQNSFYSVTLEVGTPPQSVVVLVDTGSSDLWITGSDNPYCRGSTGTSGKNMLLEAEL 124

Query: 129 -SGFEDDTN----------GKDFYSD-LLSYLTATGTAEYSGSYWATATDVTVETTSYWP 176
               ED  +            D ++D LLS+LT +             T +T+       
Sbjct: 125 KRALEDARDIAKERTTLAPRDDEHNDGLLSWLTGSDGLLGG----QGGTTITLT------ 174

Query: 177 DDTDVPTAT-SMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDD 235
            D+  PTA  + +  +ATI+C++YGTF T  SS++ SN T F+IQYGD ++A G WG D+
Sbjct: 175 -DSAQPTAAGTSNGARATINCAKYGTFDTSKSSTWHSNDTAFMIQYGDSTFASGTWGMDN 233

Query: 236 VTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVT--NALAESPSDAYTYKNFPAMLVD 293
           + L D+ V+ +S AVAN +NST GVLGIGLP LEVT     A S    Y Y NFP +L+ 
Sbjct: 234 LHLSDLNVTGLSFAVANRTNSTVGVLGIGLPALEVTYSGRTAVSGQRPYQYDNFPLVLLR 293

Query: 294 QGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVT 353
            G I+ ++YSLF+N+ +A  GSVLFGAVDHSKY G L TIP+VN+  S     PIQF+VT
Sbjct: 294 NGAIKSNSYSLFLNNASAETGSVLFGAVDHSKYLGDLYTIPMVNTYASQGYKNPIQFEVT 353

Query: 354 LHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQC 413
           L+                  PALLDSGTT T+LP  LV+ I +KL A Y +  G+Y + C
Sbjct: 354 LNGLGISSSSDNTTITTTKIPALLDSGTTLTYLPQALVTRIVQKLQATYSNRAGYYVFSC 413

Query: 414 DEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLT 473
              SD  E+VFDFGGFHI + + NF + +  D       C L ++P + G IILGD+FL 
Sbjct: 414 PSQSDDTEVVFDFGGFHINAPITNFIIGSSGDS------CILGIMPQSGGGIILGDSFLN 467

Query: 474 AAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTS-AIPISTGGNI 532
           +AYVVYDLEN EISMAQAN  GG EDIE I S+VP AV+APG+SSTW++ A   +T G+I
Sbjct: 468 SAYVVYDLENYEISMAQANYAGGQEDIEVISSSVPGAVRAPGFSSTWSTLATSFNTQGDI 527

Query: 533 FTI 535
           FT+
Sbjct: 528 FTV 530

>YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON}
           YPS1Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 569

 Score =  431 bits (1107), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 251/524 (47%), Positives = 333/524 (63%), Gaps = 35/524 (6%)

Query: 21  ISAEAKYSQD-ESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFY 79
           I A  K   D  SKFVKL F KL GD +EN  + + P V+ +KR DG     I NQ +FY
Sbjct: 24  IPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFY 83

Query: 80  SVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSS-GKSKHVLLHEDSGFEDDTNGK 138
           SV + VG+P Q+VT+L+DTGSSD+W+MGS+NPYC  +S G S+  ++ +    +D ++G 
Sbjct: 84  SVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKR---DDSSSGG 140

Query: 139 DFYSDL--LSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTAT-SMDSYQATIS 195
              +D+    +LT TG+A        TAT +   +           TAT S+ + +AT+ 
Sbjct: 141 SLINDINPFGWLTGTGSA-----IGPTATGLGGGSG----------TATQSVPASEATMD 185

Query: 196 CSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISN 255
           C +YGTF+T  SS+F+SN T F I YGD ++A G +G D + L D+ V+ +S AVAN +N
Sbjct: 186 CQQYGTFSTSGSSTFRSNNTYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETN 245

Query: 256 STFGVLGIGLPGLEVT--NALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATH 313
           ST GVLGIGLP LEVT   + A     AY Y NFP +L + G I+ + YSL++ND +A H
Sbjct: 246 STMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMH 305

Query: 314 GSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXX-XXXXXXXXXXXP 372
           G++LFGAVDHSKYTGTL TIP+VN++ ++    PIQFDVT++                  
Sbjct: 306 GTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGISDSGSSNKTLTTTK 365

Query: 373 FPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIK 432
            PALLDSGTT T+LP  +VS IA +L A+Y    G+Y   C    DS E+VFDFGGFHI 
Sbjct: 366 IPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPS-DDSMEIVFDFGGFHIN 424

Query: 433 SKLDNFALATYDDDDNETDVCALALIPYNRGE-IILGDNFLTAAYVVYDLENLEISMAQA 491
           + L +F L+T          C L +IP +     ILGD+FLT AYVVYDLENLEISMAQA
Sbjct: 425 APLSSFILST-------GTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQA 477

Query: 492 NLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535
             +  SE+IE I S+VPSAVKAPGY++TW+++  I TGGNIFT+
Sbjct: 478 RYNTTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTV 521

>SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 556

 Score =  427 bits (1098), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 236/512 (46%), Positives = 308/512 (60%), Gaps = 31/512 (6%)

Query: 33  KFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDV 92
           K+V L FDK RG   E +     P     KRDDG    E+ NQ +F+SV + +G+P Q+V
Sbjct: 27  KYVSLPFDKSRGSTYEESSKHNKPYAVLSKRDDGFQEIELKNQVSFFSVELEIGTPRQNV 86

Query: 93  TLLIDTGSSDIWVMGSNNPYCE-GSSGKSKHVLLHEDSGFEDDTNGK-------DFYSDL 144
           T+L+DTGSSD+WV GSNNPYC  GS G  ++            +N K       D  S +
Sbjct: 87  TVLVDTGSSDLWVTGSNNPYCRAGSVGNRRNDASSGSGSGSGSSNNKKRVNIKRDEISSV 146

Query: 145 LSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSEYGTFAT 204
            S+LTA+GT   + S  A+AT                  A S+ S  ATI CS+YGTF T
Sbjct: 147 RSWLTASGTNTRTQSGSASATR-----------------ANSLSSALATIDCSQYGTFNT 189

Query: 205 DSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIG 264
            +SS+F SN T F+I YGD SYA G WG+D++ L D+ +  +S AVAN +NST GVLGIG
Sbjct: 190 SASSTFSSNDTLFVIFYGDSSYAYGTWGQDELYLHDIDIGGLSFAVANQTNSTVGVLGIG 249

Query: 265 LPGLEVT-NALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDH 323
           LPGLEVT +  A S  + Y Y NFP +L     I+ +AYSLF+N  N++ GS+LFGAVDH
Sbjct: 250 LPGLEVTYSGYASSARNRYQYDNFPLILKRNNVIKANAYSLFLNSTNSSSGSLLFGAVDH 309

Query: 324 SKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTF 383
           SKY+G L T+PL+N+++S+    PIQF+V +                   PALLDSG T 
Sbjct: 310 SKYSGQLYTVPLLNTLESSGYTDPIQFEVAVQGIGVRTSGSNTTLTTTVIPALLDSGATL 369

Query: 384 THLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATY 443
           ++ P  +   IA  L+A Y    G+Y   C    D  E+++DFGGFHI SKL ++ L T 
Sbjct: 370 SYFPVQVAEMIADALDATYSSSYGYYIVDCPSSDDDTEIIYDFGGFHIASKLTDYILTT- 428

Query: 444 DDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEI 503
               N   +C L ++P N    ILGD FLT+AYVVYDL+N EIS+AQAN +GG E IE I
Sbjct: 429 ----NRPSICVLGIVPQNSNRFILGDVFLTSAYVVYDLDNFEISLAQANYEGGDEQIEVI 484

Query: 504 VSTVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535
             +VPSA+KAP YSST  S+   STGG+IFT+
Sbjct: 485 SESVPSAIKAPSYSSTRFSSASASTGGDIFTV 516

>Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {ON}
           YLR120C (REAL)
          Length = 566

 Score =  423 bits (1088), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 242/510 (47%), Positives = 324/510 (63%), Gaps = 35/510 (6%)

Query: 32  SKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQD 91
           SKFVKLSFDKL GD ++ A   + P V+  KR DG     I NQ +FYSV + VG+PAQ+
Sbjct: 37  SKFVKLSFDKLYGDSLDTAGRDKKPEVRLSKRADGYEEIIITNQQSFYSVDLEVGTPAQN 96

Query: 92  VTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDTNGKDFYSDL--LSYLT 149
           +T+L+DTGSSD+W+MGS+NPYC  S   SK+VL   D+     ++  D  +D+    +LT
Sbjct: 97  ITVLVDTGSSDLWIMGSSNPYCS-SDDSSKYVLRKRDT----SSSSGDLVNDINPFGWLT 151

Query: 150 ATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSEYGTFATDSSSS 209
            TG+   +    ATAT     T S       VP +      +AT+ C EYGTF +  SS+
Sbjct: 152 ETGSVTGA---TATATGSGTATQS-------VPAS------EATMDCEEYGTFTSSDSST 195

Query: 210 FKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLE 269
           FKSN T F I YGD ++A G +G D + L D+ V+ +S AVAN +NST GVLGIGLP LE
Sbjct: 196 FKSNNTAFEISYGDGTFAAGTFGTDVLNLSDLNVTGLSFAVANETNSTMGVLGIGLPSLE 255

Query: 270 VT--NALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYT 327
           VT   + A +   +Y Y NFP +L + G I+ +AYSL++ND +A HG++LFG VDH+KY+
Sbjct: 256 VTYSGSSASNGGKSYKYDNFPIVLKNSGAIKSNAYSLYLNDSDAKHGTILFGGVDHNKYS 315

Query: 328 GTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXX-XXXXXXXXXXXPFPALLDSGTTFTHL 386
           GTL T+ LVN++  +    PIQFD+TL+                   P LLDSGTT T+L
Sbjct: 316 GTLYTVALVNTL--SGFTSPIQFDITLNGLGIIDDNGDEKTLTTTKIPVLLDSGTTLTYL 373

Query: 387 PGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDD 446
           P  +V  IA+ + A+Y    G+Y  +C    +S E+VFDFGGFHI + L +F L+T    
Sbjct: 374 PVEMVELIAENVGAQYSSRIGYYVMECPSSDNSTEIVFDFGGFHINASLSSFILST---- 429

Query: 447 DNETDVCALALIPYNRGE-IILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVS 505
               + C L +IP +     ILGD+FLT AYVVYDLENLEISMAQA  +  SEDIE I +
Sbjct: 430 --SGNTCLLGIIPTSDSTGSILGDSFLTNAYVVYDLENLEISMAQAKYNVTSEDIEVIST 487

Query: 506 TVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535
           +VP+AVKAPGY++TW++   I+TGGNIFT+
Sbjct: 488 SVPNAVKAPGYTNTWSTTASIATGGNIFTV 517

>NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score =  420 bits (1079), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 241/556 (43%), Positives = 326/556 (58%), Gaps = 47/556 (8%)

Query: 1   MRISSSTAILGLAGLVSSTAISA--EAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRV 58
           MR+S+   I   + L ++   S   E + +   SK+V L F+KL GD  E+A   + P  
Sbjct: 1   MRLSTIKYIFSSSLLFTNILASTIPEHETTDQSSKYVILPFNKLVGDSYEDATPDKKPHF 60

Query: 59  KRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSG 118
             VKRD    +  I N+ +FYSV + +G+P+Q +T+L+DTGSSD+W+MGS+NPYC  S+ 
Sbjct: 61  ALVKRDGSYENVAIKNEQSFYSVELLIGTPSQKITVLVDTGSSDLWIMGSDNPYC-ASTS 119

Query: 119 KSKHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWP-D 177
             K+V+  +DS   D          L + +T T  ++ +G +            S+ P  
Sbjct: 120 NGKNVMRKDDSNLPDGI--------LFTEITVTNLSDLTGFF---------SDFSFIPMS 162

Query: 178 DTDVPTA-TSMDSY---------------QATISCSEYGTFATDSSSSFKSNGTQFLIQY 221
           +TD+PT  TS ++                + TI CS+YGTF  + SS+F++N T FL  Y
Sbjct: 163 ETDIPTGVTSTNTVGGPVFPTQTNNIALSERTIDCSQYGTFDKNQSSTFQTNFTSFLTSY 222

Query: 222 GDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDA 281
           GD ++A G W  D + L  + ++ +S AVAN+SNST GVLGIGLPGLE T   + S S  
Sbjct: 223 GDSTFASGTWAHDVLNLGGLNITGLSFAVANMSNSTVGVLGIGLPGLETT--YSGSTSKL 280

Query: 282 YTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKS 341
           Y Y NFP +L   G I  ++YSLF++DL+A  GSVLFGAVDH+KY G L T+P+VN + S
Sbjct: 281 YQYNNFPMLLKQSGAIDSTSYSLFLDDLDAKQGSVLFGAVDHTKYVGNLYTVPMVNILAS 340

Query: 342 AQVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAE 401
              P PIQFDVTL                  FPALLDSGTT ++ P  +V  IA++L A 
Sbjct: 341 KGYPNPIQFDVTLAGIGIQNDSKNYTVTTNKFPALLDSGTTISYFPQEVVQTIARQLGAR 400

Query: 402 YGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYN 461
           Y    GFY   C+ +S S   VFDFGGFHI   + +F L T        + C LA+ P  
Sbjct: 401 YSSALGFYAMSCNGVSSSTNFVFDFGGFHITGPVSDFLLPT------SGNTCVLAMAPQE 454

Query: 462 RGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSED--IEEIVSTVPSAVKAPGYSST 519
              I+LGD FLT AYVVYDL+N EIS+AQAN    + D  I+ I  +VPSA+KAP YS T
Sbjct: 455 SQHILLGDIFLTHAYVVYDLDNYEISLAQANTGTQNLDSNIQIISDSVPSAIKAPLYSET 514

Query: 520 WTSAIPISTGGNIFTI 535
           W+ A+PISTGGNIFT+
Sbjct: 515 WSKAMPISTGGNIFTV 530

>Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {ON}
           YLR120C (REAL)
          Length = 569

 Score =  416 bits (1070), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 237/521 (45%), Positives = 324/521 (62%), Gaps = 30/521 (5%)

Query: 21  ISAEAKYSQD-ESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFY 79
           I A +K   D  SKFVKL F KL GD  ++    + P V+ +KR DG     I NQ +FY
Sbjct: 24  IPAASKRDDDSNSKFVKLPFHKLYGDTRDDVGTDKKPEVRLLKRADGYEEIIITNQQSFY 83

Query: 80  SVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDTNGKD 139
           SV + VG+P Q+VT+L+DTGSSD+W+MGSNNPYC   S  S    +      +D ++   
Sbjct: 84  SVDLEVGTPPQNVTVLVDTGSSDLWIMGSNNPYCSSGSMSSSRRRVINKR--DDSSSSGA 141

Query: 140 FYSDL--LSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCS 197
             +D+    +LT TG+A              +  T+            S+ + +AT++C 
Sbjct: 142 LVNDINPFGWLTGTGSA--------------IGPTATGSGGGSGTATQSVPASEATMNCQ 187

Query: 198 EYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNST 257
           E+GTF T  SS+F+SN T F I YGD ++A G +G D + L D+ V+ +S AVAN +NST
Sbjct: 188 EFGTFTTSDSSTFRSNNTYFSISYGDGTFASGTFGTDILDLSDLNVTGLSFAVANETNST 247

Query: 258 FGVLGIGLPGLEVT--NALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGS 315
            GVLGIGLP LEVT   + A S    YTY NFP +L + G I+ +AYSL++ND +A HG+
Sbjct: 248 MGVLGIGLPELEVTYSGSTASSSRRPYTYDNFPMVLKNSGAIKTNAYSLYLNDSDAKHGT 307

Query: 316 VLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXX-XXXXXXXXXPFP 374
           +LFGAVDHSKY GTL T+P+VN++ ++    PIQFDVT++                   P
Sbjct: 308 ILFGAVDHSKYAGTLYTVPIVNTLSASGFSSPIQFDVTINGIGISYPDNSQKTLTTTQIP 367

Query: 375 ALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSK 434
           ALLDSGTT T+LP  +V+ IA +L+A+Y    G+Y   C   S+S ++VFDFGGFHI + 
Sbjct: 368 ALLDSGTTLTYLPQAVVAMIADELDAQYSSRLGYYVLDCPSNSNSTQIVFDFGGFHINAS 427

Query: 435 LDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLD 494
           L +F L       N  ++C L +I  +    ILGD+FLT AYVVYDL+NLEISMAQA  +
Sbjct: 428 LSSFIL-------NAGNICLLGIIATDD-TTILGDSFLTNAYVVYDLDNLEISMAQAQYN 479

Query: 495 GGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535
             +E+IE I S++PSA+KAPGY+STW+++  I TGGNIFT+
Sbjct: 480 ITNENIEVITSSIPSAIKAPGYTSTWSTSASIVTGGNIFTV 520

>Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {ON}
           YLR120C (REAL)
          Length = 572

 Score =  414 bits (1064), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 241/517 (46%), Positives = 317/517 (61%), Gaps = 46/517 (8%)

Query: 33  KFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDV 92
           KFVKL F KL GD ++N    + P     KR DG     I NQ +FYSV + VGSP Q+V
Sbjct: 40  KFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNV 99

Query: 93  TLLIDTGSSDIWVMGSNNPYC--EGSSGKSKHVLLHEDSGFEDDTNGKDFYSDL--LSYL 148
           T+L+DTGSSD+W+MGSNNPYC  +  S   + V+   D    D ++     +D+    +L
Sbjct: 100 TVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRD----DSSSSGALVNDINPFGWL 155

Query: 149 TATG-----TAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSEYGTFA 203
           T TG     TA  SG    TAT                    S+ + +AT+ C EYGTF 
Sbjct: 156 TGTGGLIGPTATGSGGSSETATQ-------------------SVPASEATMDCKEYGTFT 196

Query: 204 TDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGI 263
           T  SS+F+SN T F I YGD ++A G +G D + L D+ V+ +S AVAN +NST GVLGI
Sbjct: 197 TSDSSTFRSNNTYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGI 256

Query: 264 GLPGLEVT--NALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAV 321
           GLP LEVT   + A      + Y NFP +L + G I+ +AYSL++ND +A HG++LFGAV
Sbjct: 257 GLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAV 316

Query: 322 DHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXX-XXXXXXXXXXXPFPALLDSG 380
           DHSKYTGTL TIP+VN++ ++    PIQFDVT++                   PALLDSG
Sbjct: 317 DHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSG 376

Query: 381 TTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFAL 440
           TT T+LP  +V+ IA ++ A+Y    G+Y   C    DS ++VFDFGGFHI + L +F L
Sbjct: 377 TTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPS-DDSTQIVFDFGGFHINASLSSFIL 435

Query: 441 ATYDDDDNETDVCALALIPY--NRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSE 498
           +T          C L +IP   N G  ILGD+FLT AYVVYDL+NLEISMAQA  +  +E
Sbjct: 436 ST-------GSTCLLGIIPTSDNTGT-ILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTE 487

Query: 499 DIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535
           +IE I S++PSAVKAPGY++TW+++  I TGGNIFT+
Sbjct: 488 NIEVISSSIPSAVKAPGYTNTWSTSATIVTGGNIFTV 524

>KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  402 bits (1033), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 232/516 (44%), Positives = 293/516 (56%), Gaps = 51/516 (9%)

Query: 57  RVKRVKRD--DGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCE 114
           R    KRD  DG +  ++ NQ +FYSV + +G+P Q VT+L+DTGSSD+WVMG++NP C 
Sbjct: 2   REWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCA 61

Query: 115 GSSGKSKHVLLHEDSGFEDDTNGKDFY------------------------SDLLSYLTA 150
                 K +    D+  E +   KD +                         DL S  T 
Sbjct: 62  SGRRGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWTM 121

Query: 151 TGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSEYGTFATDSSSSF 210
              AE +     T T+  V T         VP  T+  + +AT+ CS YGTF    SS+F
Sbjct: 122 MTGAENTMMMTGTGTETAVAT--------GVPARTTDSAAEATVQCSTYGTFDHSKSSTF 173

Query: 211 KSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEV 270
           KSN T F I YGD SYA G WG D +++  + VS +S AVAN SNS+ GVLGIGLPGLEV
Sbjct: 174 KSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEV 233

Query: 271 TNAL----------AESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGA 320
           TN L          A + S  Y Y NFP +L + G I K AYSLF+ND     GSVLFGA
Sbjct: 234 TNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGA 293

Query: 321 VDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSG 380
           VDHSKYTGTL T+PLV+    +   KP++FD+TL+                  PALLDSG
Sbjct: 294 VDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSG 353

Query: 381 TTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFAL 440
           TT ++ P  L + IA+K NA Y    GFY   C   + +  LVFDFGGFHI + LD+F +
Sbjct: 354 TTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVV 413

Query: 441 ATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGG-SED 499
                    +  C LA+ P     ++LGD FL+ AYVVYDLENLE+SMAQAN D    E 
Sbjct: 414 ------QQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPES 467

Query: 500 IEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535
           +E I STVPSAVKA  YS+ W+SA+ +STGGNIFT+
Sbjct: 468 VEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIFTV 503

>Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  392 bits (1006), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 223/507 (43%), Positives = 308/507 (60%), Gaps = 29/507 (5%)

Query: 33  KFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDV 92
            +V++ F K  GD  ENA + +    + VKR D     ++ NQ++FYSV + +G+P+Q V
Sbjct: 35  NYVRIQFQKKYGDSFENASSNKKTEARLVKRGDDYEVVDLSNQNSFYSVDLDIGTPSQKV 94

Query: 93  TLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDTNGKDFYSDLLSYLTATG 152
           T+L+DTGSSD+WV GSNNPYC   SG       H  S  ++  +  +  S + S + +  
Sbjct: 95  TVLVDTGSSDLWVTGSNNPYCSTKSG-------HTSSSSKERKDEDNILSLVQSVVQSV- 146

Query: 153 TAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSEYGTFATDSSSSFKS 212
                      A++++ +TT    D T    +TS  S   TI C+ YG F +  SS+F+S
Sbjct: 147 -----------ASEISYDTTITDTDATATQDSTS--SALQTIDCTTYGVFDSSKSSTFQS 193

Query: 213 NGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVT- 271
           N T F I YGDL++A G WG D + L ++ V+ +S AVAN +NST GVLGIGL GLE T 
Sbjct: 194 NKTDFSITYGDLTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLAGLESTY 253

Query: 272 -NALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTL 330
             A   S  ++YTY NFP +L + G I+ +AYSLF+N+ NA HGS+LFGAVDH KY+G L
Sbjct: 254 SGATLSSAQESYTYNNFPMVLKNSGAIKSAAYSLFLNETNAKHGSILFGAVDHGKYSGDL 313

Query: 331 QTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXX-XXXXXXXXXPFPALLDSGTTFTHLPGY 389
            TIP++N+++      PIQF VTL                    PALLDSGTT +++P  
Sbjct: 314 YTIPIINTLQDHGYKDPIQFQVTLQGLGLAKGDSESTTITTTKIPALLDSGTTISYMPVE 373

Query: 390 LVSAIAKKLNAEYGDEDGFY-RYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDN 448
           L+  +A KL A Y  + G+Y      +  D   +VFDFGGF+I   L ++ L+     D+
Sbjct: 374 LMEMLADKLGASYSSKVGYYLMDCITDTDDDINVVFDFGGFYISGNLSSYQLSA----DS 429

Query: 449 ETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVP 508
            +DVC L   P +   +ILGDNFL+ AYVVYDL+N+EISMAQ +L G SEDI+ I  +VP
Sbjct: 430 SSDVCILGFAPQSDSTVILGDNFLSNAYVVYDLDNMEISMAQVDLSGRSEDIDVIEDSVP 489

Query: 509 SAVKAPGYSSTWTSAIPISTGGNIFTI 535
           SAVKAP YSSTW++   I +GG+IFT+
Sbjct: 490 SAVKAPSYSSTWSTDGSIVSGGDIFTV 516

>KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 589

 Score =  386 bits (991), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 242/534 (45%), Positives = 319/534 (59%), Gaps = 28/534 (5%)

Query: 8   AILGLAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGT 67
           A LG AG ++   +S   +  +   K V +SFDKLRG+    A   +       KR DG 
Sbjct: 13  ASLGSAGYITKRDVS---QVGEANKKHVFMSFDKLRGNDASEASLSKRRVGHLKKRADGY 69

Query: 68  ASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHE 127
              EIDNQ+TFYSV + +G+PAQ V +LIDTGSSD+WV GS NP+C  S   SK      
Sbjct: 70  VDVEIDNQNTFYSVDLEIGTPAQKVGVLIDTGSSDLWVPGSGNPFCSASRSSSKKKR--- 126

Query: 128 DSGFEDDTNGKDFYSDLLSYLTATGT-----AEYSGSYWATATDVTVETTSYWPDDTDVP 182
                     +D+ + L S L+  GT       Y+G   AT +  T    +     T   
Sbjct: 127 ----------QDYTALLSSLLSVFGTDVATDYTYTGIASATGSAGTQTVPTALTSGTVAA 176

Query: 183 TA-TSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDV 241
           T+  S+ S  AT+ CSE+GTF T  SSS++SN T+F I Y D ++A G WG D++ L DV
Sbjct: 177 TSIRSVPSSLATLDCSEFGTFDTSKSSSWQSNDTRFYISYADGTFADGDWGVDEIHLDDV 236

Query: 242 KVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSA 301
            V+ +S AV+N ++S FGVLGIGL G E T +   S  + Y Y NFP +L   G I K+A
Sbjct: 237 NVTGLSFAVSNYTDSQFGVLGIGLTGSESTYSGQLSTYNRYQYDNFPIVLQRNGVIEKNA 296

Query: 302 YSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXX 361
           YS+F+NDL+A  GS+LFGAVDHSKYTGTL T+P+VN+++S    + I+  +TL       
Sbjct: 297 YSVFLNDLDADSGSILFGAVDHSKYTGTLYTVPMVNALRSIGYTEQIRLSITLQGIGVTS 356

Query: 362 XXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDE 421
                      +PALLD+G TF + P  L +AIA  ++A Y    G+Y   CD  SD D 
Sbjct: 357 SYGNETVTQTKYPALLDTGATFCYFPSSLAAAIASSVSATYSSSSGYYFVDCDSGSDYD- 415

Query: 422 LVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDL 481
           LVFDFGGFHI S L ++ + T     + +  C L ++P +  EI LGD FLT+AYVVYDL
Sbjct: 416 LVFDFGGFHIISPLSDYIVTT-----SSSSQCVLGILPQSDNEITLGDAFLTSAYVVYDL 470

Query: 482 ENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535
           E LEIS+AQA+   G E IE I  +VPSAV APGYSSTW++A  +STGGNIFT+
Sbjct: 471 EELEISLAQASYTSGDEKIEVIRDSVPSAVAAPGYSSTWSTAASLSTGGNIFTV 524

>Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  385 bits (990), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 230/549 (41%), Positives = 324/549 (59%), Gaps = 53/549 (9%)

Query: 1   MRISSSTAILGLAGLVSSTAISAEAKYSQDES---KFVKLSFDKLRGDLVENARAGQIPR 57
           M++S+   ++  A L+ S+ + A++  SQ       +VK++F +  GD  E+A      R
Sbjct: 1   MKLSTIKFVVN-ALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKAR 59

Query: 58  VKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYC---- 113
            + V R D     E+ NQ++FYSV + +G+P Q VT+L+DTGSSD+WV GS+NPYC    
Sbjct: 60  ARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEG 119

Query: 114 EGSSGKS-KHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETT 172
           E +SG S KHV              KD   +L+S + +              T+++ +TT
Sbjct: 120 EDTSGSSFKHV-------------NKD---NLVSVVESV------------FTEISYDTT 151

Query: 173 SYWPDDTDVPTAT--SMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGV 230
                 T V TAT  +  S    ++C+ YGTF T  SS+F+SN T+F I YGD ++A G 
Sbjct: 152 MV----TSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGT 207

Query: 231 WGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVT--NALAESPSDAYTYKNFP 288
           WG D ++L ++ V+ +S AVAN +NST GVLGIGLPGLE T       S   +YTY NFP
Sbjct: 208 WGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFP 267

Query: 289 AMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPI 348
            +L + G I+ +AYSLF N  ++ HG++LFGAVDH KY G L TIP++N++++     PI
Sbjct: 268 MILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPI 327

Query: 349 QFDVTLH---XXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDE 405
           QF VTL                      P LLDSGTT +++P  LV  IA ++ A Y  +
Sbjct: 328 QFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPD 387

Query: 406 DGFYRYQC-DEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE 464
            G+Y   C +E+ +   L+FDFGGF+I + L NF L T    D+ ++VC L + P +   
Sbjct: 388 YGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLT----DSRSNVCILGIAPQSDPA 443

Query: 465 IILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAI 524
           IILGDNFL + YVVYDL+N+EISMA A+   G E I+ I  +VPSA+KAPGYSSTW++  
Sbjct: 444 IILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYE 503

Query: 525 PISTGGNIF 533
            I  GGN+F
Sbjct: 504 SIVPGGNMF 512

>YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}
           MKC7GPI-anchored aspartyl protease, member of the yapsin
           family of proteases involved in cell wall growth and
           maintenance; shares functions with Yap3p and Kex2p
          Length = 596

 Score =  384 bits (986), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 222/510 (43%), Positives = 296/510 (58%), Gaps = 41/510 (8%)

Query: 34  FVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVT 93
           +VK++F K  G   ENA      R + + RDD     E+ NQ++FYSV + +G+P Q VT
Sbjct: 36  YVKMNFQKKYGSSFENALDDTKGRTRLMTRDDDYELVELTNQNSFYSVELDIGTPPQKVT 95

Query: 94  LLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDTNGKDFYS---DLLSYLTA 150
           +L+DTGSSD+WV GS+NPYC   S K K            DT G  F     D L+ +  
Sbjct: 96  VLVDTGSSDLWVTGSDNPYC---STKKK------------DTTGSSFKQVNKDALASVVE 140

Query: 151 TGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSEYGTFATDSSSSF 210
           +   E S       T VT E T+         T  S  S    I C+ YGTF T  SS+F
Sbjct: 141 SVFTEIS----YDTTIVTSEATA---------TFDSTASTSQLIDCATYGTFNTSKSSTF 187

Query: 211 KSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEV 270
            SN T+F I YGD ++A G WG D ++L D+ ++ +S AVAN +NST GVLGIGLPGLE 
Sbjct: 188 NSNNTEFSIAYGDTTFASGTWGHDQLSLNDLNITGLSFAVANETNSTVGVLGIGLPGLES 247

Query: 271 T--NALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTG 328
           T       S   +YTY NFP +L + G I+ +AYSLF ND ++ HG++LFGAVDH KY G
Sbjct: 248 TYSGVSLSSVQKSYTYNNFPMVLKNSGVIKSTAYSLFANDSDSKHGTILFGAVDHGKYAG 307

Query: 329 TLQTIPLVNSIKSAQVPKPIQFDVTLH---XXXXXXXXXXXXXXXXPFPALLDSGTTFTH 385
            L TIP++N+++      PIQF VTL                      P LLDSGTT ++
Sbjct: 308 DLYTIPIINTLQHRGYKDPIQFQVTLQGLGTSKGDKEDNLTTLTTTKIPVLLDSGTTISY 367

Query: 386 LPGYLVSAIAKKLNAEYGDEDGFYRYQC-DEISDSDELVFDFGGFHIKSKLDNFALATYD 444
           +P  LV  +A ++ A Y    G+Y   C  E+ +   ++FDFGGF++ + L +F L T  
Sbjct: 368 MPTELVKMLADQVGATYSSAYGYYIMDCIKEMEEESSIIFDFGGFYLSNWLSDFQLVT-- 425

Query: 445 DDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIV 504
             D+ +++C L + P +   IILGDNFL   YVVYDL+N+EISMAQAN     E IE I 
Sbjct: 426 --DSRSNICILGIAPQSDPTIILGDNFLANTYVVYDLDNMEISMAQANFSDDGEYIEIIE 483

Query: 505 STVPSAVKAPGYSSTWTSAIPISTGGNIFT 534
           S VPSA+KAPGYSSTW++   I +GGN+F+
Sbjct: 484 SAVPSALKAPGYSSTWSTYESIVSGGNMFS 513

>Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON}
           YDR144C (REAL)
          Length = 590

 Score =  381 bits (978), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 229/543 (42%), Positives = 314/543 (57%), Gaps = 39/543 (7%)

Query: 1   MRISSSTAILGLAGLVSSTAIS---AEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPR 57
           M+ S++T +     L SST  +   A A  +  ES +V ++F+K  GD  ENA   +   
Sbjct: 1   MKFSAATFVANAFLLYSSTVSADSIASASIATSES-YVIMNFEKKYGDSFENASNDRNAG 59

Query: 58  VKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSS 117
              V+R+D     ++ N+++FYSV + +G+P Q +T+L+DTGSSD+WV GSNNPYC  + 
Sbjct: 60  AHLVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCS-TK 118

Query: 118 GKSKHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPD 177
           GK       + S F      KD  + ++                +  T+++ +TT    +
Sbjct: 119 GK-------DTSDFSFKQIHKDNPASVVE---------------SVITEISYDTTISVIE 156

Query: 178 DTDVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVT 237
            T     T + S +  I+C  YGTF +  SS+F+SN T+F I YGD ++A G WG D + 
Sbjct: 157 ATATLDNTPLASQK--INCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLN 214

Query: 238 LQDVKVSDISLAVANISNSTFGVLGIGLPGLEVT--NALAESPSDAYTYKNFPAMLVDQG 295
           L ++ V+ +S AVAN +NST GVLGIGLPGLE T       S   +YTY NFP +L + G
Sbjct: 215 LNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSG 274

Query: 296 KIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLH 355
            I+ SAYSLF N  N+ HG++LFGAVDH KYTG L TIP++N +++     PIQF VTL 
Sbjct: 275 AIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQ 334

Query: 356 XXXXXX---XXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQ 412
                                PALLDSGTT ++LP  LV  +A K+ A Y  E G+Y   
Sbjct: 335 GIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMN 394

Query: 413 C-DEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNF 471
           C  E+     +VFDFGGFHI S L NF L T    D+ +DVC L   P +   +ILGDNF
Sbjct: 395 CIHEVKKDITVVFDFGGFHISSWLSNFQLFT----DSSSDVCILGFAPQSDPTVILGDNF 450

Query: 472 LTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGN 531
           L + Y+VYDL+N+EISMA A+     E I+ I S VPSA+KAP YS+TW++   I  GGN
Sbjct: 451 LVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGN 510

Query: 532 IFT 534
           IF+
Sbjct: 511 IFS 513

>ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 572

 Score =  377 bits (967), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 223/524 (42%), Positives = 303/524 (57%), Gaps = 21/524 (4%)

Query: 15  LVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDN 74
           L+S  +    A   Q  S  VKLSF+K  G   E +    + R     R++   +F ++N
Sbjct: 10  LLSVASTCKSALIEQTSSPMVKLSFNKWHGPTYEES---SLERRSLETRNNKEFNFIVEN 66

Query: 75  QDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDD 134
           Q  FYSV + VG+P Q++T+L+DTGSSD+W+   NNPYC+ ++G +      ED   ED 
Sbjct: 67  QQNFYSVDLLVGTPGQNITVLLDTGSSDLWLTAKNNPYCKSNAGSNDK---KEDYRLEDG 123

Query: 135 TNGKDFYSDLLSYLTA--TGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQA 192
            N       ++S LTA  TGT    GS   TA   + + T      +   T  S  S + 
Sbjct: 124 DN-----QSIVSMLTASGTGTNPIGGSGIPTAISGSAQLTGT--YTSGTGTGPSGSSPEP 176

Query: 193 TISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVAN 252
           T+ CS+YGTF  + S SF+SN T+F I YGD S+A G WG D V   ++ +  +S AVAN
Sbjct: 177 TMDCSQYGTFDVNKSKSFRSNKTEFYISYGDGSFASGYWGTDSVNFANMNLEGVSFAVAN 236

Query: 253 ISNSTFGVLGIGLPGLEVTNALAESPSD--AYTYKNFPAMLVDQGKIRKSAYSLFVNDLN 310
            +NST GV GIGLP  E T     S +D   Y Y+NFP +L  +G I K+AYSLF+N L+
Sbjct: 237 ETNSTVGVFGIGLPENEATYTPDPSLNDFHPYEYQNFPQVLKSKGAINKAAYSLFLNSLD 296

Query: 311 ATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXX 370
           A+ G +LFGAVD SKY G L T+PL+NS    +   P++FDVTL                
Sbjct: 297 ASSGDILFGAVDRSKYKGDLYTLPLLNS-DPTKYKNPMEFDVTLQGVGFTNGSSKTTFTT 355

Query: 371 XPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFH 430
              PALLDSGT+  +LP  L   IA KL   Y ++ G+Y   C   +D  +LVFDFGGF 
Sbjct: 356 TKIPALLDSGTSLIYLPDALAKGIAHKLGGSYNEDIGYYVIGCPSENDDSQLVFDFGGFT 415

Query: 431 IKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQ 490
           IK+ L N+ L + DD D+    C L ++P +  + ILGD FL  AYVVYDL++ E+S+AQ
Sbjct: 416 IKNNLSNYLLGSPDDGDDSQ--CVLGILPSDV-QAILGDVFLADAYVVYDLDDYEVSLAQ 472

Query: 491 ANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFT 534
           A+ D   EDI+ I  ++P A +APGYS TW++   I +GGNIFT
Sbjct: 473 ASFDNSKEDIQIISDSIPGAKRAPGYSKTWSTPASIKSGGNIFT 516

>NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON} 
          Length = 652

 Score =  379 bits (974), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 224/534 (41%), Positives = 304/534 (56%), Gaps = 40/534 (7%)

Query: 33  KFVKLSFDKLRGDLVENARAGQIPRVKRVKRDD----GTASFEIDNQDTFYSVTIGVGSP 88
           K+VKL F+K  GD  E+A     P  + +KRD+    G    +I NQ +FYSV + +G+P
Sbjct: 56  KYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTP 115

Query: 89  AQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLL---------------HEDSGFED 133
            Q VT+L+DTGS+D+WV GS NP+C+ SS  S++V++                + +G   
Sbjct: 116 PQHVTVLVDTGSADLWVTGSMNPFCQ-SSLNSRNVVIKRDDDDDDDDDDDDTQQAAGMFT 174

Query: 134 D---TNGKDF--YSDLLSYLTATGTAEYSGSY-WATATDVTVETTSYWPDDTDVPTATS- 186
           +   TN  D    SDLL   T   T    G       T  T            +PTAT+ 
Sbjct: 175 EILVTNLSDLGNLSDLLGSFTIISTGIPGGIIPTGVTTATTTGGGGGAGGAGGLPTATND 234

Query: 187 MDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDI 246
           +   + T+ C EYGTF +  SS+FK+N T F I YGD ++A G W +D + L D+ V+ +
Sbjct: 235 IPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGL 294

Query: 247 SLAVANISNSTFGVLGIGLPGLEVT--NALAESPSDAYTYKNFPAMLVDQGKIRKSAYSL 304
           S AVAN++NST GVLGIGLP LE T   A   +    Y Y NFP +L   G I  + YSL
Sbjct: 295 SFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSL 354

Query: 305 FVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXX 364
           F++DL+ +HGSVLFGA+DHSKYTG L T+P++N ++++    PIQFDVTL          
Sbjct: 355 FLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGER 414

Query: 365 XXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVF 424
                     ALLDSGTT ++ P  +V  +A+++NA+Y    GFY   C  +S +  LVF
Sbjct: 415 NLTLTTTKLAALLDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVF 474

Query: 425 DFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENL 484
           DFGGFHI   L +F + T          C LA+ P     +ILGD FLT AYVVYDL+N 
Sbjct: 475 DFGGFHISGPLQDFLIQT------SQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNY 528

Query: 485 EISMAQAN----LDGGSEDIEEIV-STVPSAVKAPGYSSTWTSAIPISTGGNIF 533
            I++AQA+        S DIE I  ST+P A++AP YS TWT+  P+ +GGNIF
Sbjct: 529 VIALAQADTSTSNQSSSSDIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582

>ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  374 bits (961), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 229/539 (42%), Positives = 312/539 (57%), Gaps = 31/539 (5%)

Query: 12  LAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFE 71
           LA +  S A S E +  +   K VKLSFDK  G+  E +  G+   +  VKRDDG     
Sbjct: 12  LANVARSAAFSQEVE--EQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELS 69

Query: 72  IDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGF 131
           + N+  FYSV + VGSP+Q +T+L+DTGSSD+W+ GS+NPYC+ +S  SK      D G 
Sbjct: 70  LRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKK----RDIG- 124

Query: 132 EDDTNGKDFYSDLLS------YLTATGTAEYSGSYWATATDVTVETTSYWPDDT------ 179
             D +  D +SD+ +      Y T T T     S + +   + V T    P +T      
Sbjct: 125 --DNSLDDIFSDITAGGSGAIYKTLTLTGGSMPSSFGSFGSIDVSTGGIEPTETISGGGG 182

Query: 180 --DVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVT 237
                   S  S   +I CS YGTF  + SS++KSN T F I YGD S+A G WGRD + 
Sbjct: 183 GSGGSPTGSSSSGGQSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIE 242

Query: 238 LQDVKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAES--PSDAYTYKNFPAMLVDQG 295
           L  + +SD+S+AVAN +NST GVLGIGLPGLE T +  +S    D + Y NFP +L ++G
Sbjct: 243 LGSLNISDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERG 302

Query: 296 KIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLH 355
             +K+ YSL++N  +A +GS+LFGAVD SK+ G+L TIP++N  KS  V +PIQFDVTL 
Sbjct: 303 ITKKNVYSLYLNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQ 362

Query: 356 XXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDE 415
                             PALLDSG+T  +LP  L+  +A  L A + +   +Y   C  
Sbjct: 363 GLGLSNQTSTTTLSTTKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPS 422

Query: 416 ISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAA 475
             D  ++VF+FGGF+I++ L  +           +D C L ++P      ILGD FL  A
Sbjct: 423 KHDETKIVFNFGGFNIETNLTTYTTPI------SSDTCVLRILPSGDSSAILGDAFLVHA 476

Query: 476 YVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFT 534
           YVVYDLE+ EISMAQAN D   EDIE + S++P A  A GYSST++S+  I++GGNIF+
Sbjct: 477 YVVYDLEDFEISMAQANFDVNHEDIEVVSSSIPQATAAAGYSSTYSSSKSITSGGNIFS 535

>TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {ON}
           Anc_8.318 YLR120C
          Length = 524

 Score =  367 bits (941), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 213/512 (41%), Positives = 283/512 (55%), Gaps = 51/512 (9%)

Query: 12  LAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFE 71
           ++G +  +   A +   +   K+V LSFDKLRG+  E A  G  P  +  KRDDG    E
Sbjct: 9   ISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIE 68

Query: 72  IDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGF 131
           I N+  FYS+ + +G+P+Q+VT+L+DTGSSD+WV    NPYC  S               
Sbjct: 69  IYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDS--------------- 113

Query: 132 EDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQ 191
            DDT      S   +  T++GTA  SG                             +S  
Sbjct: 114 -DDTKPVTQLS-TSTLATSSGTATSSG-----------------------------NSGI 142

Query: 192 ATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVA 251
           AT+ CSEYGTF    S+SF+SN T F I YGD ++A G WG D+  L D+ V+++S AVA
Sbjct: 143 ATVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVA 202

Query: 252 NISNSTFGVLGIGLPGLEVTNALAESPSD-AYTYKNFPAMLVDQGKIRKSAYSLFVNDLN 310
           N SNST GV+GIGL GL+ T     S S  AY Y+NFP  L  QG I ++AYSLF+N+ +
Sbjct: 203 NQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPD 262

Query: 311 ATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXX 370
           A  GSVLFGAVDHSKY+G L T+P++N  ++  +  PI+FDVT+                
Sbjct: 263 ADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDVTVQGVSVTSGSTIRNLTN 322

Query: 371 XPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFH 430
             FPALLDSGTT +++P  L   IA  + A+Y    G+Y  +C   ++   L FDFGGF 
Sbjct: 323 TQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQ 382

Query: 431 IKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQ 490
           I +       +      + +  C L +IP      I GDNFL  AYVVYDLEN EISMAQ
Sbjct: 383 ISAN----LSSYLLSSRSSSSTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQ 438

Query: 491 ANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTS 522
           A  +     IE I  ++PSAV+A GYSSTW++
Sbjct: 439 AAFNNSDSQIEVISDSIPSAVRAQGYSSTWST 470

>TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.318
           YLR120C
          Length = 667

 Score =  368 bits (945), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 233/581 (40%), Positives = 315/581 (54%), Gaps = 86/581 (14%)

Query: 24  EAKYSQDESKFVKLSFDKLRGDLVEN---------------ARAGQI------PRVKRVK 62
           + K +   S F+KL F+K   D + +                R   I      P V  +K
Sbjct: 31  DGKVNSVNSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIK 90

Query: 63  RDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKH 122
           R+DG    +I NQ +FYSV + +G+PAQ +T+L+DTGSSD+WV GS+NPYC+ +SGKS +
Sbjct: 91  RNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSGKSTN 150

Query: 123 VL-----------------------------------LHEDSGFEDDTNGKD-------- 139
           +L                                     E   F  + N ++        
Sbjct: 151 LLTPTDSDSDSDSDSQPDLESGSSSGNNDGDDGSILSWFEKFKFWKNNNKQEEVAKKNIV 210

Query: 140 FYSDLLSYLTATGTAE---YSGSYW-ATATDVTVETTSYWPDDTDVPTAT-SMDSYQATI 194
              D+L    A   +E   ++   W +TAT  T   + Y     D   AT + D+Y  T 
Sbjct: 211 IIDDVLQIKNAQADSEKPDWNPFGWGSTATATTGGNSGYQTMSLDPSQATINCDTY-GTF 269

Query: 195 SCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQD-VKVSDISLAVANI 253
              +  TF ++ +S        F I+Y D SYA G WGRD +T  D + V+ +S AVAN 
Sbjct: 270 DIEDSSTFQSNKTS--------FAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQ 321

Query: 254 SNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATH 313
           +NST GVLGIGLP LEVT +     +  Y Y NFP +L + G I KS YSL++N  NA +
Sbjct: 322 TNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAKN 381

Query: 314 GSVLFGAVDHSKYTG-TLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXP 372
           G+VLFGAVDHS+Y G TL T+PLVN   S+    PI+FD+TL                  
Sbjct: 382 GNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGVTDNTNNYTVTTTQ 441

Query: 373 FPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIK 432
             ALLDSGTT T+ P  +++ +AK +NA Y D  G+Y   C +  D+ ++VFDFGGFHI 
Sbjct: 442 IVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHIN 501

Query: 433 SKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQAN 492
           + L NF L++       +  C L L+PYN    ILGD FLT AYVVY+L++LEISMAQAN
Sbjct: 502 ANLTNFVLSS------ASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQAN 555

Query: 493 LDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIF 533
            D  +EDIE I STVP+AVKAPGYS T++++  I +GGNIF
Sbjct: 556 YDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596

>CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 591

 Score =  353 bits (906), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 224/551 (40%), Positives = 315/551 (57%), Gaps = 66/551 (11%)

Query: 12  LAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIP------RVKRVKRDD 65
           +AG V+  A++AE        K++KL F+K R D+ E     ++P      R  R +  D
Sbjct: 9   VAGCVN--AVAAE--------KYLKLDFEKHRADIDE-----ELPLTHSAARQLRKRASD 53

Query: 66  GTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLL 125
            + +F +  Q+ +YS+ + VG+P Q+V+LL+DTGSSD+WV+GSNN YC+ S  KS+++  
Sbjct: 54  DSVAFPLVAQENYYSINLEVGTPPQNVSLLLDTGSSDMWVIGSNNGYCKNSDNKSRNL-- 111

Query: 126 HEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDD-TDVPTA 184
                   D  G + ++   S + +   +  + S      D + +   ++P   +++P A
Sbjct: 112 --------DALGSNRFAKRASSVASASPSSATDSDGGDDGDDSGDAEQFYPTAASEIPAA 163

Query: 185 TSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVS 244
                   T+ C     F  + SSSFKSN T F   YGD SYA G+WG DDV L ++ ++
Sbjct: 164 AK------TLDCQSLSLFDLEKSSSFKSNSTPFFTSYGDNSYASGLWGTDDVRLGNLSIA 217

Query: 245 DISLAVANISNSTFGVLGIGLPGLE-----------VTNALAESPSDA-------YTYKN 286
           D+  AVAN SNS+ GVLG+GLP LE           V++ L  + SDA        TY N
Sbjct: 218 DVFFAVANFSNSSTGVLGVGLPALESYNPALSDNFNVSDYLPVNASDADIDNISKPTYAN 277

Query: 287 FPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPK 346
           FP +L  +  I K AYSLF+ND NAT+G +LFGAVDHSKYTG+L T+PLVNS+    +  
Sbjct: 278 FPQILKQKNVIEKVAYSLFLNDTNATNGQILFGAVDHSKYTGSLSTLPLVNSLYVEGIND 337

Query: 347 PIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDED 406
             Q ++TL                   PALLDSGTT ++LP  L S +AK+L      + 
Sbjct: 338 TTQLEITLDGMGLKNSQGQFTIYNQKMPALLDSGTTVSYLPIDLHSLVAKQLKGIVDPQT 397

Query: 407 GFYRYQ-CDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEI 465
           GF   + C   +D+ +LVF+FGG  I  K   F   +  DDDN    C +  +P     I
Sbjct: 398 GFIELKNCPAKNDNTQLVFNFGGAFISIKYTEFIEKS--DDDN----CYVTFMPQGEPGI 451

Query: 466 ILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIP 525
           +LGDNFL  AY+VYDLE++EIS+AQAN +GG+E+IE IV  VPSAVKAPGYS+++T   P
Sbjct: 452 LLGDNFLRNAYIVYDLEDMEISIAQANFNGGAENIEAIVKNVPSAVKAPGYSASFTE-FP 510

Query: 526 IS--TGGNIFT 534
            S  T GNIF+
Sbjct: 511 SSYATTGNIFS 521

>TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  350 bits (898), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 223/537 (41%), Positives = 292/537 (54%), Gaps = 64/537 (11%)

Query: 31  ESKFVKLSFDKLRGDLVENARAG-----QIPRVKRVKRDDGTASFEIDNQDTFYSVTIGV 85
           + K ++L  +K  GD   N  +        P  + VKR+DG    EI NQ  FYSV + +
Sbjct: 26  QDKVLRLDINKFYGDSKFNLGSEIDEDISTPSARLVKREDGHEIIEIQNQQAFYSVDLML 85

Query: 86  GSPAQDVTLLIDTGSSDIWVMGSNNPYC-EGSSGKSKHVLLHEDSGFEDDTNG------- 137
           G+P Q VT+L+DTGSSD+WV G+NNPYC +G+S K+    + +DS  ++  +        
Sbjct: 86  GTPPQKVTVLVDTGSSDLWVTGNNNPYCIDGTSSKAVSSNIEDDSQTKNPISKVVGTTIN 145

Query: 138 ---KDFYSDL--LSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQA 192
              K F  +L  LS+L  +G+ +Y+ S      DVT       P D             A
Sbjct: 146 KIRKYFSHNLPDLSFLEDSGSGKYNSSQLK---DVT-------PQD-------------A 182

Query: 193 TISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQD-VKVSDISLAVA 251
            I CS YGTF    SS+F SN T F+I+YGD ++A G WGRD +   D + ++D S  VA
Sbjct: 183 HIDCSTYGTFDPSKSSTFVSNDTNFMIRYGDRTFASGTWGRDSIEFSDHLNLTDFSFGVA 242

Query: 252 NISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNA 311
           +++NST  VLG+GLP LEVT +        YTY NFP  L   G I +  YSL++N   A
Sbjct: 243 DLTNSTISVLGMGLPRLEVTYSGLSLDRSPYTYANFPMALKQSGLIDRMVYSLYLNKAGA 302

Query: 312 THGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLH-XXXXXXXXXXXXXXX 370
           + GSVLFGAVDHSKY G+L TIPL+ S+  + +  PI F+V L                 
Sbjct: 303 STGSVLFGAVDHSKYHGSLNTIPLI-SLSGSGI--PIAFNVALQGLGMSSDSQGTQTFLS 359

Query: 371 XPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFH 430
            P PALLDSGTT T+LP  LV+ +A  L A + +  G Y   C   SD  E  FDFGGF 
Sbjct: 360 TPLPALLDSGTTMTYLPDALVATVASTLGASFDEAQGLYLLDCPSGSDDREFNFDFGGFQ 419

Query: 431 IKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQ 490
           I   L NF L          DVC L L   +    ILGD+FLT AYVVYDLENLEISMAQ
Sbjct: 420 ISVPLSNFILEAL------PDVCVLTLFESHAERAILGDSFLTEAYVVYDLENLEISMAQ 473

Query: 491 ANLDGGSE-DIEE-----------IVSTVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535
           A  D  ++ DIE+           + S +PSA +APGYSST  +   I   GN++ +
Sbjct: 474 ARYDDDNDSDIEKYNADNKVLLEVVTSNIPSANQAPGYSSTLINRSTIQPSGNMYAV 530

>KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score =  345 bits (886), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 204/524 (38%), Positives = 281/524 (53%), Gaps = 86/524 (16%)

Query: 20  AISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFY 79
           A+ A AK       +V + F+K  GD    A   Q P+++  KR+ G     + NQ +F+
Sbjct: 13  AVCAAAK------DYVGMRFEKKFGDNYAGATKWQRPQMRLAKRNTGYEEITLTNQQSFF 66

Query: 80  SVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDTNGKD 139
           SV + VG+PAQ+VT+L+DTGSSD+W+ G++NPYC   SG     +   D           
Sbjct: 67  SVELDVGTPAQNVTVLVDTGSSDLWITGADNPYCLTYSGSGADSIPRRDR---------- 116

Query: 140 FYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSEY 199
                         +EY G++       ++E +S W  ++  P                 
Sbjct: 117 -----------VDCSEY-GTF-------SLEDSSTWSQNSSAP----------------- 140

Query: 200 GTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFG 259
                            F I YGD ++A GVWG+D + LQDV V+ +S AVAN +NST G
Sbjct: 141 ----------------PFYITYGDTTFASGVWGQDHLHLQDVNVTGVSFAVANRTNSTVG 184

Query: 260 VLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFG 319
           V+GIGLPGLE TN    S S  YTY NFP +L + G  + + YSL++NDL    GS+LFG
Sbjct: 185 VMGIGLPGLETTN----SGSRPYTYANFPQVLKNSGATQSALYSLYLNDLEEERGSILFG 240

Query: 320 AVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXX---XXXXXXPFPAL 376
           AVDHSKYTG++ T+P++N ++S     PIQFD+TL                      PAL
Sbjct: 241 AVDHSKYTGSMYTLPIINRLQSYGYTTPIQFDITLQGIGLSSSESNGDEVTITSTKMPAL 300

Query: 377 LDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLD 436
           LDSGTT T+LP  +VS IA++L A      G Y   C  + ++  LV+DFGGFHI S L 
Sbjct: 301 LDSGTTMTYLPSNIVSQIAQQLGASMSARFGQYVLPCSNVPENMHLVYDFGGFHINSNLT 360

Query: 437 NFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGG 496
           N+ +           +C L L P +    ILGD FLT AYVVYDLENL+I +AQA     
Sbjct: 361 NYIVQA------SQTLCILGLFPRDSNTAILGDTFLTDAYVVYDLENLQIGLAQAKFGVS 414

Query: 497 SEDIEEIVST----VPSAVKAPGYSSTWTSAI-PISTGGNIFTI 535
             D +  + T    +PSA +AP YSSTW++++  ++TGGNIFT+
Sbjct: 415 DSDAKIDIVTGSAGIPSAQRAPDYSSTWSTSVGTVTTGGNIFTL 458

>ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 531

 Score =  343 bits (881), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/526 (37%), Positives = 295/526 (56%), Gaps = 59/526 (11%)

Query: 15  LVSST--AISAEAKYSQDES---KFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTAS 69
           L+S T   IS      ++E+   K VK SF+K +G     +        + + + D   +
Sbjct: 13  LLSETVQCISVRHYLEEEEASSPKLVKFSFNKHQGRTFTAS--------EELSKRDKDVT 64

Query: 70  FEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDS 129
           F++ N+  FYS+ + VG+P Q+V +L+DTGSSD+W+ GS+NPYC+ SS  S       + 
Sbjct: 65  FDLKNEQNFYSIKLSVGTPGQEVVVLLDTGSSDLWIPGSDNPYCKESSSFSI-----SNQ 119

Query: 130 GFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDS 189
           G E+   G         + T  G          TAT+++  +T+                
Sbjct: 120 GKENGAEGP--------FQTLPGG--------VTATNMSGGSTA---------------- 147

Query: 190 YQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLA 249
             AT+ C E+GTF  + S +F SN T+F + YGD SYA+G WG D + + DV ++++S+ 
Sbjct: 148 -SATLDCKEFGTFNREDSKTFHSNDTEFSVSYGDTSYAIGTWGYDSININDVNLTNVSIG 206

Query: 250 VANISNSTFGVLGIGLPGLEVTNALAESPSDAYTYK--NFPAMLVDQGKIRKSAYSLFVN 307
           VAN +NS+ G++GIGL  LE T    E+  +  T+K  NFP +L +QG I K+ YSLF+N
Sbjct: 207 VANKTNSSVGIMGIGLSNLENTYTGVENVKNRNTHKYLNFPMLLKEQGFIEKNVYSLFLN 266

Query: 308 DLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXX 367
              A  GS+LFGAVDHSKY+G L T+P++N  +   +  P+Q  VTL             
Sbjct: 267 RREAFEGSILFGAVDHSKYSGQLYTVPMLNLYQQQGLKDPLQLQVTLQGVGIEANNMTNT 326

Query: 368 XXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFG 427
               P PALLDSGTT  +LP  +++ +A++LNA +    G+Y   C  + D+  L F+FG
Sbjct: 327 TSTTPVPALLDSGTTLVYLPDKMLAMLAEQLNAHWDRGIGYYVTDCSRV-DNTNLYFNFG 385

Query: 428 GFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEIS 487
           GF+I S +  + ++  +++      C L L P      ILGD F+  AY+V+DL++ EIS
Sbjct: 386 GFNIVSNMSTYVVSRSNENS-----CVLGLQPGGPEAAILGDMFMQHAYIVFDLDDFEIS 440

Query: 488 MAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIF 533
           MAQAN  GG   +E +   VPSA+KAPGYS T++ +  I+ GGNIF
Sbjct: 441 MAQANYAGGKNQLEAVTQQVPSAMKAPGYSHTFSGSQGITGGGNIF 486

>ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {ON}
           weakly similar to YYIL015W uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 551

 Score =  343 bits (881), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/490 (41%), Positives = 272/490 (55%), Gaps = 62/490 (12%)

Query: 36  KLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLL 95
           KLSF+KLRG+  E          K V   +G A+F+I NQ  FYSV + VG+PAQ+V +L
Sbjct: 27  KLSFNKLRGETFE----------KAVGNSNGHANFDIKNQQNFYSVELKVGTPAQNVLVL 76

Query: 96  IDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAE 155
           +DTGSSD+W+ GS NPYC  S+  S                          +L + G+  
Sbjct: 77  LDTGSSDLWITGSGNPYCSPSTRNS--------------------------HLGSAGSN- 109

Query: 156 YSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGT 215
                  ++T+    +T+ +P            S  ATI CS+YGTF  D S +FKSN +
Sbjct: 110 -------SSTNNGPSSTANFP------------SSSATIDCSQYGTFNLDGSETFKSNDS 150

Query: 216 QFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVTNALA 275
            F + YGD S+A G+WG D V L  + VSD+S AVAN SNST GV G+GLPG E T    
Sbjct: 151 TFYLTYGDGSFAKGLWGMDHVYLDGLNVSDVSFAVANESNSTVGVFGVGLPGEEATVTPG 210

Query: 276 ESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPL 335
            +  + Y YKNFP +L D G ++K+AYSL++N  ++  G++LFGAVDHSKY+G L T+P+
Sbjct: 211 VN-GNHYQYKNFPQVLKDNGVVQKNAYSLYLNSPDSNSGNILFGAVDHSKYSGNLYTLPI 269

Query: 336 VNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIA 395
           VN+     V  P +FDVT+                    ALLDSGTT  +LP  L   +A
Sbjct: 270 VNTYADQGV-APREFDVTVQGITVGNSSSNSTVSSDKTLALLDSGTTLMYLPTALADELA 328

Query: 396 KKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCAL 455
           K L  ++    G+Y       +D  ++ FDFGGFHI++KL N+ L          DV  L
Sbjct: 329 KSLGGKFSPSTGYYLIPKPSENDDTKITFDFGGFHIETKLSNYIL----QGSGPQDVAIL 384

Query: 456 ALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPG 515
            ++       I GD FL  AYVVYDLE+ EIS+AQAN + GS DIE I  +VP A +APG
Sbjct: 385 GILRTEGDRAIFGDVFLVDAYVVYDLEDYEISLAQANFNSGSSDIEAISGSVPGASRAPG 444

Query: 516 YSSTWTSAIP 525
           YS T+T   P
Sbjct: 445 YSQTYTGNQP 454

>TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.318
           YLR120C
          Length = 600

 Score =  345 bits (885), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 186/369 (50%), Positives = 237/369 (64%), Gaps = 14/369 (3%)

Query: 175 WPDDTDVPTATSMD--------SYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSY 226
           W   +D P  +S D        S Q++I CS YGTF  D SSSF SN T F I YGD SY
Sbjct: 113 WVTGSDNPLCSSDDATFTGSDGSSQSSIDCSLYGTFDIDDSSSFTSNDTSFAITYGDGSY 172

Query: 227 ALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKN 286
           ALG WG+D ++LQD+ V+ +S AVAN +NST GVLGIGLP LE T + + + S+ Y Y N
Sbjct: 173 ALGNWGQDVLSLQDIDVTGLSFAVANYTNSTVGVLGIGLPSLEATYSGSLAGSNPYQYDN 232

Query: 287 FPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPK 346
            P +L + G ++  AYSLF+ND +++ GS+LFG VDHSKY GTL T+PLVN  KS+    
Sbjct: 233 LPLVLRNSGAVKSYAYSLFLNDEDSSEGSILFGGVDHSKYEGTLNTLPLVNYQKSSGFQS 292

Query: 347 PIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDED 406
           P +FD+TL                    ALLDSGTT T+LP  L S +A +LNA Y    
Sbjct: 293 PYEFDITLQGLGISTSSKNTTVSDTQIVALLDSGTTLTYLPVTLTSLLAAELNASYSARL 352

Query: 407 GFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEII 466
           G+Y   C   SDS E+VFDFGGFHI   L +F + +        +VC L +IP +  + I
Sbjct: 353 GYYTMSCPSSSDSTEIVFDFGGFHINVPLTSFIVTS------SMNVCILGIIPRSGDQAI 406

Query: 467 LGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPI 526
           LGD+FL  AYVVYDLENLEIS+AQA     SEDIE IVS+VPSAV+A  YS+TW++A  I
Sbjct: 407 LGDSFLQHAYVVYDLENLEISLAQAKYGSSSEDIEAIVSSVPSAVRAASYSNTWSTAATI 466

Query: 527 STGGNIFTI 535
           ++GG+IFT+
Sbjct: 467 NSGGDIFTV 475

 Score = 92.4 bits (228), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 74/137 (54%), Gaps = 8/137 (5%)

Query: 33  KFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDV 92
            F+K  FDK  GD  +N+     P++  VKRD G    E+ N+ +FYS+ + +G+PAQ+V
Sbjct: 43  NFIKFKFDKSYGDSYKNSSKRNKPKLDIVKRD-GYEEIELKNESSFYSIKLSIGTPAQNV 101

Query: 93  TLLIDTGSSDIWVMGSNNPYCE-------GSSGKSKHVLLHEDSGFEDDTNGKDFYSDLL 145
           T+LIDTGSSD+WV GS+NP C        GS G S+  +     G  D  +   F S+  
Sbjct: 102 TVLIDTGSSDLWVTGSDNPLCSSDDATFTGSDGSSQSSIDCSLYGTFDIDDSSSFTSNDT 161

Query: 146 SYLTATGTAEYSGSYWA 162
           S+    G   Y+   W 
Sbjct: 162 SFAITYGDGSYALGNWG 178

>Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144C
           (MKC7) - aspartyl protease related to Yap3p [contig 105]
           FULL
          Length = 651

 Score =  337 bits (865), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 214/534 (40%), Positives = 296/534 (55%), Gaps = 78/534 (14%)

Query: 2   RISSSTAILGLAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKRV 61
           R++S +A    AGLVS  A S  +        +V  +F K  G     AR G  P  K  
Sbjct: 3   RLTSISAFA--AGLVSVVAASESSN-----GDYVSFNFGKSLGSSFHGARGGSRPG-KLH 54

Query: 62  KRDDGTASFEI---DNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSG 118
           +RD G++   +    N++ FYSV + +G+P QD+T+L DTGSSD+WV  ++NP+CE    
Sbjct: 55  RRDSGSSDSALSVLKNEEVFYSVKLNIGTPPQDITVLFDTGSSDLWVSSNSNPFCEA--- 111

Query: 119 KSKHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDD 178
                            +G +  +DL S      ++ YS                     
Sbjct: 112 -----------------DGVNRRADLKS------SSTYS--------------------- 127

Query: 179 TDVPTATSMDSYQA--TISCSEYGTFATDSSSSFKSNGTQ-FLIQYGDLSYALGVWGRDD 235
             V  +T++D ++   T+ C+E+GTF  + SS+F+  G   F+I YGD ++A G+W +D 
Sbjct: 128 --VAPSTTIDGFEVAPTVDCAEFGTFNPNKSSTFRPQGNDTFMIMYGDGTFANGLWAKDT 185

Query: 236 VTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVT-NALAESPSDAYTYKNFPAMLVDQ 294
           ++L    +S++  AVAN+S+S  GVLG+GL GLE + +   + PS    Y NFP +L   
Sbjct: 186 LSLDGHDISNLQFAVANMSDSDVGVLGVGLTGLESSADPFDDEPSQ---YPNFPVVLKQN 242

Query: 295 GKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTL 354
             I K AYSL++N L+A  GSVLFGAVDHSKYTG L TIPLVN++    V + ++FDVT+
Sbjct: 243 NVISKMAYSLYINSLDAEAGSVLFGAVDHSKYTGGLYTIPLVNALAQYFVDEILEFDVTV 302

Query: 355 HXX--XXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQ 412
                               FPAL+DSGTT  ++   L  AIA  L A   D+   Y ++
Sbjct: 303 QGLGIESKKNCFQKTLTTAQFPALMDSGTTLIYIDPDLADAIADSLGATMSDDYELYTFE 362

Query: 413 CDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIP-YNRGEIILGDNF 471
           C    D  +LVFDFGGF I + L N+ L T D+      VC L ++P Y+    ILGD F
Sbjct: 363 CPAKDDDTQLVFDFGGFQITNPLSNYVLETDDEK-----VCGLGVVPSYSN---ILGDEF 414

Query: 472 LTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIP 525
           L +AYVV+DLENLE+S+ QANL+ G EDIE I+STVP A KAPGYSSTWT   P
Sbjct: 415 LASAYVVFDLENLELSIGQANLNPGPEDIEPIISTVPGAQKAPGYSSTWTFNFP 468

>Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {ON}
           complement(141395..143161) [1767 nt, 589 aa]
          Length = 588

 Score =  331 bits (848), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/432 (43%), Positives = 263/432 (60%), Gaps = 29/432 (6%)

Query: 114 EGSSGKSKHV--LLHEDSGFED--DTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTV 169
           E +S K+K    ++  D+G E+    N  +FYS  LS               + A +VTV
Sbjct: 78  ENASNKNKRYANIVKRDNGVEEVEIMNQSNFYSVSLSI-------------GSNAQNVTV 124

Query: 170 ----ETTSYWPDDTDVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLS 225
                ++  W   ++ P  +  DS    + C+++GTF   +S ++ SN T F I Y D S
Sbjct: 125 LLDTGSSDLWVTGSNNPLCSRGDSNSDAVDCAKFGTFNPSTSDTWSSNETSFSISYADSS 184

Query: 226 YALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDA-YTY 284
           YA G WG+D + LQD+ V+ +S AVAN +NST GVLGIGLP LEVT + + + +   Y Y
Sbjct: 185 YASGTWGQDTLKLQDLDVTGLSFAVANYTNSTVGVLGIGLPSLEVTYSGSNNVAGTRYQY 244

Query: 285 KNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQV 344
           +NFP +L + G  + +AYSL++NDL++  GSVLFG VDH+KY+GTL TIPLVN++++A  
Sbjct: 245 ENFPLLLKNSGATKANAYSLYLNDLDSRTGSVLFGGVDHNKYSGTLYTIPLVNTLRAAGF 304

Query: 345 PKPIQFDVTLHXXXXXX-XXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYG 403
            +P++FDVTL                    PALLDSGTT  +LP  LVS IA + +A Y 
Sbjct: 305 SQPVEFDVTLQGMGISDDEHGNVTLTTTKIPALLDSGTTLVYLPSALVSLIADEYDAVYN 364

Query: 404 DEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRG 463
              G+Y   C +  +  ++VFDFGGFHI + L  + +           +C L ++P + G
Sbjct: 365 SRTGYYVMNCPDSDEDSQIVFDFGGFHISTNLTTYIIQAVGG------ICVLGILPQSSG 418

Query: 464 EIILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSA 523
             ILGD+FL  AYVVYDL+NLEISMAQA+ +   E++E I S++PSAVKAPGYSSTW++ 
Sbjct: 419 TAILGDSFLQHAYVVYDLDNLEISMAQASFETDDENVEVISSSIPSAVKAPGYSSTWSTF 478

Query: 524 IPISTGGNIFTI 535
             IS+GGNIFT+
Sbjct: 479 SSISSGGNIFTV 490

 Score = 96.3 bits (238), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 56/86 (65%)

Query: 28  SQDESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGVGS 87
           S +   FV+  FDKL GD  ENA          VKRD+G    EI NQ  FYSV++ +GS
Sbjct: 58  SNESQGFVRYHFDKLVGDSFENASNKNKRYANIVKRDNGVEEVEIMNQSNFYSVSLSIGS 117

Query: 88  PAQDVTLLIDTGSSDIWVMGSNNPYC 113
            AQ+VT+L+DTGSSD+WV GSNNP C
Sbjct: 118 NAQNVTVLLDTGSSDLWVTGSNNPLC 143

>ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 486

 Score =  327 bits (837), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 209/549 (38%), Positives = 283/549 (51%), Gaps = 88/549 (16%)

Query: 1   MRISSSTAILGLAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKR 60
           M+ ++  AI  LA  VS  AI  E    +   K ++LSF+K  G    N +    P  + 
Sbjct: 1   MKFTTLNAIGILASTVSGAAI--ENHRREVSPKIIQLSFNKHGG--AANNKDILTPTSQN 56

Query: 61  VKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKS 120
                   S    N+  FYSV + VG+PAQ +++L+DTGSSD+WV G++N          
Sbjct: 57  TD-----ISVNATNRYIFYSVELSVGTPAQKLSVLLDTGSSDLWVPGADN---------- 101

Query: 121 KHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTD 180
              L  E+    D                                           + TD
Sbjct: 102 ---LFCENHAVSDS------------------------------------------NSTD 116

Query: 181 VP-TATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQ 239
            P  + ++ S Q TI C++YGTF    SSSFK+N +  LI+YGD SYALG +G+D V + 
Sbjct: 117 KPLKSPTLPSPQPTIDCNQYGTFDYSKSSSFKANDSSLLIRYGDQSYALGRFGQDTVEMN 176

Query: 240 DVKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESP--SDAYTYKNFPAMLVDQGKI 297
            + + ++SL VA+ +N T GVLGIGL GLE TN    S   S +YTY+NFP +L  QG I
Sbjct: 177 SLSIPNVSLGVAHQANVTQGVLGIGLAGLETTNTGFSSTLNSKSYTYENFPQVLKSQGII 236

Query: 298 RKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLH-- 355
             +AYSLF+N   A+ G +LFG VDHSKYTG L T+P++N+        PIQF VTL   
Sbjct: 237 DANAYSLFLNSPGASQGGILFGGVDHSKYTGPLYTVPIINTGAPG---NPIQFQVTLQGV 293

Query: 356 ----------XXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDE 405
                                      FP LLDSGTT   LP  +   +AK+L A Y  E
Sbjct: 294 GISLDKSNGTNTNAADSTSNVTLTASKFPVLLDSGTTLMTLPRPVTDQMAKQLGATYNSE 353

Query: 406 DGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEI 465
             +Y+ +C   +D+  L+ DFGGF + +K+ N    + + +      C L + P +    
Sbjct: 354 TSYYQLKCPSQNDNTRLILDFGGFQVNAKITNHITRSQNGE------CLLGITPSDTDSG 407

Query: 466 ILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIP 525
            LGD FL  AYVVYDL+N EIS+AQA+    ++ IE I S+VPSA KAPGYS+TWT +  
Sbjct: 408 TLGDVFLVDAYVVYDLDNYEISLAQADFSDSAQSIEPISSSVPSATKAPGYSNTWTGSES 467

Query: 526 ISTGGNIFT 534
           I TGGNIFT
Sbjct: 468 IKTGGNIFT 476

>KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {ON} 
          Length = 540

 Score =  323 bits (829), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 212/536 (39%), Positives = 284/536 (52%), Gaps = 70/536 (13%)

Query: 12  LAGLVSSTAISAEAKYSQDESKFVKLSFDKLR-----GDLVENARAGQIPRVKRVKRDDG 66
           +AG     A+ A ++ S +  K+V++ F K R     GD +              +R D 
Sbjct: 7   VAGSFLGGAVLASSQASPN--KYVQMGFHKSRSFSSGGDSL-------------ARRADD 51

Query: 67  TASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEG--SSGKSKHVL 124
             S +++NQ  +YSV + VG+P Q+V++LIDTGSSD+W+   +NPYC G    G +K  L
Sbjct: 52  YLSVDVENQQLYYSVELYVGTPPQNVSVLIDTGSSDLWLTSPDNPYCIGFKQPGSAKFAL 111

Query: 125 LHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTA 184
             +++                                A AT +T +        +    A
Sbjct: 112 EEKEA--------------------------------ANATVLTAQNAEGPTRSSKAAKA 139

Query: 185 TS--MDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVK 242
           T   +D +     C+  GTF    SSSFKSN T FL  Y D ++A G WG D V + DV 
Sbjct: 140 TGGHLDQFD----CALLGTFNNSESSSFKSNNTDFLTGYADNTFASGFWGTDVVRIGDVD 195

Query: 243 VSDISLAVANISNSTFGVLGIGLPGLEVTNA--LAESPSDAYTYKNFPAMLVDQGKIRKS 300
           VSD+SLAV N++NST  VLGIG+P LE +NA  LA   + +Y Y NFP  L ++G I K 
Sbjct: 196 VSDVSLAVVNLTNSTSPVLGIGMPVLESSNAGRLAAETNSSYEYDNFPVQLKNKGVIEKI 255

Query: 301 AYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXX 360
           AYSLF+ND +AT GSVLFGAVDHSKY   L T+P+VN+ K   V  PI+F VT++     
Sbjct: 256 AYSLFLNDSDATEGSVLFGAVDHSKYENGLFTVPMVNTYKDQGVQHPIEFYVTMYGLGFK 315

Query: 361 XXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSD 420
                       FP LLDSG+T ++LP  LVS +A  LNA + ++   Y  +C    D+ 
Sbjct: 316 KDGFLNTITTTNFPVLLDSGSTTSYLPDTLVSMLASALNATFSEKINGYTLKCPSEEDAT 375

Query: 421 ELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE--IILGDNFLTAAYVV 478
            L FD GGF I   L +     + +       C L +     GE   ILGD FL++AYVV
Sbjct: 376 FLSFDLGGFLIDVPLSDLVAKRHKNQ------CVLMVKGQGEGEGGYILGDTFLSSAYVV 429

Query: 479 YDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFT 534
           YDLE+ EIS+ QA+    +EDIE I STVP AV+AP Y   WT    IS  GNI T
Sbjct: 430 YDLESYEISIGQASTGDAAEDIEVIKSTVPGAVRAPFYDRPWTGGTVISMSGNIST 485

>KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 767

 Score =  330 bits (845), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 203/496 (40%), Positives = 271/496 (54%), Gaps = 58/496 (11%)

Query: 34  FVKLSFDKLRGDLVENARAGQIPRV--KRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQD 91
           +V + F K +G   ++AR G  P    KR      T + E+ N + FYSV + +G+P Q 
Sbjct: 35  YVAIDFAKAKGISYQDARVGARPAKLQKRALSQGETLNSELVNNNVFYSVGLDIGTPPQQ 94

Query: 92  VTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDTNGKDFYSDLL--SYLT 149
           VT+L DTGSSD+WV  ++NPYC        +                ++ +DL   S LT
Sbjct: 95  VTVLFDTGSSDLWVSSNDNPYCSNGDSTESYA---------------NYRADLKSSSALT 139

Query: 150 ATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSEYGTFATDSSSS 209
           A  T   SG        +T+                       TI C++YGTF  D S+S
Sbjct: 140 AAPTTTISG--------ITIA---------------------PTIDCAQYGTFNADRSTS 170

Query: 210 FKSNGTQ-FLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGL 268
             +N ++ F + Y D SYALG W RD + +    +S +  AVA ISNST GVLG+GL GL
Sbjct: 171 LFANYSKPFFVSYNDDSYALGYWARDKLVVDGDDISSLEFAVAEISNSTVGVLGVGLQGL 230

Query: 269 EVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTG 328
           E T     SP+ +  Y NFP +L + G I K AYSL++N L+A  GSVLFG VDHSKYTG
Sbjct: 231 EST-VHYRSPNISSIYPNFPMVLKENGAIDKIAYSLYLNSLDAPSGSVLFGGVDHSKYTG 289

Query: 329 TLQTIPLVNSIKSAQVPKPIQFDVTLH--XXXXXXXXXXXXXXXXPFPALLDSGTTFTHL 386
            L T+PLVN+ K   V  P+QFDVT+                      AL+DSGTT  + 
Sbjct: 290 GLYTLPLVNTYKDYGVKTPVQFDVTVQGIGIESEKACRQETFTTTKIAALMDSGTTLMYT 349

Query: 387 PGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDD 446
              +V+ IA  +NA +    G + ++C    D  + +FDFGGF IKS L N+ L T  DD
Sbjct: 350 APEIVNKIALYVNASFSPGYGLFMFRCPSDGDDTQFIFDFGGFQIKSPLSNYILRT--DD 407

Query: 447 DNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVST 506
           +N   +C L LI  N+G  I GD FL +AYVVYDLENLE+S+AQAN + GS +IE+IVS 
Sbjct: 408 EN---ICGLGLISSNQG-TIFGDEFLASAYVVYDLENLELSLAQANWNPGSPEIEKIVSE 463

Query: 507 VPSAVKAPGYSSTWTS 522
           +P A +A  Y +TW S
Sbjct: 464 IPRAQRASQYWNTWVS 479

>TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {ON}
           Anc_8.318 YLR120C
          Length = 596

 Score =  322 bits (825), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 215/545 (39%), Positives = 306/545 (56%), Gaps = 52/545 (9%)

Query: 1   MRISSSTAILGLAGLVSSTAISA--------EAKYSQD----ESKFVKLSFDKLRGDLVE 48
           M+ ++S AI  LA L    + SA        EAK +++    + KF++L FD+  G+  E
Sbjct: 1   MKFTNSIAISALALLQQFQSASALIWNREQVEAKEAKNIQPIKPKFLELKFDRHYGESYE 60

Query: 49  NARAGQIPRVKRVKRDDGTA---SFE---IDNQDTFYSVTIGVGSPAQDVTLLIDTGSSD 102
           ++  G+   V   KR   +A   S+E   + NQ TFYSV + +G+PAQ VT+++DTGSSD
Sbjct: 61  DSTLGKDGAVHLEKRTFDSAYNGSYEDVILTNQLTFYSVELDIGTPAQKVTVVVDTGSSD 120

Query: 103 IWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWA 162
           +W+  ++NP+C  S+G             +DDT    +   LL         ++ G    
Sbjct: 121 LWITETSNPFC--STG-------------DDDTEDSVWSPFLLKDKIDPRVLKHKGKR-T 164

Query: 163 TATDVT-VETTSYWPDDTDVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQY 221
           T+ DVT   TT       D+ +  ++   +  I+C+E+GTF T  SS+FK+N T F I Y
Sbjct: 165 TSIDVTATATTGSINISIDLGSNFTLPP-EFLINCTEFGTFNTKKSSTFKNNHTDFFISY 223

Query: 222 GDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVT-----NALAE 276
           GD ++A G WGRD ++ QD+ V+ +S  VAN++NST GVLGIGLP LE T     N++ E
Sbjct: 224 GDNTFASGYWGRDVLSFQDINVTGLSFGVANVTNSTVGVLGIGLPELESTYFGTVNSVNE 283

Query: 277 SPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLV 336
           S   +Y Y NFP +L + G I K+AYSLF+N  ++T GS+L GAVD SK+   L T+P++
Sbjct: 284 S---SYIYNNFPQVLKNSGIINKTAYSLFLNKSDSTQGSLLLGAVDTSKFADKLYTVPML 340

Query: 337 NSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAK 396
           N   S     P  F V +                   P LLDSGTT  +LP  +V  I +
Sbjct: 341 NINPSKGYTDPSAFLVLMQKMTRYKYGQGHLVPSSRIPVLLDSGTTMVYLPRSIVEQIMR 400

Query: 397 KLNAEYGDEDGFYRYQCDEISDSDE--LVFDFGGFHIKSKLDNFALATYDDDDNETDVCA 454
              A+Y +E   Y+ +C   +  ++    FDFGGF IK+ L +F + T   D+ +   C 
Sbjct: 401 HEEAQYVEELDLYQIKCPSPNKKNQTSFSFDFGGFQIKASLSDFIVPT---DNGQ---CI 454

Query: 455 LALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAP 514
             +IP +    ILGD+FLT AYVVYDLE+ EISMAQA  DGG  +   IVSTVPSAV+A 
Sbjct: 455 FGMIPQDMNVGILGDSFLTHAYVVYDLEDYEISMAQAVYDGGEPNYIPIVSTVPSAVRAK 514

Query: 515 GYSST 519
            YS+T
Sbjct: 515 YYSAT 519

>NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score =  318 bits (816), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 179/367 (48%), Positives = 233/367 (63%), Gaps = 12/367 (3%)

Query: 174 YWPDDTDVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGR 233
           +W   +D P   S D+    I CSE+GTF + SSS+F +NGT F I YGD S+ALG WG 
Sbjct: 104 FWVMGSDNPYC-SDDTSTTGIDCSEFGTFDSSSSSTFHNNGTAFNIHYGDGSFALGTWGT 162

Query: 234 DDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVT--NALAESPSDAYTYKNFPAML 291
           D V++ D+ +  +SLAVAN SNS+ GV+G+GL GLE T  ++ A      Y Y NFP  L
Sbjct: 163 DTVSIDDITLDALSLAVANSSNSSMGVIGLGLAGLETTYSSSHAVKSGQTYQYANFPLAL 222

Query: 292 VDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFD 351
            + G +  +AYSL++ND   T G++LFGAVDHS Y+G L TIPLVN    +     ++FD
Sbjct: 223 KNAGIVAANAYSLYLNDPEETTGNILFGAVDHSLYSGQLYTIPLVNIYSGSGFKNAVEFD 282

Query: 352 VTLHXXXXX-XXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYR 410
           VTL+                 P  ALLDSGTT T+ P   VS +A +L A+Y   +G+Y 
Sbjct: 283 VTLNGIGIVDSSGSATTVSTTPIIALLDSGTTLTYFPTQYVSLLAAQLGAQYSSSNGYYT 342

Query: 411 YQCDEISD-SDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGD 469
             CD + D + +LVFDFGGFHI + L +F + +       T  C L++IP N    ILGD
Sbjct: 343 ISCDAMQDTTTKLVFDFGGFHINATLADFVVQS------GTSTCFLSIIPQNSSSAILGD 396

Query: 470 NFLTAAYVVYDLENLEISMAQANLDGGS-EDIEEIVSTVPSAVKAPGYSSTWTSAIPIST 528
            FL  AYVVYDL+NLEISMAQA  D  S EDIE I S+VPSAVKAPGYS+TW++ + I++
Sbjct: 397 TFLNNAYVVYDLDNLEISMAQAKWDQSSDEDIEVISSSVPSAVKAPGYSNTWSTTMSITS 456

Query: 529 GGNIFTI 535
           GGNIFT+
Sbjct: 457 GGNIFTV 463

>KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa]
           {ON} Anc_8.318 YLR120C
          Length = 575

 Score =  319 bits (817), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 173/338 (51%), Positives = 216/338 (63%), Gaps = 7/338 (2%)

Query: 198 EYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNST 257
           EYGTF T+ SS++ SN T F I YGD S A GVWG+D +++ DV VS +S AVAN +NST
Sbjct: 186 EYGTFNTNDSSTWSSNHTSFFISYGDSSVAEGVWGQDVLSISDVDVSGVSFAVANYTNST 245

Query: 258 FGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVL 317
            GVLGIGL GLE T +   S S++Y Y+N P +L   G I   AYSLF+N+ + T G++L
Sbjct: 246 VGVLGIGLSGLETTYS-GTSSSESYIYENLPMLLKSSGVIDTIAYSLFLNEKSDTTGNLL 304

Query: 318 FGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALL 377
           FGAVDHSKY+G+L T+P+VN   S     P++FDVT++                  PALL
Sbjct: 305 FGAVDHSKYSGSLYTLPIVNVYASEGYKNPLEFDVTMYGLGISTSDSNTTIATMKIPALL 364

Query: 378 DSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDN 437
           DSGTT  + P  L+  +A +L A Y DE GFY   C   SD  E VFDFGGFHI   L +
Sbjct: 365 DSGTTIVYFPETLLELVADQLGASYSDELGFYAMSCVSSSDDTEFVFDFGGFHITVPLSD 424

Query: 438 FALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGS 497
           F +     +      C LA+   +   IILGD FLT AYVVYDLEN EISMAQAN D   
Sbjct: 425 FLIRVSGSE------CILAMAAQDDESIILGDYFLTNAYVVYDLENYEISMAQANYDSED 478

Query: 498 EDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535
           EDIE I STVPSAVKA  YS++W+S   I++GG+IFT+
Sbjct: 479 EDIEVISSTVPSAVKAASYSNSWSSTGSITSGGDIFTV 516

>TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {ON} 
          Length = 689

 Score =  321 bits (823), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/344 (51%), Positives = 230/344 (66%), Gaps = 10/344 (2%)

Query: 194 ISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQD-VKVSDISLAVAN 252
           I+C  YGTF  ++SS+++SN T F I+Y D S+A G WGRD +T  D + V+ +S AVAN
Sbjct: 282 INCDAYGTFDIENSSTYQSNQTGFAIRYADTSFASGDWGRDVLTFSDGLNVTGLSFAVAN 341

Query: 253 ISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNAT 312
            +NST GVLGIGLP LEVT A     +  YTY NFP +L + G I KSAYSL++N  +A 
Sbjct: 342 QTNSTVGVLGIGLPQLEVTYAGVYQTTKPYTYDNFPLVLKNSGAIHKSAYSLYLNKQSAK 401

Query: 313 HGSVLFGAVDHSKYTG-TLQTIPLVNSIKSAQVPKPIQFDVTLH-XXXXXXXXXXXXXXX 370
           +G+VLFGA+DHS+Y G TL TIPLVNS  S+   KPI+FDVTL                 
Sbjct: 402 NGNVLFGAIDHSQYQGDTLYTIPLVNSDTSSGYSKPIEFDVTLQGLGVSDNRNGNFTVTT 461

Query: 371 XPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFH 430
               ALLDSGTT T+ P  +++ +AK++NA Y +  G+Y   C +  D+ +LVFDFGGFH
Sbjct: 462 TQIVALLDSGTTLTYFPKDMLNLLAKRINASYSEALGYYVMNCPDSRDNTQLVFDFGGFH 521

Query: 431 IKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQ 490
           IK+ L NF L++       +  C L L+PYN    ILGD FLT AYVVY+L++LEISMAQ
Sbjct: 522 IKTNLTNFVLSS------ASGKCVLGLLPYNGNSAILGDIFLTHAYVVYNLDDLEISMAQ 575

Query: 491 ANLDGGS-EDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIF 533
           AN + G+ EDIE I ST+P+AVKAPGYS T++ +  I  GG+IF
Sbjct: 576 ANFNNGNDEDIEVISSTIPNAVKAPGYSYTYSVSKSIVPGGDIF 619

>Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {ON}
           YLR121C (REAL)
          Length = 745

 Score =  314 bits (805), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 197/504 (39%), Positives = 260/504 (51%), Gaps = 95/504 (18%)

Query: 44  GDLVENARAGQIPRVKRV--------KRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLL 95
           G ++ N +  +IP  KR         KR  G  +F + N+ +FYSV + +G+P+Q+VT+L
Sbjct: 21  GSVLPNVKYVRIPFAKRQNGPGSELGKRAGGDENFVLSNEQSFYSVELALGTPSQNVTVL 80

Query: 96  IDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAE 155
           +DTGS+D+WV  + NPYC  +    ++       G  D  N   F            TA 
Sbjct: 81  LDTGSADLWVPSNANPYCGSAMNCDQY-------GVFDKANSSTF------------TAN 121

Query: 156 YSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGT 215
           +S  ++A+  D                                 GTFA            
Sbjct: 122 HSAPFYASYGD---------------------------------GTFAE----------- 137

Query: 216 QFLIQYGDLSYALGVWGRDDVTLQ-DVKVSDISLAVANISNSTFGVLGIGLPGLEVT--N 272
                        GV+G+D +     + +S +S AVAN SNST GVLGIGLP LEVT   
Sbjct: 138 -------------GVFGQDKLHYSGGLDLSGLSFAVANKSNSTVGVLGIGLPMLEVTYSG 184

Query: 273 ALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQT 332
            +A +   +Y Y NFP  L   G I  +AYSLF+ND   T GSVLFGAVDHSKY G L T
Sbjct: 185 KVAVADKRSYQYDNFPLFLKRSGAIDATAYSLFLNDETQTSGSVLFGAVDHSKYLGQLYT 244

Query: 333 IPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVS 392
           IPLVN  K+    +P+ FDVTL                   PALLDSGTT T+LP   V+
Sbjct: 245 IPLVNLYKAQGYQRPVAFDVTLQGLGLQTRAHNTTLTTTRIPALLDSGTTLTYLPADAVA 304

Query: 393 AIAKKLNAEYGDEDGFYRYQCDEISD-SDELVFDFGGFHIKSKLDNFALATYDDDDNETD 451
            +AK LNA +  E G+Y Y C    D +  +VFD GGFHI + L +F + T         
Sbjct: 305 LMAKSLNATFSKELGYYEYACPTSGDNATSVVFDLGGFHINAPLSDFTMQT------NVG 358

Query: 452 VCALALIPY-NRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSA 510
            C LA++P       ILGD+FL +AYVVYDL+N E+S+AQA    G EDIE I S+VP A
Sbjct: 359 TCVLAIVPQAGNATAILGDSFLRSAYVVYDLDNYEVSLAQAKYGSGKEDIEAIRSSVPGA 418

Query: 511 VKAPGYSSTWTSAIPISTGGNIFT 534
            +APGY+STW +   +++GGNIFT
Sbjct: 419 TRAPGYNSTWVNYASVTSGGNIFT 442

>Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {ON}
           YLR121C (REAL)
          Length = 497

 Score =  306 bits (784), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 165/345 (47%), Positives = 212/345 (61%), Gaps = 9/345 (2%)

Query: 194 ISCSEYGTFATDSSSSFKSNGTQ-FLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVAN 252
           + C +YG F    SS+FK+N +  F   YGD ++A G +G+D +    + +S +S AVAN
Sbjct: 101 MDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTFAQGAFGQDRLKYNGLDLSGLSFAVAN 160

Query: 253 ISNSTFGVLGIGLPGLEVT--NALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLN 310
            SNSTFGVLGIGLP LEVT    +A     +Y Y NFP  L   G I  +AYSLF+ND +
Sbjct: 161 ESNSTFGVLGIGLPALEVTYSGKVAVVDKKSYEYDNFPLFLKRSGAIDATAYSLFLNDES 220

Query: 311 ATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXX 370
            + GS+LFGAVDHSKY G L T+PLVN  +S     P+ FDVTLH               
Sbjct: 221 QSSGSILFGAVDHSKYEGRLYTVPLVNLYRSQGYQHPVAFDVTLHGIGLQTDRHNTTLTA 280

Query: 371 XPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFH 430
              PALLDSGTT T+LP   V+ +AK LNA Y    G+Y Y C    +   + FDFGGFH
Sbjct: 281 TKIPALLDSGTTLTYLPSQAVALLAKSLNATYSKALGYYEYACPSSDNDTSVAFDFGGFH 340

Query: 431 IKSKLDNFALATYDDDDNETDVCALALIPY-NRGEIILGDNFLTAAYVVYDLENLEISMA 489
           I + + +F + T     +    C LA+IP       ILGD+FL  AYVVYDL+N E+S+A
Sbjct: 341 INAPVSDFTMQT-----SVGGTCVLAVIPQAGNATAILGDSFLRNAYVVYDLDNYEVSLA 395

Query: 490 QANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFT 534
           QA    G+EDIE I STVPSA +APGY+STW++   +++GGNIFT
Sbjct: 396 QAKYGTGAEDIEAIKSTVPSATRAPGYNSTWSNYASVTSGGNIFT 440

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 8/78 (10%)

Query: 44  GDLVENARAGQIPRVKRV--------KRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLL 95
           G ++   +  +IP VK          KR +G   F + N+ +FYSV + +G+P+Q +T+L
Sbjct: 20  GSILPREKYVKIPFVKNQDGAGNVLGKRSNGHEKFVLANEQSFYSVELAIGTPSQSLTVL 79

Query: 96  IDTGSSDIWVMGSNNPYC 113
           +DTGS+D+WV    NPYC
Sbjct: 80  LDTGSADLWVPSKGNPYC 97

>Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}
           similar to Ashbya gossypii AGL192W
          Length = 502

 Score =  306 bits (785), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 203/536 (37%), Positives = 274/536 (51%), Gaps = 85/536 (15%)

Query: 1   MRISSSTAILGLAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKR 60
           M++S   A   LA + SS A+ A+     + + +V+   DK RG+   ++  G +P  + 
Sbjct: 1   MKLSGCIAATVLAFVPSSFALLAQ---RAESAAYVRFDLDKTRGNDFRSSEKGVMPFGEL 57

Query: 61  VKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKS 120
            KRDD     +I N+ TFYS           V L I T + ++ V+              
Sbjct: 58  KKRDDEYVDVKIHNEQTFYS-----------VNLSIGTPAQEVTVL-------------- 92

Query: 121 KHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTD 180
                  D+G  D                           W    DV        PD++D
Sbjct: 93  ------VDTGSSD--------------------------LWIIGADVDCG-----PDNSD 115

Query: 181 VPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQD 240
                        + C EYG F    SSS+K+N T+F I YGD S+A G WG D + L D
Sbjct: 116 S---------TEPLDCFEYGAFDKSKSSSWKNNHTEFYISYGDTSFASGEWGTDKLDLGD 166

Query: 241 VKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKS 300
           +    ++ AVA  SNS+  VLGIGL G+EVT A   S  + Y Y N P +L   G I K+
Sbjct: 167 LNADGLTFAVATASNSSVAVLGIGLTGIEVTRA---SGDNGYEYDNLPIVLKRNGVIDKT 223

Query: 301 AYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXX 360
           AYSL++NDL+AT GSVLFGAVDHSKYTGTL T+PLVN       PKPI+  +TL+     
Sbjct: 224 AYSLYLNDLDATSGSVLFGAVDHSKYTGTLATVPLVNVNARYGFPKPIELHITLNGLGFS 283

Query: 361 XXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSD 420
                        PALLDSGTT ++ P  L +AIA  + A +      +   C +   ++
Sbjct: 284 SGKKRGTISATKVPALLDSGTTLSYFPTELAAAIASNVGAVWNARLRKFLIPCSQAKRNN 343

Query: 421 -ELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVY 479
            +L+++FGG  I S L N     Y  + N  DVC L ++P +  +IILGD FLT+ Y VY
Sbjct: 344 IDLIYNFGGVEITSPLVN-----YLSETNVEDVCLLGIVPTSSNDIILGDVFLTSVYTVY 398

Query: 480 DLENLEISMAQANLDGGS--EDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIF 533
           DLE LE+S+AQA     +  E+IE I STVP A KAPGYS+TW++  PISTGGN+F
Sbjct: 399 DLEALEVSIAQAAYGASAEKENIEVIKSTVPGATKAPGYSNTWSTYAPISTGGNMF 454

>KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON} 
          Length = 538

 Score =  306 bits (785), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 172/344 (50%), Positives = 216/344 (62%), Gaps = 13/344 (3%)

Query: 195 SCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANIS 254
           +CS+YGTF T+ SS++ SN ++F IQYGD ++A G WGRD +++  + V+ ++ AVAN S
Sbjct: 142 NCSQYGTFNTNKSSTWSSNNSRFFIQYGDTTFASGTWGRDVMSINGLNVTGLTFAVANAS 201

Query: 255 NSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHG 314
           NS+  VLGIGL  LE T   + S S +YTY NFP +L + G     +YSLF+N+L+A  G
Sbjct: 202 NSSNSVLGIGLTQLETTYNGSNS-SHSYTYANFPVVLKNAGLTESISYSLFLNELDAESG 260

Query: 315 SVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFP 374
           S+LFGAVDHSKY+G L T+PLVN+ K    P PI+F VTL                    
Sbjct: 261 SILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLA 320

Query: 375 ALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCD-EISDSDELVFDFGGFHIKS 433
           A+LDSGT+ T LPG ++ +IA  LN  Y      Y   C    S +  LVFDFGGF IK 
Sbjct: 321 AILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKG 380

Query: 434 KLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANL 493
            L NF L        E D+C L L   +   +ILGD FL +AYVVYDLENL+ISMAQA  
Sbjct: 381 TLSNFILEI------EDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKF 434

Query: 494 DGGSEDIEEIV--STVPSAVKAPGYSSTWTSAIP--ISTGGNIF 533
           D  + DI+ I   S VPSA+KAPGYSSTWT A P  ISTGGNIF
Sbjct: 435 DNSTSDIDVIRGNSGVPSAIKAPGYSSTWT-ATPSSISTGGNIF 477

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 61/106 (57%), Gaps = 15/106 (14%)

Query: 25  AKYSQDESKFVKLSFDKLRG---DLVE----------NARAGQIPRVKRVKRDDGTASFE 71
           +++SQ  + F+ L F+KL G   D+ +          N    Q    KR   D      E
Sbjct: 27  SRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSD--YQELE 84

Query: 72  IDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSS 117
           I NQ +FYS+ + +G+P Q+VT+ IDTGSSD+WV GSNNPYC GS+
Sbjct: 85  IKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGST 130

>KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON} 
          Length = 531

 Score =  302 bits (773), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 191/510 (37%), Positives = 254/510 (49%), Gaps = 59/510 (11%)

Query: 33  KFVKLSFDK----LRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGVGSP 88
           K+V++ FDK      GD+V              KRD      ++ N+   Y+V + VG+P
Sbjct: 33  KYVQMGFDKSCTSATGDMV------------FAKRDGDYVLVDLINEKILYTVQLAVGTP 80

Query: 89  AQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDTNGKDFYSDLLSYL 148
            Q++T+ I+ GS+D W+   +NPYCE          + + SG+E                
Sbjct: 81  PQNITVSINIGSADPWMTSPDNPYCE----------IKKHSGYEKQV------------- 117

Query: 149 TATGTAEYSGSYWATATD-VTVETTSYWPDDTDVPTATSMDSYQATISCSEYGTFATDSS 207
              G         + + D VT+  T        V T TS    Q  I C+ YGTF   SS
Sbjct: 118 ---GANTSVSLLSSLSNDRVTMSGT--------VTTGTSSSMVQPIIDCTNYGTFNHSSS 166

Query: 208 SSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPG 267
           SSFK+NGT F + Y D + A   WG D V ++ +++ D+S  VAN+ N+T GV GIG P 
Sbjct: 167 SSFKNNGTNFTMFYADKTGASRFWGTDVVRVELLEILDMSFGVANVFNATEGVFGIGFPS 226

Query: 268 LEVTNALAES--PSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSK 325
           LE TN       P  +Y Y NFP  L +QG + K AYSLF+ND +A  GSVLFGAVDHSK
Sbjct: 227 LETTNMFNARIDPYSSYEYANFPQALNNQGSVDKVAYSLFLNDSHAMKGSVLFGAVDHSK 286

Query: 326 YTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTH 385
           Y   L T+PLVN  +   +  P  F+V                    F  +LDSG T + 
Sbjct: 287 YRNDLFTVPLVNDFRDKGMDHPHYFNVFNARRGCPNKRRPQNRRHDEFIVVLDSGATVSS 346

Query: 386 LPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDD 445
           LP  LV  + + LNA + +E   Y  +C    D+    FD G FHI   L NF       
Sbjct: 347 LPTKLVDQLVQSLNATFDEELNSYTLKCPSKKDTSVASFDIGRFHIDGPLSNFVRKY--- 403

Query: 446 DDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVS 505
              E + C L L P +    IL DNFL+ AYVV+DLE+ EISM QAN +   E IE I S
Sbjct: 404 ---EKNKCILRLDPADNQPYILCDNFLSRAYVVHDLESYEISMGQANTEYAPEQIEAIKS 460

Query: 506 TVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535
            VP  V+AP Y  TW +   +S  GNI+T+
Sbjct: 461 KVPGTVRAPSYDKTWGNGTDVSPSGNIYTV 490

>Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {ON}
           YLR121C (REAL)
          Length = 507

 Score =  297 bits (760), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 163/347 (46%), Positives = 206/347 (59%), Gaps = 10/347 (2%)

Query: 192 ATISCSEYGTFATDSSSSFKSNGTQ-FLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAV 250
           + + C +YG F    SS+FK+N +  F   YGD ++A G +G+D +   ++ +S +  AV
Sbjct: 99  SVMDCDQYGVFDKSKSSTFKANKSSPFYAAYGDGTFAEGAFGQDKLKYNNLDLSGLPFAV 158

Query: 251 ANISNSTFGVLGIGLPGLEVT--NALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVND 308
           AN SNSTFGVLGIGL  LEVT    +A     +Y Y NFP  L   G I  +AYSLF+ND
Sbjct: 159 ANESNSTFGVLGIGLSTLEVTYSGKVAVMDKRSYEYDNFPLFLKHSGAIDATAYSLFLND 218

Query: 309 LNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXX 368
            +   GS+LFGAVDHSKY G L TIPLVN  KS     P+ FDVTL              
Sbjct: 219 ESQASGSILFGAVDHSKYEGQLYTIPLVNMYKSQGYQHPVAFDVTLQGLGLQTDKRNTTL 278

Query: 369 XXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGG 428
               FPALLDSGTT T+LP   V+ +AK LNA Y    G+Y Y C    +   + FDFGG
Sbjct: 279 TTTKFPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKTSIAFDFGG 338

Query: 429 FHIKSKLDNFALATYDDDDNETDVCALALIPY-NRGEIILGDNFLTAAYVVYDLENLEIS 487
           F I + L +F + T          CALALIP       ILGD+FL  AYVVYDL+N EIS
Sbjct: 339 FRINAPLSDFTMQT------SVGTCALALIPQAGNATAILGDSFLRNAYVVYDLDNYEIS 392

Query: 488 MAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFT 534
           +AQA      E+IE I STVP A +AP Y++TW++   +++GGNIFT
Sbjct: 393 LAQAKYGKAKENIEAIKSTVPGATRAPSYNNTWSTYASVTSGGNIFT 439

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 58/103 (56%), Gaps = 11/103 (10%)

Query: 12  LAGLVSSTAISAEA-KYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASF 70
           LA  VS T +S+ A      E K+VK+ F           + G        KR  G  +F
Sbjct: 5   LAAAVSLTVLSSLAVGRVLPEGKYVKMPF----------VKKGNSESSVLSKRSSGHENF 54

Query: 71  EIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYC 113
            + N+ +FYSV + +G+P+Q++T+L+DTGS+D+WV G  NPYC
Sbjct: 55  VLANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYC 97

>KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score =  297 bits (761), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 193/521 (37%), Positives = 280/521 (53%), Gaps = 68/521 (13%)

Query: 26  KYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGV 85
           + S +E+K++KL F     +     ++ ++P  KR    D  A+  I + + +Y V + V
Sbjct: 30  QLSSNENKYLKLDFASETFE-----KSSRLPLQKR----DTYATVNI-SAEFYYVVQLSV 79

Query: 86  GSPAQDVTLLIDTGSSDIWVMGSNNPYCEGS------SGKSKHVLLH--EDSGFED-DTN 136
           G+P Q+VTLL+DT SSDIWV   +NP C+G          +KHV++   E+S   D D+N
Sbjct: 80  GTPGQNVTLLVDTCSSDIWVTSPDNPLCDGDIFYDNVEKTAKHVVVAAAEESTVSDGDSN 139

Query: 137 GKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISC 196
           G      LL     + T                E++  +P              +  + C
Sbjct: 140 G------LLDGEPVSTTP--------------FESSVIYPA-------------EGLVDC 166

Query: 197 SEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNS 256
             +GTF  + SS++ +N T F+I Y D S A GVWG+D +++  + +S +  AVAN +NS
Sbjct: 167 GFFGTFNPNDSSTWSTNHTDFVITYSDNSTAEGVWGQDVLSIGGLDISGVPFAVANYTNS 226

Query: 257 TFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSV 316
           + GVLGIGLPG E T       +++Y Y N P +L   G I  +AYSL +   N     +
Sbjct: 227 SLGVLGIGLPGSETTYL-----TNSYMYDNLPMVLKKSGVIDSAAYSLLLAAYNNYTSGL 281

Query: 317 LFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPAL 376
           LFGAVDHSKY+G+L TIP++N  +S     P++FDVT++                  PAL
Sbjct: 282 LFGAVDHSKYSGSLYTIPMINIYESRGYESPVEFDVTIYGLGISSTDSNTTIATMKTPAL 341

Query: 377 LDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYR--YQCDEISDSDELVFDFGGFHIKSK 434
           LDSG+T    P  L++  A++LNA Y +E G Y   Y    IS     VFDFGGFHI   
Sbjct: 342 LDSGSTAIFFPTTLLNLAAEQLNATYSEEKGLYTIPYSPANIS----FVFDFGGFHINLP 397

Query: 435 LDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLD 494
           +      +Y + +       L ++ +N   I+LG+ FL  AYVV+D EN EISM Q++ D
Sbjct: 398 IRELCSVSYGEPE-----YILNIVAHNENRIVLGEAFLARAYVVFDFENYEISMGQSSYD 452

Query: 495 GGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535
              EDIE I+STVP AVK   YS++W+S   I++GG+IFTI
Sbjct: 453 YAEEDIEAIISTVPGAVKVASYSNSWSSFGSITSGGDIFTI 493

>YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON}
           YPS3Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 508

 Score =  296 bits (757), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 163/347 (46%), Positives = 208/347 (59%), Gaps = 10/347 (2%)

Query: 192 ATISCSEYGTFATDSSSSFKSNGTQ-FLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAV 250
           + + C +YG F    SS+FK+N +  F   YGD +YA G +G+D +   ++ +S +S AV
Sbjct: 99  SVMDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTYAEGAFGQDKLKYNELDLSGLSFAV 158

Query: 251 ANISNSTFGVLGIGLPGLEVT--NALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVND 308
           AN SNSTFGVLGIGL  LEVT    +A     +Y Y NFP  L   G I  +AYSLF+ND
Sbjct: 159 ANESNSTFGVLGIGLSTLEVTYSGKVAIMDKRSYEYDNFPLFLKHSGAIDATAYSLFLND 218

Query: 309 LNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXX 368
            + + GS+LFGAVDHSKY G L TIPLVN  KS     P+ FDVTL              
Sbjct: 219 ESQSSGSILFGAVDHSKYEGQLYTIPLVNLYKSQGYQHPVAFDVTLQGLGLQTDKRNITL 278

Query: 369 XXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGG 428
                PALLDSGTT T+LP   V+ +AK LNA Y    G+Y Y C    +   + FDFGG
Sbjct: 279 TTTKLPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKTSVAFDFGG 338

Query: 429 FHIKSKLDNFALATYDDDDNETDVCALALIPY-NRGEIILGDNFLTAAYVVYDLENLEIS 487
           F I + L +F + T          C LA+IP       ILGD+FL  AYVVYDL+N EIS
Sbjct: 339 FRINAPLSDFTMQT------SVGTCVLAIIPQAGNATAILGDSFLRNAYVVYDLDNYEIS 392

Query: 488 MAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFT 534
           +AQA    G E++E I STVPSA++AP Y++TW++    ++GGNIFT
Sbjct: 393 LAQAKYGTGKENVEVIKSTVPSAIRAPSYNNTWSNYASATSGGNIFT 439

 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 53/83 (63%), Gaps = 10/83 (12%)

Query: 31  ESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQ 90
           + K+VK+ F K +     N   G++      KR +G   F + N+ +FYSV + +G+P+Q
Sbjct: 25  DGKYVKIPFTKKK-----NGDNGELS-----KRSNGHEKFVLANEQSFYSVELAIGTPSQ 74

Query: 91  DVTLLIDTGSSDIWVMGSNNPYC 113
           ++T+L+DTGS+D+WV G  NPYC
Sbjct: 75  NLTVLLDTGSADLWVPGKGNPYC 97

>SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some
           similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 592

 Score =  297 bits (761), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 199/542 (36%), Positives = 272/542 (50%), Gaps = 51/542 (9%)

Query: 1   MRISSSTAILGLAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKR 60
           MR+ S  A+L L  L   + I  E       SK V + F K +G     +      R + 
Sbjct: 1   MRLESVFAVLLLPALGVGSVIEPET------SKHVSIPFKKAKGKTFSGSADSNKWRNRL 54

Query: 61  VKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKS 120
            KR D   +  +      Y V + +G+P Q   + +DTGSSD+WV  S+NPYC  S    
Sbjct: 55  SKRGDDYENLGLKTDKLAYYVELSLGTPGQKFEVQLDTGSSDLWVYDSHNPYCMPSETTH 114

Query: 121 KHVLLHEDSGFED--DTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDD 178
              +  E +  E   D    D +  LL                A+AT+          DD
Sbjct: 115 NEKVYGEAAYGETAFDQTALDQFETLL----------------ASATE----------DD 148

Query: 179 TDVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTL 238
                  ++ S +ATI C+ +GTF    SSSF +N T+F I Y D + A G+W +D + L
Sbjct: 149 PSYTQTEAVPSSEATIDCASFGTFNYTLSSSFSANDTEFYISYLDSTAAYGIWAQDVLKL 208

Query: 239 QDVKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIR 298
            D+++SD+  AVA + +    V G+G PG E T     S  + Y Y NFP +L  QG ++
Sbjct: 209 GDLEISDMPFAVAVVGDVQTPVFGVGFPGTEST--AGSSVKEPYEYANFPVLLKSQGYVK 266

Query: 299 KSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQV--PKPIQFDVTLHX 356
           K  YSLF++  +++ GS L GAVDHSKY+G L T+P+ +           P +F +TL  
Sbjct: 267 KVVYSLFLDAQDSSSGSFLLGAVDHSKYSGGLYTLPMYSGTDGDDTLSSTPSRFIITLQG 326

Query: 357 XXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEI 416
                               LDSG+T T  P      IA  L A Y  +   Y  +C   
Sbjct: 327 LGISDKGENKTVATTRSLVYLDSGSTGTVFPSEYAELIADSLGASYSGDYEAYVMKCPSK 386

Query: 417 SDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALAL----IPYNRGEIILGDNFL 472
            D    V+DFGGF I S L N+  AT DD      VC L +    IPY    I+LGD FL
Sbjct: 387 DDDTNFVYDFGGFTISSPLSNYMEATGDDS-----VCVLDIDTDDIPY----IVLGDAFL 437

Query: 473 TAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNI 532
            +AYVVYDLE+ EIS+AQAN DGGSE+IE +  ++PSAVKAP YSSTW++ +  ++GGNI
Sbjct: 438 VSAYVVYDLEDYEISIAQANYDGGSENIEVVSDSIPSAVKAPFYSSTWSTYVTATSGGNI 497

Query: 533 FT 534
           FT
Sbjct: 498 FT 499

>NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A
          Length = 590

 Score =  297 bits (760), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 183/436 (41%), Positives = 263/436 (60%), Gaps = 37/436 (8%)

Query: 116 SSGKSKHVLLHEDSGFEDDT--NGKDFYS---------DLLSYLTATGTAEYSGSYWATA 164
           S+G S   L+  D G+E  T  N + FYS           L+ L  TG++++    W T+
Sbjct: 52  SNGPSAQ-LIKRDDGYEQVTLTNQQSFYSVEVEMGTPSQKLTVLLDTGSSDF----WVTS 106

Query: 165 TDVTVETTSYWPDDTDVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDL 224
           +D      + +   T    +      Q TI CS YGTF +  SS+F+SN T FLI YGD 
Sbjct: 107 SD------NPYCGTTSTEGSLYGGETQDTIDCSTYGTFDSSKSSTFQSNDTDFLISYGDG 160

Query: 225 SYALGVWGRDDVTLQD-VKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSD--A 281
           S+A G WG D + L D + ++D+S+AVA+ +NS+ GVLGIGL  LE T +  +S ++  +
Sbjct: 161 SFAEGTWGTDVIKLDDSLSLNDVSVAVASSTNSSMGVLGIGLRPLETTYSSTKSVNEKTS 220

Query: 282 YTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKS 341
           Y Y NFP  L   G I  +AYSL++ND ++  G++LFG VDHSKYTG L T+P+++S  S
Sbjct: 221 YMYDNFPISLKKSGLIESTAYSLYLNDPSSKSGNILFGGVDHSKYTGQLYTVPMLSSTTS 280

Query: 342 AQVPKPIQFDVTLHXXXXX-XXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNA 400
            +   P++FDVTL+                  F  LLDSGTTF++LP  LV+ I ++L A
Sbjct: 281 YKT--PVEFDVTLNGIGIIDSSGNKKTLTATQFYGLLDSGTTFSYLPSALVAMIGEELGA 338

Query: 401 EYGDEDGFYRYQCD-EISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIP 459
            Y    G+Y   C  E SD  ++VFD GGFHI + L +F +         T  C L+++P
Sbjct: 339 SYDSNIGYYTIDCSAEDSDDTKIVFDMGGFHINTTLSDFVIQI------STSTCILSIVP 392

Query: 460 YNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSE-DIEEIVSTVPSAVKAPGYSS 518
            + G+++LGD+FL  AY+VYDL+N EI+MAQA  D   E +I+ I +T+PSA++APGYSS
Sbjct: 393 QD-GKVVLGDSFLNNAYIVYDLDNYEIAMAQAAWDSTREANIDVISTTIPSAIRAPGYSS 451

Query: 519 TWTSAIPISTGGNIFT 534
           TW+++  IS+GG+IFT
Sbjct: 452 TWSTSRSISSGGDIFT 467

 Score = 94.7 bits (234), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 93/175 (53%), Gaps = 9/175 (5%)

Query: 22  SAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSV 81
           SA +K +    K++ L+F+K  GD   N+ +   P  + +KRDDG     + NQ +FYSV
Sbjct: 21  SASSKDNTSPPKYLALNFEKRYGDSFLNSSSSNGPSAQLIKRDDGYEQVTLTNQQSFYSV 80

Query: 82  TIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYC-----EGS--SGKSKHVLLHEDSGFEDD 134
            + +G+P+Q +T+L+DTGSSD WV  S+NPYC     EGS   G+++  +     G  D 
Sbjct: 81  EVEMGTPSQKLTVLLDTGSSDFWVTSSDNPYCGTTSTEGSLYGGETQDTIDCSTYGTFDS 140

Query: 135 TNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDS 189
           +    F S+   +L + G   ++   W   TDV     S   +D  V  A+S +S
Sbjct: 141 SKSSTFQSNDTDFLISYGDGSFAEGTW--GTDVIKLDDSLSLNDVSVAVASSTNS 193

>KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.319
           YLR121C
          Length = 521

 Score =  290 bits (742), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 197/439 (44%), Positives = 248/439 (56%), Gaps = 40/439 (9%)

Query: 114 EGSSGKSKHVLLHEDSGFE--DDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVET 171
           EGS+  S   L     G+E  D  N ++FYS  L   T + T             V V+T
Sbjct: 48  EGSTTWS--ALAKRTRGYELVDLVNRQNFYSVDLDIGTPSQTIT-----------VLVDT 94

Query: 172 TS--YWPDDTDVPTATSMDSYQAT----ISCSEYGTFATDSSSSFKSNGTQFLIQYGDLS 225
            S   W   +D P   S+ S   +      C+ YGTF  + SS++ SN T F I YGD S
Sbjct: 95  GSSDLWVTGSDNPYCVSVKSNLVSSTNKFDCNTYGTFDKNQSSTWSSNDTLFSITYGDTS 154

Query: 226 YALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDAYTYK 285
           +A G WG+D + L D+ VS +S AVAN++NST GVLGIGLPGLEVT     +P + Y Y 
Sbjct: 155 FARGTWGQDKLHLDDLDVSGLSFAVANVTNSTVGVLGIGLPGLEVT--YINAPRNRYQYD 212

Query: 286 NFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVP 345
           NFP +L + G    + YSL ++   A HG+VLFGAVDHSKYTG+L TIPLVN++K+    
Sbjct: 213 NFPMILKNSGATHSNLYSLHLDHPEAEHGTVLFGAVDHSKYTGSLYTIPLVNTLKTHGFS 272

Query: 346 KPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDE 405
            P +F+VTL                    ALLDSGTT T+LP  LV  IA  + A +   
Sbjct: 273 DPAKFEVTLQGVGIVANNTQTTLTNTKIAALLDSGTTLTYLPQALVQVIADSIGARWSSR 332

Query: 406 DGFYRYQCDEISDSD-ELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYN-RG 463
            G+Y   C  + +SD  LVFDFGGFHI  KL +F + T+       +VC L +I      
Sbjct: 333 YGYYIVSCRAVENSDTTLVFDFGGFHINGKLTDFIVETFG------NVCLLTIIEETGSN 386

Query: 464 EIILGDNFLTAAYVVYDLENLEISMAQA--NLDGGSEDIEEIVST--VPSAVKAPGYSST 519
             ILGDNFL  AYVV+DLEN EISMAQA  N+D   +DIE + S   V SAV A GYSST
Sbjct: 387 SAILGDNFLINAYVVFDLENNEISMAQALHNVD-DDQDIEIVTSNAGVASAVTALGYSST 445

Query: 520 WTSAIP--IST-GGNIFTI 535
           WT A P  I T  G+IFT+
Sbjct: 446 WT-AEPSTIETFAGDIFTV 463

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 4/83 (4%)

Query: 31  ESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQ 90
           +  +V L F K  GD  E    G        KR  G    ++ N+  FYSV + +G+P+Q
Sbjct: 31  QPDYVNLKFKKTYGDSFE----GSTTWSALAKRTRGYELVDLVNRQNFYSVDLDIGTPSQ 86

Query: 91  DVTLLIDTGSSDIWVMGSNNPYC 113
            +T+L+DTGSSD+WV GS+NPYC
Sbjct: 87  TITVLVDTGSSDLWVTGSDNPYC 109

>ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 506

 Score =  282 bits (722), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 187/508 (36%), Positives = 276/508 (54%), Gaps = 42/508 (8%)

Query: 36  KLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEID--NQDTFYSVTIGVGSPAQDVT 93
           K+ F K  G   + +R     ++   ++  G    EID  NQ+ +YS +I +G+P Q++T
Sbjct: 31  KIPFSKRYGKSFDESR-----QISFSEKGTGGDDQEIDISNQNVYYSASIYLGTPGQELT 85

Query: 94  LLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGT 153
           LL+DTGSSD+W+      +C+  S              +D T GK   S + S L +  +
Sbjct: 86  LLLDTGSSDLWIPQKGGYHCQSDS--------------DDATKGKS--SGIASQLFSIAS 129

Query: 154 AEYSGSYWATATDVTVETTSY----WPDDTDVPTATSMDSYQATISC-SEYGTFATDSSS 208
           AE   S   T T +     S+     P + +V    ++ +     SC S  G F  +SSS
Sbjct: 130 AEGGPSPSLTTTLIGSSGGSHPDPLEPTNRNVQPPAAITASALEESCQSSSGNFDPNSSS 189

Query: 209 SFKSNGT--QFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLP 266
           SF  N T   F I+YGD SYA G W  DD+T+ D+ V D+++AVA+ +NS+  V GI   
Sbjct: 190 SFNKNDTVDGFFIEYGDNSYASGYWATDDLTVGDISVKDMTIAVADDTNSSVAVFGISYR 249

Query: 267 GLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKY 326
           GLE ++   ++  D + Y+NFP +L DQG ++++AYSL++N   A+ G++LFG VDH+KY
Sbjct: 250 GLE-SSVFGDNLQDPHEYENFPYLLKDQGIVKRNAYSLYLNSAGASDGNILFGGVDHNKY 308

Query: 327 TGTLQTIPLVNSIKSAQVPKPIQ-FDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTH 385
           +G L T+P+   +K  +   P + F VT+                 PF  LLDSGTT  +
Sbjct: 309 SGDLYTLPV---LKGQEDSDPWERFVVTVQGIGIKGSETQNTLTTTPFIGLLDSGTTAVY 365

Query: 386 LPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDD 445
           LP  +   +A      + D+     Y     SD +++VF+FGGF+I++ L N+       
Sbjct: 366 LPEPVADMVANAYGGSFDDDPEVQSYVISCPSDDEKIVFNFGGFNIETSLSNYIT----- 420

Query: 446 DDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVS 505
            DN    C L + P +    ILGD+FL  +YVVYD++N EIS+AQAN D  +ED+E I  
Sbjct: 421 -DNGNGQCILNISPTSDYMGILGDSFLRDSYVVYDMDNNEISLAQANFD-STEDVEAITG 478

Query: 506 TVPSAVKAPGYSSTWTSAIPISTGGNIF 533
            VP A KAPGYSST++      TGGNIF
Sbjct: 479 PVPGATKAPGYSSTYSGPQTFQTGGNIF 506

>AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR121C (YPS3),
           YDR144C (MKC7) and YLR120C (YPS1); Tandem gene
           duplication in Saccharomyces cerevisiae
          Length = 499

 Score =  280 bits (716), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 149/343 (43%), Positives = 200/343 (58%), Gaps = 12/343 (3%)

Query: 194 ISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANI 253
           ++C E+G+F T  SS++K N TQF I+YGD +YA G WG D + L    V  ++ AVA+ 
Sbjct: 118 LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFAVAHA 177

Query: 254 SNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATH 313
           SNS+  VLGIGLP +E T     S    Y Y N P +L     I+K+ YS+F+N+LNA  
Sbjct: 178 SNSSVAVLGIGLPAMETT---MSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKT 234

Query: 314 GSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXX---XXXXXXX 370
           GSVLFGAVDHSKY GTL T+PLVN+    +V KP++  VTL                   
Sbjct: 235 GSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLG 294

Query: 371 XPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEIS-DSDELVFDFGGF 429
              PALLDSGTT T+ P  L   +A+   A +  E+  Y   C+         ++DFGGF
Sbjct: 295 SKVPALLDSGTTLTYFPMQLADRLARAAGARWHSEEVGYIVDCNSRRLHQTAYIYDFGGF 354

Query: 430 HIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMA 489
            I+S L ++++ T     N    C   ++P++   +ILGD FLT AYVV+DLE LE+SMA
Sbjct: 355 QIRSPLSDYSMMT-----NVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMA 409

Query: 490 QANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNI 532
           QAN +GG E IE I   VP AV+APGY+  W +  P+   G +
Sbjct: 410 QANYEGGKEQIEVIAGAVPRAVRAPGYNDPWKAYTPLVFNGEL 452

 Score = 79.3 bits (194), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 61/100 (61%), Gaps = 1/100 (1%)

Query: 9   ILGLAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTA 68
           I  L  ++++    A     ++ ++FV++ FDK RG     A +G+    +  KR+D   
Sbjct: 5   IAALGAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRNDWV- 63

Query: 69  SFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGS 108
             EIDNQ  FYSV + +G+P Q+V +L+DTGSSD+WV+G+
Sbjct: 64  DIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA 103

>CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 482

 Score =  277 bits (708), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 174/483 (36%), Positives = 251/483 (51%), Gaps = 67/483 (13%)

Query: 62  KRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSK 121
           KRDD     E++N    Y+V + VG+P Q++T+ +DTGSSD+W     NPYC+ +    K
Sbjct: 33  KRDDKGLQLELENGGLLYAVQLSVGTPPQNITVQLDTGSSDLWFTSEANPYCKNNR---K 89

Query: 122 HVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWP-DDTD 180
           H                                             + + +   P +D D
Sbjct: 90  H---------------------------------------------SPKKSQIEPLNDAD 104

Query: 181 VPTA-TSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQ 239
            PT+   +      I C  +G F T  SS++K+NGT F + Y D ++A G WG D ++  
Sbjct: 105 YPTSPNQIPKSLRDIDCKAFGFFNTSKSSTYKNNGTNFTLSYADTTFASGPWGVDTLSFN 164

Query: 240 DVKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPS----DAYTYKNFPAMLVDQG 295
            VKV +++  +A  SNST  V GI LP  E TN LA + S    ++Y Y NFP +L +QG
Sbjct: 165 GVKVDNVTFGLAAFSNSTTPVFGISLPARETTNQLAANGSRIGPNSYEYSNFPMLLKEQG 224

Query: 296 KIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLH 355
            ++K AYS+++ND  + +GS+LFGAVD SKY GTL T+PLVNS+   QV KP QF++TL+
Sbjct: 225 IVKKIAYSVYLNDTRSKYGSILFGAVDQSKYIGTLYTLPLVNSLYK-QVSKPFQFEITLN 283

Query: 356 XXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRY-QCD 414
                               LLD+G T + LP  + + +A K+N    D++GF +  +C 
Sbjct: 284 GIGLQTADKNYTLYDQKLATLLDTGVTTSVLPAKVAALVASKVNGTIDDDNGFIKLDKCP 343

Query: 415 EISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEI-ILGDNFLT 473
              +   +VF+FGG  I       ++   D        C L +   +  E   LGD FL 
Sbjct: 344 NKKEKRTVVFNFGGAEI-------SIDIRDLTRKIKGKCYLQMQARDDIEFAALGDIFLR 396

Query: 474 AAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTG--GN 531
             YVVY+LE+ EIS+A AN +  + DI+EIVSTVP AVKAP Y +T+ S  P +T   G+
Sbjct: 397 HVYVVYNLEDEEISIANANFNYSTPDIQEIVSTVPGAVKAPQYYNTY-SVYPTATAVTGD 455

Query: 532 IFT 534
           +FT
Sbjct: 456 VFT 458

>ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 528

 Score =  275 bits (703), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 189/522 (36%), Positives = 271/522 (51%), Gaps = 23/522 (4%)

Query: 10  LGLAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQ----IPRVKRVKRDD 65
           L + GLVSS +       S+      K+ F+K+ G     A A +    + R K +  D+
Sbjct: 7   LYVCGLVSSVSCLPAVHDSRSSQSVAKIGFNKVYGKSFSEATADRKYVNLFRNKNISDDN 66

Query: 66  GTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLL 125
              + + +N +T+YSV I +G+P Q++T+ +DTGSSD+WV+      C  +       L 
Sbjct: 67  DEVALQ-NNANTYYSVNISLGTPGQNMTIQLDTGSSDLWVIKPGGLQCTDNDTN----LF 121

Query: 126 HEDSGFEDDTNG-KDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTA 184
            + S  ++D +    F S L SY  +  T    G         T+ ++   P        
Sbjct: 122 KKRSENDNDNDAISSFISQLESYEGSFSTLFGPGPGSVGTPTGTISSSMPAPTGNGSYDG 181

Query: 185 TSMDSYQATISCSEYGTFATDSSSSFKSNGTQ-FLIQYGDLSYALGVWGRDDVTLQDVKV 243
              DS  +  +C+    F  D+S +F  N T  + IQY DLSYA G WG DD+ L D++V
Sbjct: 182 GDSDSDGSN-NCNATAFFEADNSKTFHRNRTDPYYIQYEDLSYASGYWGTDDLQLGDLQV 240

Query: 244 SDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDA---YTYKNFPAMLVDQGKIRKS 300
            ++S AVAN +NST  V GIG PG E + A       A   + Y NFP  L +QG I++ 
Sbjct: 241 HNVSFAVANDTNSTTPVFGIGFPGGESSFASVGPEYRAAHPHEYANFPQTLKNQGIIQRV 300

Query: 301 AYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQ-FDVTLHXXXX 359
           AYSL++N  N+T+G+VLFG VDHS+Y G L T+P++          P     +TL     
Sbjct: 301 AYSLYLNSPNSTYGNVLFGGVDHSQYQGQLYTLPILQLGNLTSDGDPYNTLAITLQGVSV 360

Query: 360 XXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDS 419
                       P P +LDSGTT  +LP  L  +IA + +   G ED  Y   C +  D+
Sbjct: 361 TRRGSKHKVKTKPIPVVLDSGTTAMYLPYKLAKSIASRYHGILGPEDQGYIIDCPKSGDN 420

Query: 420 DELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVY 479
           D + FDFGG  IK+ + N+    ++  +N+   C L +IP +    + GD FLT AYVVY
Sbjct: 421 DYITFDFGGVTIKTDIRNY---IFEQSENK---CLLGIIPNSDILAVFGDVFLTDAYVVY 474

Query: 480 DLENLEISMAQANLDGGSEDIEEIVST-VPSAVKAPGYSSTW 520
           DLE  EIS+AQA+ +  SE IE I S+ VP A +APGYS TW
Sbjct: 475 DLEGKEISLAQASFNSSSEQIEAITSSGVPGAKRAPGYSKTW 516

>CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  266 bits (679), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 169/484 (34%), Positives = 240/484 (49%), Gaps = 68/484 (14%)

Query: 59  KRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSG 118
           KR   D   A   + N    Y+V I VG+P Q++T+ +DTGSSD+W + ++NPYC+ +  
Sbjct: 33  KRADNDSFIA--PLLNGGELYTVQIAVGTPPQNLTVQLDTGSSDLWFVSASNPYCKNNKK 90

Query: 119 ----KSKHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSY 174
               K   + +  D GF    N                                      
Sbjct: 91  FAPKKQDLMPITSDDGFPTSPN-------------------------------------- 112

Query: 175 WPDDTDVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRD 234
                 VP A         I+C++YG F    SS++  N T F + YGD ++A G WG D
Sbjct: 113 -----QVPKALR------NINCNKYGFFNASGSSTYSRNDTNFSLSYGDETFASGPWGTD 161

Query: 235 DVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDAYT---YKNFPAML 291
            ++L  VKV +++  +A+ SNST  V GIGLPG E T A+    ++  T   Y NFP  L
Sbjct: 162 TISLNGVKVENVTFGLASFSNSTNPVFGIGLPGDESTYAMFSEDTNGTTNTQYSNFPLQL 221

Query: 292 VDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFD 351
             QGKI K AYS+++N   +  GS+LFGAVDHSKY+G L T+P+VN      V  P + +
Sbjct: 222 KQQGKIDKVAYSIYLNSTKSKQGSILFGAVDHSKYSGPLYTLPIVNRFGHL-VENPYELE 280

Query: 352 VTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRY 411
           VTL                   PALLD+GTT+T++P  +   +A + N     +    + 
Sbjct: 281 VTLSGLGLQRATSNITLFDQLLPALLDTGTTYTYMPSSVAQYLANQTNGVIDKKTSLIKL 340

Query: 412 -QCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDN 470
            +C     +D +VF+F G  IK K+ +F        +     C L  +       +LGD+
Sbjct: 341 AKCPSKKSNDTIVFNFSGAQIKIKMVDFV-------EKHKGKCYLPCVSQESSFFLLGDS 393

Query: 471 FLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTS-AIPISTG 529
           F+   Y V+DL++ EIS+AQAN +   EDIEEI STVPSAVKAP Y S++      IS  
Sbjct: 394 FMRHVYTVFDLDDKEISIAQANFNSTKEDIEEISSTVPSAVKAPQYYSSYVDFPTEISVT 453

Query: 530 GNIF 533
           G+IF
Sbjct: 454 GDIF 457

>CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 516

 Score =  262 bits (670), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 175/483 (36%), Positives = 249/483 (51%), Gaps = 68/483 (14%)

Query: 62  KRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCE---GSSG 118
           KR D  +   + N    Y V + VG+P Q V++ +DTGS+D+W  G++NPYC+     + 
Sbjct: 32  KRADDLSPVPLRNDVDQYIVQLAVGTPPQMVSVQLDTGSADLWFSGADNPYCKTNKKKAP 91

Query: 119 KSKHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDD 178
           KSK +   ++SGF  +                                         PD 
Sbjct: 92  KSKDLQPVDNSGFPTN-----------------------------------------PDQ 110

Query: 179 TDVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTL 238
                A ++D       C +YG F   SSS+FK+N T   + Y DLS+  G WG D V+L
Sbjct: 111 IG-KKARNLD-------CKKYGFFNMSSSSTFKNNDTDIFLYYEDLSFVRGTWGTDVVSL 162

Query: 239 QDVKVSDISLAVANISNSTFGVLGIGLPGLEVT---NALAESPSDAYTYKNFPAMLVDQG 295
             + +S ++ AVA ISNS+ GVLG+ LP  E T   N+   + +  Y Y N P  L +QG
Sbjct: 163 GGLNISGVNFAVAEISNSSSGVLGVSLPSEESTYSINSNGTTNATNYQYSNLPLQLKEQG 222

Query: 296 KIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLH 355
            I K  YS+++ND  + +GS+LFGAVDHSKYTGTL T+PLVNS +   V KP + D+TL+
Sbjct: 223 IIDKVTYSIYLNDTKSKYGSILFGAVDHSKYTGTLYTLPLVNS-EYDVVNKPYELDITLN 281

Query: 356 XXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEY-GDEDGFYRYQCD 414
                              AL+DSGTT +  P  +V  +AK++NA    + +G    +C 
Sbjct: 282 GIGYQSMSSNMTLYDQKVAALIDSGTTISEFPDEIVEVVAKQMNATVDPNGNGIRLAKCP 341

Query: 415 EISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE--IILGDNFL 472
              D+ +L+F+ GG  I   +  F              C L +IP       +ILGDNF+
Sbjct: 342 SKKDNAKLLFNLGGALIYVDIKEFTTKVKGK-------CYLEIIPSGAESDLVILGDNFM 394

Query: 473 TAAYVVYDLENLEISMAQANLDGG-SEDIEEIVSTVPSAVKAPGYSSTWTSAIPIST-GG 530
            + Y V+DLE  E+S+AQAN +      IEEI STVPSAVKAP Y +T+++   IS+  G
Sbjct: 395 RSVYTVFDLEANEVSIAQANFNSSLPAQIEEIKSTVPSAVKAPQYYNTFSAIASISSVTG 454

Query: 531 NIF 533
           +IF
Sbjct: 455 DIF 457

>KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  257 bits (657), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 186/524 (35%), Positives = 262/524 (50%), Gaps = 79/524 (15%)

Query: 16  VSSTAISAEAKYSQDESK-FVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDN 74
           VSS A+ +  K +  E+  FV + F K  G  + ++    + +   VKR  GT   E+ N
Sbjct: 8   VSSVALFSSLKAAAAEAPGFVGVQFSKRYGKSISDSS---LAKGNLVKRSSGTDEVELIN 64

Query: 75  QDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDD 134
           +  FY++ + +                             G+  +S  VL+        D
Sbjct: 65  ESVFYAIDMEI-----------------------------GTPKQSVTVLV--------D 87

Query: 135 TNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATI 194
           T   DF+                         V   T  Y    +   T  S D     I
Sbjct: 88  TGSSDFW-------------------------VPSSTNPYCESKSATSTIASSD----LI 118

Query: 195 SCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANIS 254
            C+ YGTF+   SSSF  N T F  QY D S A G WG D V     ++SDIS+AVA+ +
Sbjct: 119 DCTTYGTFSVSDSSSFVYNNTDFQTQYADGSSATGFWGHDVVDFGGQELSDISIAVADQT 178

Query: 255 NSTFGVLGIGLPGLEVTNALAESPSDA---YTYKNFPAMLVDQGKIRKSAYSLFVNDLNA 311
           +S+FGVLGIGL GLE T + + + S +   Y Y NFP  LV +  I+ +AYSL+++    
Sbjct: 179 DSSFGVLGIGLTGLESTYSGSAAASSSTGRYQYDNFPIRLVQENVIQANAYSLYLDPATG 238

Query: 312 THGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXX 371
           + G++LFG VDH+KY+G L TIPL+N++++     PI+  VTL+                
Sbjct: 239 SSGTILFGGVDHNKYSGDLNTIPLINTLEANGYTSPIKLQVTLNGLGVSDGSSTSTVTTT 298

Query: 372 PFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHI 431
             PALLDSGTT T+LP  +   +A+++ A Y      Y   C  + +   +V+DFGGF I
Sbjct: 299 QIPALLDSGTTLTYLPTAMFDLLAEQIGATYSSTSNGYVLSCANVDEDSMIVYDFGGFQI 358

Query: 432 KSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQA 491
           ++ L   A + Y   D   D C LA+   +     LGD FLT AYVVYDL+N EISMAQ 
Sbjct: 359 QTPL---AGSLYQLSD---DQCELAIGSTSSSYATLGDLFLTHAYVVYDLDNKEISMAQI 412

Query: 492 NLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535
           N +  +EDIE I  +VP A KA GY +TWT++  I+ GGNIFT+
Sbjct: 413 NYNATTEDIEIISDSVPGATKAAGYYNTWTTSESITAGGNIFTL 456

>CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 508

 Score =  253 bits (645), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 167/483 (34%), Positives = 237/483 (49%), Gaps = 75/483 (15%)

Query: 62  KRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSK 121
           + DD   + ++DN+  FY V + +GS  Q++TLL+DTGSSD WV+G+ NPYC+ + GK  
Sbjct: 31  RADDDYLNVQLDNEQIFYGVEVSIGSDKQNMTLLVDTGSSDFWVLGAQNPYCKSNRGKKP 90

Query: 122 HVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDV 181
                           KD                              + +S  P     
Sbjct: 91  K--------------KKD------------------------------QPSSVDPGRNGY 106

Query: 182 PTATSMDSY-QATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQD 240
           PT      Y + T  CS++ TF + SS++FKSN T F I YGD SY  G WG D V L  
Sbjct: 107 PTKAEAIPYAERTFDCSDFKTFNSSSSNTFKSNDTDFFITYGDGSYVEGTWGTDQVALAG 166

Query: 241 VKVSDISLAVANISNSTFGVLGIGLPGLEV-----------TNALAESPSDAYTYKNFPA 289
             + +++ AVA ++N+++G+LGIGLP LE            T+++ ++P     Y NFP 
Sbjct: 167 QTLENVTFAVAELTNNSYGLLGIGLPELESSITIDTAQLTNTSSVKKNP-----YMNFPE 221

Query: 290 MLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQ 349
            L     I K  YS+++N  N   GS+LFGAVDH++Y G L T+PLV S +    P+P +
Sbjct: 222 SLKLNKLINKVVYSIYLNRTNDKFGSILFGAVDHNRYDGNLTTVPLVFSNRDFGTPRPNE 281

Query: 350 FDVTLHXXXXXXX---XXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDED 406
             VTL+                    FPALLD+G+T THLP  + +A+A+  N  Y    
Sbjct: 282 LMVTLNGMSFEATDGNVTQILNATSKFPALLDTGSTDTHLPVDVYNALAESTNGTYDQTQ 341

Query: 407 GFYRY-QCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEI 465
              R  +C    D   L F  GG +I                     C + + P      
Sbjct: 342 NKIRIPKCLSKKDKTILNFSLGGVNIGVPYKEMVKKIKGK-------CYINVAPTGSDFA 394

Query: 466 ILGDNFLTAAYVVYDLENLEISMAQANL-DGGSEDIEEIVSTVPSAVKAPGYSSTW--TS 522
           ILGD+ +  AY+V+DLE+ EIS+AQA+  D   EDIE +VST+P A +A  YS T+  T 
Sbjct: 395 ILGDDVIRYAYMVFDLEDREISLAQASFNDTLPEDIEVVVSTIPGATRASAYSETYSPTF 454

Query: 523 AIP 525
           A+P
Sbjct: 455 AVP 457

>CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  248 bits (632), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 157/485 (32%), Positives = 246/485 (50%), Gaps = 67/485 (13%)

Query: 61  VKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKS 120
           VKRDD   +  + N    Y V + VG+P Q++T+ +DTGSSD+W   ++NP+C+ +    
Sbjct: 32  VKRDDEYVNVPLKNDGDLYLVQLAVGTPPQNITVQLDTGSSDLWFPSADNPFCKENK--- 88

Query: 121 KHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTD 180
                                                  Y     DV     S +P  ++
Sbjct: 89  --------------------------------------KYAPKGKDVQPLDDSGYPSASN 110

Query: 181 -VPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQ 239
            VP ++       T++C +YG F +  SS+FK N ++FL+ Y D+S+A G WG D V+  
Sbjct: 111 QVPKSSR------TLNCKKYGVFNSSESSTFKRNDSEFLLSYADMSFATGNWGSDVVSFN 164

Query: 240 DVKVSDISLAVANISNSTFGVLGIGLPGLEVT-----NALAESPSDAYTYKNFPAMLVDQ 294
           ++ +S+++ A+ + +NS+ GVLG+GLP +E T         ++ SD++ Y NFP  L   
Sbjct: 165 ELNISNVNFALGSFANSSNGVLGVGLPDVESTYDGPYAGSRKNISDSHQYANFPITLKQN 224

Query: 295 GKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTL 354
           G I K AYSL++N   +  GSVLFGAVDH++Y G L T+PL NS+       P Q ++T+
Sbjct: 225 GVIDKIAYSLYLNSSKSKFGSVLFGAVDHNRYNGPLYTLPLANSL-FQNFTDPFQLEITM 283

Query: 355 HXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRY-QC 413
           +                   ALLDSGTT T +  ++   IA ++N     +D   R  +C
Sbjct: 284 NGLGLQGNDANITLYDKKSAALLDSGTTLTVVSKHIGDLIAAQVNGTIAGKDQCIRLPKC 343

Query: 414 DEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPY---NRGEIILGDN 470
               ++ +L+F+F G  +   ++          +     C L    +   +   II GDN
Sbjct: 344 PSKKENKKLIFNFSGAEVAVDINQMM-------NKHKGKCYLQFAVHEDTSNDAIIFGDN 396

Query: 471 FLTAAYVVYDLENLEISMAQANLDGG-SEDIEEIVSTVPSAVKAPGYSSTWTS-AIPIST 528
           FL + Y+VY+LE+ EIS+A AN +    E+IE I STVPSA++AP Y +T++  A   + 
Sbjct: 397 FLRSVYLVYNLEDKEISIAPANFNSSLPENIEPIKSTVPSAIRAPQYYNTYSEHATATAV 456

Query: 529 GGNIF 533
            G+IF
Sbjct: 457 TGDIF 461

>Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)
          Length = 464

 Score =  242 bits (618), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 165/502 (32%), Positives = 251/502 (50%), Gaps = 67/502 (13%)

Query: 24  EAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEID--NQDTFYSV 81
           +A +    + +VKL   KL    + N+ +G        KR +   S  I+  +    Y V
Sbjct: 17  QAAFGSSSNSYVKLPVQKLAN--IPNSASG------ISKRSEAFNSTLINMFSSAHIYVV 68

Query: 82  TIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDTNGKDFY 141
            + +G+P Q     +DTGSSD+    +++ YCE                F D++N     
Sbjct: 69  EMEIGTPPQAAYFQLDTGSSDMCANEADSSYCES---------------FTDESN----- 108

Query: 142 SDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSEYGT 201
                         ++ +Y  TAT   + +T           ATS  +Y     CS +GT
Sbjct: 109 -------------IWTSNYELTATASEISST-----------ATSSKAYNT--PCSYWGT 142

Query: 202 FATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVL 261
           F+ + SS+FK N T F I Y D  Y  G +G D V+L ++ +S+ +  V+N +  ++G+L
Sbjct: 143 FSPNVSSTFKYNETIFNISYADNMYYAGTYGTDVVSLGNITLSNFTFGVSNDTKMSYGIL 202

Query: 262 GIGLPGLEVTNALAE---SPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLF 318
           G+ LP +E T+ + +   S +  + Y+NFP  L  QGKI K AYSLF+N+ +A  GS+LF
Sbjct: 203 GVSLPSVEETDDIEDALSSNTTPFVYENFPMALKSQGKIEKIAYSLFLNEPSARFGSILF 262

Query: 319 GAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLD 378
           GAVD SKY+G L T+P++ +  +        F                      FP L D
Sbjct: 263 GAVDKSKYSGQLYTLPMLQAYNTLDALYSGMFVTAQSAAIIDSKSGNKTVSEVQFPVLFD 322

Query: 379 SGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNF 438
           SGT+ + LP  +  AI +  + +Y  +D  Y + C +++++ +L  DFGGF+I + + NF
Sbjct: 323 SGTSTSVLPTEIADAIGRSFDGKYSSDDEGYIFDCSKVNNT-QLSIDFGGFNISANISNF 381

Query: 439 ALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSE 498
                 D       C L ++P +    +LGD FL   YVVYDLEN E+S+AQA+ +   E
Sbjct: 382 VTPLTKDH------CVLQILPSDTVS-VLGDAFLVDTYVVYDLENHEVSVAQASFNNEEE 434

Query: 499 DIEEIVSTVPSAVKAPGYSSTW 520
           DIE I  +VP A  APGYSSTW
Sbjct: 435 DIEIISDSVPGATPAPGYSSTW 456

>CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7
          Length = 505

 Score =  242 bits (618), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 171/512 (33%), Positives = 251/512 (49%), Gaps = 82/512 (16%)

Query: 34  FVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVT 93
           +V L F+K  GD +             VKRD          +   Y++ + VG+P Q++T
Sbjct: 14  YVALDFEKSHGDDL-------------VKRDVQDVKLINSQKAMLYNIQLSVGTPPQNIT 60

Query: 94  LLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGT 153
             +DTGSSD+W   S NPYC+ +  ++   +   D+G                    T  
Sbjct: 61  AQLDTGSSDLWFPDSTNPYCKANKKQAPKSIASLDAGTR-----------------PTSP 103

Query: 154 AEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSEYGTFATDSSSSFKSN 213
           A+                         VP +         + C+E+G F + +S++F SN
Sbjct: 104 AQ-------------------------VPKSLR------NLDCAEFGLFNSSASTTFNSN 132

Query: 214 GTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVT-- 271
            T+F I Y D SYA GVW  D++ L  + +S ++  +A  SNS+  VLG+GL  LE +  
Sbjct: 133 KTEFFISYLDSSYAEGVWATDNLYLNGLNISGLNFGLAYFSNSSNSVLGVGLTPLEASYD 192

Query: 272 NALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQ 331
             + +  S  + Y NFP +L  +G I K  YSL++ND  + +G +LFG VDHSKY G L 
Sbjct: 193 TDIKQDDSPRFQYPNFPQILKQKGAISKVTYSLYLNDTKSKYGQILFGGVDHSKYVGQLY 252

Query: 332 TIPLVNSIKSAQVPKPI-QFDVTLHXX--XXXXXXXXXXXXXXPFPALLDSGTTFTHLPG 388
           TIPLVNS K  + P  I   +VTL+                    PAL DSGT+++++P 
Sbjct: 253 TIPLVNS-KYQKSPGVIADLEVTLNGLGIRDNTTNTNTTLYTQKLPALFDSGTSYSYVPY 311

Query: 389 YLVSAIAKKLNAEYGDEDGFYRY-QCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDD 447
            +   IA ++N    ++    R  +C    D+ E+VF+F G  I   L  F         
Sbjct: 312 TMAQVIASQVNGTIDNKTEAIRLPKCPSKKDTREVVFNFNGVEIAIPLKQFY-------Q 364

Query: 448 NETDVCALALI--PYNRGE-IILGDNFLTAAYVVYDLENLEISMAQANLDGG-SEDIEEI 503
            ++  C L L+  P N G  ++LGD FL   Y V+DLE  E+S+A+AN +     D+EEI
Sbjct: 365 KKSGKCYLDLMVAPPNNGPGLLLGDTFLRQVYTVFDLEAQELSIARANFNSSLPADVEEI 424

Query: 504 VSTVPSAVKAPGYSSTWTSAIPISTG--GNIF 533
            STVPSA+KAP Y +T+ SA   +T   GNIF
Sbjct: 425 KSTVPSAIKAPQYYNTF-SAYDNATQVVGNIF 455

>SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {ON}
           some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 542

 Score =  243 bits (619), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 164/465 (35%), Positives = 231/465 (49%), Gaps = 83/465 (17%)

Query: 62  KRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSK 121
           KR+  + +  + N+  FY+  + VG+P Q++T                            
Sbjct: 43  KRNQNSLALNLKNEQIFYAADLNVGTPPQNLT---------------------------- 74

Query: 122 HVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATD----VTVETTSYWPD 177
            VLL        DT   D                     W T +D    ++ ETT     
Sbjct: 75  -VLL--------DTGSSDL--------------------WVTGSDNPYCLSNETT----- 100

Query: 178 DTDVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVT 237
                T  S +  ++ + CS YGTF  D+S +F  + ++F I Y D ++A G W +D V+
Sbjct: 101 -----TEPSKNITKSVVDCSRYGTFEKDNSLTFSQSDSRFQINYADNTFANGYWAKDVVS 155

Query: 238 LQDVKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKI 297
             D  ++D+  AVAN +NST GVLGIG   LE       +P+    Y+NFP  L + G I
Sbjct: 156 FGDNFIADMQFAVANETNSTVGVLGIGFERLESVKGYEGAPNTY--YQNFPLALKNNGVI 213

Query: 298 RKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLH-X 356
            K+AYSL++N L+++ GS+LFG +D +KYTG L T PLVN I  + V KP +F VT+   
Sbjct: 214 DKTAYSLYLNSLDSSSGSILFGGIDSNKYTGDLYTFPLVN-IHPSVVNKPAKFHVTVQGI 272

Query: 357 XXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEI 416
                           +PALLDSGTT    P     ++A  +NA Y D +G Y   C   
Sbjct: 273 GVQSSGSEQSILMSTKYPALLDSGTTLLVAPQEFADSMANYVNATYNDLEGIYTMTCPPE 332

Query: 417 SDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAY 476
           +D  E +FDFG   IK  L NF LA    +DNE   C   ++P     +ILGD FL+AAY
Sbjct: 333 NDDTEFLFDFGDLKIKVPLKNFILAP---EDNE--YCGFGVLP-TVDTMILGDMFLSAAY 386

Query: 477 VVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWT 521
           VVYDLE+ E+S+AQAN +    +I+ I  TVP A KA   ++TW+
Sbjct: 387 VVYDLESYEVSLAQANWNSDESEIQAIRHTVPGATKAT--AATWS 429

>Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C
           (REAL)
          Length = 540

 Score =  242 bits (618), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 169/513 (32%), Positives = 255/513 (49%), Gaps = 64/513 (12%)

Query: 23  AEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVT 82
           ++A +    + +VKL   KL    + N        + +      +    + +    Y V 
Sbjct: 16  SQAVFGSSSNSYVKLLVQKLAN--IPNINLQGASGISKRSEAFNSTLINMFSSAGMYVVK 73

Query: 83  IGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDTNGKDFYS 142
           + +G+P Q   L +DTGSSD+ +  ++  YCE                  D+ N      
Sbjct: 74  MEIGTPPQTAYLQLDTGSSDMCINEADAAYCES---------------LADENNIS---- 114

Query: 143 DLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSEYGTF 202
                         + +Y  TAT + + +T+        P+A    +Y A   CS +GTF
Sbjct: 115 --------------TSNYELTATAIEILSTA-------APSA----AYNA--PCSYWGTF 147

Query: 203 ATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLG 262
           + +SSS+FK N T F + YGD SY  G +G D V+L ++ +S+ +  V+N + +  G+LG
Sbjct: 148 SPNSSSTFKYNETIFNLTYGDNSYYAGTYGTDVVSLGNITLSNFTFGVSNDTTNNGGILG 207

Query: 263 IGLPGLEVT----NALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLF 318
           + LP  EVT    +AL+ S +  + Y NFP  L  QGKI+K AYSLF+N+ +A  GS+LF
Sbjct: 208 VSLPSAEVTDDTEDALS-SNTTPFIYNNFPMALKSQGKIKKIAYSLFLNEPSARFGSILF 266

Query: 319 GAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLD 378
           GAVD S+Y+G L T+P++ +  +        F                      FP L D
Sbjct: 267 GAVDKSEYSGQLYTLPMLQAYNTLDATDAGMFVTAQSVAILDSKSGNKTVSEVQFPVLFD 326

Query: 379 SGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNF 438
           SGT+ + LP  +  AI +  + +Y  +D  Y + C +++++  L FDFGGF+I + + NF
Sbjct: 327 SGTSTSVLPTKIADAIGRSFDGKYSSDDQGYIFDCAKVNNT-LLSFDFGGFNISANISNF 385

Query: 439 ALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSE 498
                D        C L ++P +    +LGD FL   YVVYDLEN E+S+AQA+ D   E
Sbjct: 386 VTPAKDH-------CILQILPSDT-IFVLGDAFLVDTYVVYDLENHEVSVAQASFDNKEE 437

Query: 499 DIEEIVSTVPSAVKAPGYSSTW--TSAIPISTG 529
           DI  I  +VP A  APGYSSTW  T   PI +G
Sbjct: 438 DIGIISDSVPGATPAPGYSSTWRYTPGSPIGSG 470

>YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}
           YPS6Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance
          Length = 537

 Score =  239 bits (609), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 169/462 (36%), Positives = 236/462 (51%), Gaps = 71/462 (15%)

Query: 79  YSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDTNGK 138
           Y V + +G+P Q + L +DTGSSD+ V  ++  YC+  S                  +G 
Sbjct: 67  YVVKMEIGTPPQTLYLQLDTGSSDMIVNNADIAYCKSMS------------------DGS 108

Query: 139 DFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTAT-SMDSYQATISCS 197
           D+ S     LTAT    ++G                      +P+ T S ++Y     CS
Sbjct: 109 DYASTDNYELTAT----FNG----------------------LPSTTISSEAYNTL--CS 140

Query: 198 EYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVAN--ISN 255
            +GTF   +SS+F++N T F   YGD +Y  G +G D V+ +++ ++D +  V+N  I N
Sbjct: 141 YWGTFDASNSSTFENNATFFNNTYGDGTYYAGTYGTDVVSFENITLNDFTFGVSNDTIGN 200

Query: 256 STFGVLGIGLP------GLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDL 309
            + G+LGI LP      G+E   AL  +P   + Y NFP  L +QGKI K AYSLF+N  
Sbjct: 201 PS-GILGISLPIAEFTDGIEYALALNRTP---FIYDNFPMELKNQGKINKIAYSLFLNGP 256

Query: 310 NATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXX 369
           +A  GS+LFGAVD SKYTG L T+P++ +  +     P                      
Sbjct: 257 DAHFGSILFGAVDKSKYTGQLYTLPMLQAFNTLG-SNPGMIITAQSVAILDSESGNKTVS 315

Query: 370 XXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGF 429
              FP +LDSGTTF++LP  +  AI K  + EY  +D  Y + C +++D+  L  DFGGF
Sbjct: 316 DIQFPVMLDSGTTFSYLPTEIAEAIGKSFDGEYSSDDQGYIFDCSKVNDT-LLSVDFGGF 374

Query: 430 HIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMA 489
           +I + + NF  +         D C L  +  +    +LGD FL  AYVVYDLEN EIS+A
Sbjct: 375 NISANISNFVTSA-------KDRCVLN-VKQSESTYMLGDAFLVDAYVVYDLENYEISIA 426

Query: 490 QANLDGGSEDIEEIVSTVPSAVKAPGYSSTWT--SAIPISTG 529
           QA+ +   EDIE I  TVP A  APGY STW      PI TG
Sbjct: 427 QASFNNQEEDIEVISDTVPGATPAPGYFSTWVYKPGSPIGTG 468

>KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score =  236 bits (601), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 129/344 (37%), Positives = 200/344 (58%), Gaps = 13/344 (3%)

Query: 196 CSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQD--VKVSDISLAVANI 253
           C EYGTF    SS+F+   +   I Y D +   G WG D + L +  +++ +  + VA+ 
Sbjct: 93  CKEYGTFDYGQSSTFQDRNSALKINYQDGTKVDGRWGVDTLELNNGAIQLQNTMIGVADS 152

Query: 254 SNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATH 313
           S+S  GV+G+G PGLE TN + ++  ++YTY NFP  L  QG    + +++ ++  N+  
Sbjct: 153 SDSVAGVIGLGFPGLETTNNV-QANGESYTYANFPMQLKQQGVTDATVFAIALD--NSYG 209

Query: 314 GSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXX-XXXP 372
           G +LFGAVD  KY G L T+P+VNS  +A    PI+ +VTL                  P
Sbjct: 210 GDILFGAVDEGKYIGGLYTLPVVNSRGTA---TPIRMEVTLQGIGVDSDGGDQETFSSTP 266

Query: 373 FPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIK 432
             AL+DSG+T  +LP  + +AI  K+ A Y      Y   C    ++D L+FDFGGFHI 
Sbjct: 267 MLALVDSGSTMVYLPELIATAIYNKVGARYDGSSEMYTIDCGTNVENDNLIFDFGGFHIS 326

Query: 433 SKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQAN 492
           + + N+ +    D  +    C   ++  +   ++LGD FL++AYVV+DL++ EISMAQ N
Sbjct: 327 TPVSNYIIT---DQRSSNGQCLFGILSQSGNTVVLGDTFLSSAYVVFDLDHYEISMAQGN 383

Query: 493 LDGGSEDIEEIVS-TVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535
            + G  +++++ S T+P+A KAP YS TW++  P+++GGNIFT+
Sbjct: 384 SNNGDGNVKDVTSGTIPNARKAPMYSQTWSTNAPVTSGGNIFTL 427

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 53/82 (64%), Gaps = 13/82 (15%)

Query: 35  VKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTL 94
           V L F ++R          Q P++  V+R+DG  S  +  Q  FYS+ + +G+P+Q VT+
Sbjct: 20  VNLPFKRVR----------QSPQL--VRREDGD-SVHLGKQTGFYSIDLAIGTPSQKVTV 66

Query: 95  LIDTGSSDIWVMGSNNPYCEGS 116
           L+DTGSSD+WV G+NNPYC+ S
Sbjct: 67  LLDTGSSDLWVTGANNPYCQTS 88

>NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa]
           {ON} Anc_7.182
          Length = 540

 Score =  231 bits (590), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 155/467 (33%), Positives = 227/467 (48%), Gaps = 77/467 (16%)

Query: 57  RVKRVKRDDGTASFEIDNQ---DTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYC 113
           + +  KR+ G+   EI+ Q    T+Y+ T+ +G+P Q++T+L D+GSSD+WVM ++NPYC
Sbjct: 37  KNQYAKRNSGSGHLEIELQHIEQTYYATTLEIGTPPQNLTVLFDSGSSDLWVMDASNPYC 96

Query: 114 EGSSGKSKHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTS 173
           E                                    TG+  Y+GS    A         
Sbjct: 97  ESQ---------------------------------YTGSQTYNGSSINQA--------- 114

Query: 174 YWPDDTDVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGT-QFLIQYGDLSYALGVWG 232
                             +TI CS + TF    SSSFK+ GT +F   Y D ++A G W 
Sbjct: 115 ------------------STIDCSSFMTFNKSLSSSFKTKGTSRFYAYYSDKTFADGSWA 156

Query: 233 RDDVTLQDVKVSDISLAVAN-ISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAML 291
            + +T+  V VS +   + N ++    GVLGIG P  E       +P++ Y   NFP +L
Sbjct: 157 TEKLTMNGVDVSSLQFGLGNCVTTPVSGVLGIGFPRRESVKGYDNAPNEFY--PNFPQVL 214

Query: 292 VDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFD 351
            +QG I   AYS+F+N L +  GS+LFGA+D SKYTG L T P++N I      KP    
Sbjct: 215 KNQGIIDVVAYSMFLNKLESDTGSILFGAIDTSKYTGDLVTFPMLN-IYPDVTDKPATLM 273

Query: 352 VTLH--XXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFY 409
           V L                     P LLDSGTT    P  +   +A  +NA + +++G Y
Sbjct: 274 VILQGLGAQDNANCKAETFVTSKIPVLLDSGTTLMGAPKEIADMMADFMNATFSEDEGIY 333

Query: 410 RYQC--DEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIIL 467
             +C   E   + + +FDFGG  IK  L NF L+      +E   C  A++P +   ++L
Sbjct: 334 IMECPTKETLANTDYIFDFGGVQIKVPLSNFILSA----QSEGGPCGFAVLPDDSNTMVL 389

Query: 468 GDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAP 514
           GD FL++AYVV+DL+N +IS+A ANLD     +E+ +  +PS    P
Sbjct: 390 GDIFLSSAYVVFDLDNYQISLAAANLDNNVS-LEDSIINIPSDGNIP 435

>Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)
          Length = 342

 Score =  217 bits (553), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 129/320 (40%), Positives = 176/320 (55%), Gaps = 12/320 (3%)

Query: 213 NGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVTN 272
           N TQF   YGD +Y  G +G D V+L ++ +   S  VAN + +  G+LGI LP  E T+
Sbjct: 1   NDTQFDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTENQGGILGISLPAGENTH 60

Query: 273 ALAES-PSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQ 331
           +L  +  +  + Y+NFP  L   GKI K AYSLF+N+  A  GS+LFGAVD SKY+G L 
Sbjct: 61  SLGGAYNTTPFEYENFPMALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQLY 120

Query: 332 TIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLV 391
           T+P++ +  +     P  F                      FP L DSGTT++ LP  + 
Sbjct: 121 TLPMLQAYDTLDSVSPGMFVTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTEVA 180

Query: 392 SAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETD 451
            AI K  + +Y   D  Y + C ++ D+  L  DFGGF+I + + NF   T D       
Sbjct: 181 HAIGKSFDGKYSSGDQGYTFDCSKVKDT-LLSIDFGGFNISANISNFVTRTKDH------ 233

Query: 452 VCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAV 511
            C L +   + G  +LGD FL  AYVV+DLE+ E+S+AQA+ D   E+IE I   VP A+
Sbjct: 234 -CLLNIEAADSG-FVLGDAFLVDAYVVFDLESHEVSIAQASFDDKKEEIEVISDRVPGAI 291

Query: 512 KAPGYSSTW--TSAIPISTG 529
           +APGYSSTW  T   PI TG
Sbjct: 292 RAPGYSSTWVYTPGSPIGTG 311

>CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3
          Length = 521

 Score =  218 bits (555), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 135/366 (36%), Positives = 203/366 (55%), Gaps = 18/366 (4%)

Query: 176 PDDTDVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDD 235
           P D    T   +     T+ C +YG +  + SS+F SNGT   I YGD  +  G WG D 
Sbjct: 100 PGDDYPRTPNQVPKSDRTLDCKKYGFYNRNESSTFNSNGTDLFITYGDNGFVRGTWGTDS 159

Query: 236 VTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVT---NALAESPSDAYTYKNFPAMLV 292
           V++ ++ +S++S+ V+ ++N++ G+LG+GLPG E T   ++    PS+ Y Y NFP  L 
Sbjct: 160 VSVGNLNLSNLSIGVSPMTNTSTGILGVGLPGEESTFNYSSNVTGPSN-YQYSNFPIRLK 218

Query: 293 DQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDV 352
           ++G I K AYS+++N+  + +GS+LFGAVDHSKY G L T PLVNS K  +   P QF++
Sbjct: 219 EEGLIEKIAYSIYLNETGSKYGSILFGAVDHSKYQGPLYTFPLVNS-KYKEGSDPFQFEI 277

Query: 353 TLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEY-GDEDGFYRY 411
           T++                  P LLDSG+T + LP  +   +A+++N    G  +     
Sbjct: 278 TMNGVGLVGKTDNITLYDQKLPTLLDSGSTISLLPRDVADLVAQQVNGTVDGKGNCIKLP 337

Query: 412 QCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEI-ILGDN 470
           +C    D+ +L+F+F G         F++   D  +     C L     +     +LGDN
Sbjct: 338 KCPSKKDNQKLIFNFSGAE-------FSVNVTDFMEKHKGKCYLQFSALDGINFALLGDN 390

Query: 471 FLTAAYVVYDLENLEISMAQANLDGG-SEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTG 529
           F+   Y V++L++ E+S+AQAN +     DIEEI  TVPSAV AP Y +T+ SA P +T 
Sbjct: 391 FMNNVYTVFNLDDKELSLAQANYNSSLKPDIEEIKDTVPSAVLAPQYYNTF-SADPTATA 449

Query: 530 --GNIF 533
             GNIF
Sbjct: 450 VTGNIF 455

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 40/81 (49%), Gaps = 14/81 (17%)

Query: 34  FVKLSFDKLRG-DLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDV 92
           +VKL F K  G DL            KR   D   A    D     Y V + VG+P Q V
Sbjct: 17  YVKLDFTKTPGSDLA-----------KRDVVDPEAAQLTFDKDQ--YIVEVAVGTPPQKV 63

Query: 93  TLLIDTGSSDIWVMGSNNPYC 113
            L IDTGSSD++V+  +NPYC
Sbjct: 64  LLQIDTGSSDLFVIEESNPYC 84

>CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
          Length = 539

 Score =  218 bits (556), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 151/470 (32%), Positives = 233/470 (49%), Gaps = 69/470 (14%)

Query: 76  DTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDT 135
           D  Y+V + VG+P Q+VT+ +DTGSSD+W   ++NPYC+ ++                  
Sbjct: 50  DLMYTVQLHVGTPPQNVTVQLDTGSSDLWFPVASNPYCKRNA------------------ 91

Query: 136 NGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATIS 195
                    +  L ATG        +AT  D   +                      T  
Sbjct: 92  ---KLAPKKVKALPATG--------FATENDQVAKKLR-------------------TFD 121

Query: 196 CSEYG-TFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANIS 254
           C  +G   ++ SSS   ++ ++F ++Y D +YA G+WG D   L    VS+I+ A+ANI+
Sbjct: 122 CDAFGLFNSSMSSSFKSNDSSEFFVKYEDGTYASGMWGTDTFKLNHHNVSNITFALANIA 181

Query: 255 NSTFGVLGIGLPGLEVTNALAESP-----SDAYTYKNFPAMLVDQGKIRKSAYSLFVNDL 309
           N++ GVLG+G P  E T+    SP      + Y Y NFP  L     I+K +YS+F+ND 
Sbjct: 182 NASMGVLGVGFPAEETTDD--PSPGSLIDKEHYQYDNFPIALKRTRTIKKVSYSIFLNDT 239

Query: 310 NATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXX 369
           N+  G +LFG VDHSKY GTL T+P+VN++ +       + ++TL+              
Sbjct: 240 NSKKGVILFGGVDHSKYQGTLWTVPMVNNLLTLNQTTTSRPEITLNGLGFRDDKKNVTLW 299

Query: 370 XXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRY-QCDEISDSDELVFDFGG 428
               P LLD+GTT  + P  +V  IAK++N     + G  +  +C    D+ EL+F+F G
Sbjct: 300 GEKIPVLLDTGTTLAYAPKQVVDVIAKRVNGTIDSKTGGIKLKKCPNAKDNSELIFNFAG 359

Query: 429 FHIKSKLDNFALATYDDDDNETDVCALALIPY---NRGEIILGDNFLTAAYVVYDLENLE 485
             I   L N         +     C L +  +   ++  ++LGD F+   Y V+++E++E
Sbjct: 360 AEIPVSLLNMV-------EKRKGKCYLEIRYHEELSKTGMLLGDIFMRHVYSVFNMEDME 412

Query: 486 ISMAQAN-LDGGSEDIEEIVSTVPSAVKAPGYSSTWTSA-IPISTGGNIF 533
           +S A AN  D     IE I+S VPSAVKAP Y +T+ S+ +P +   +IF
Sbjct: 413 VSFAVANGNDSAPLQIEAIISDVPSAVKAPQYYNTFASSNLPSTVTNDIF 462

>KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]
           {ON} some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease
          Length = 511

 Score =  217 bits (553), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 153/470 (32%), Positives = 225/470 (47%), Gaps = 75/470 (15%)

Query: 56  PRVKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEG 115
           P  + +++   +   +++ QD FY+V +GVG+P+Q +  + DTGSSD+WV   +NP+C G
Sbjct: 37  PADRSLQKRSKSFESKLNPQDYFYTVELGVGTPSQKINCIFDTGSSDLWVPAKSNPFCLG 96

Query: 116 SSGKSKHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYW 175
           +               + DTNG               T E+ G      T++T       
Sbjct: 97  N---------------KLDTNG---------------TNEFHG------TEIT------- 113

Query: 176 PDDTDVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDD 235
                             + C + G F   SS S  + G  F  QY D SY+ G W  DD
Sbjct: 114 ----------------PILDCDKIGVFDPGSSYSLSATGYNFSTQYFDGSYSDGFWVVDD 157

Query: 236 VTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQG 295
           +++ D +V D+  AVANIS++  GVLG+GLP LE       +P+    Y NFP  L    
Sbjct: 158 ISIADQQVPDLQFAVANISSAPSGVLGVGLPRLEAVRGYDGAPN--ANYDNFPQTLKSNR 215

Query: 296 KIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLH 355
            I +  YSL+ +  +   G+VLFG +D  KY G L T+PLVN  +  Q+ +P  FD+TL 
Sbjct: 216 LINRVLYSLYFDSGDLESGTVLFGGIDEKKYDGVLYTLPLVNIYE--QIDEPAAFDITLQ 273

Query: 356 XX--XXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQC 413
                               PALLDSG+T    P   + +IA++L A + + DG Y   C
Sbjct: 274 GLGIRSESNCKDTVIAHKKAPALLDSGSTIMGAPQEALESIAQELGAAFSESDGLYVLDC 333

Query: 414 DEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLT 473
              +D     FDFG   +K  + +         ++  + C LA+I     E ILGD  L 
Sbjct: 334 PASNDDRTFYFDFGELKLKVPIHDLLYLP----ESGQNYCGLAIIASGE-EWILGDLVLK 388

Query: 474 AAYVVYDLENLEISMAQANLDGGSEDIEEIVST--VPSAVKAPGYSSTWT 521
           +AYVVYDL+NLEIS+AQ     GS  I+ + +T  +P   K+   S+ W+
Sbjct: 389 SAYVVYDLDNLEISIAQVKTTSGSR-IQTVSATGSLPQTRKS--NSTPWS 435

>Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR039C
           (REAL)
          Length = 387

 Score =  213 bits (542), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 128/325 (39%), Positives = 178/325 (54%), Gaps = 13/325 (4%)

Query: 210 FKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLE 269
           FK N T F I Y D SY  G +G D V+L D+ +S+ +  V+N +    G+LGI LP  E
Sbjct: 1   FKYNETIFNITYDDNSYYAGTFGTDIVSLGDITLSNFTFGVSNDTTINGGILGISLPSAE 60

Query: 270 VTNA---LAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKY 326
           +T++      S +  + Y NFP  L +QGKI K AYSLF+N+ NA  GS+LFGAVD SKY
Sbjct: 61  ITDSGQGALSSNTTPFAYDNFPMALKNQGKIEKIAYSLFLNEPNARFGSILFGAVDKSKY 120

Query: 327 TGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHL 386
           TG L T+P++ +  +                               FP L DSGT+ + L
Sbjct: 121 TGQLYTLPMLQAYNTLDALGGGMLVTAQSVAILDSISGNKTVSEVQFPVLFDSGTSTSVL 180

Query: 387 PGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDD 446
           P  +  AI +  + +Y  +D  Y + C +++++ +L  DFGGF+I + + NF      D 
Sbjct: 181 PTEIADAIGRSFDGKYSSDDEGYIFDCSKVNNT-QLSIDFGGFNISANISNFVTPLTKDH 239

Query: 447 DNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVST 506
                 C L ++P +    +LGD FL   YVVYDLE+ E+S+AQA+ +   EDIE I  +
Sbjct: 240 ------CVLQILPSDTVS-VLGDAFLVDTYVVYDLESHEVSVAQASFNNEEEDIEIISDS 292

Query: 507 VPSAVKAPGYSSTW--TSAIPISTG 529
           VP A  APGYSSTW  T   PI TG
Sbjct: 293 VPGATPAPGYSSTWVYTPGGPIGTG 317

>Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar to
           Ashbya gossypii AGR240W
          Length = 518

 Score =  214 bits (546), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 147/471 (31%), Positives = 223/471 (47%), Gaps = 76/471 (16%)

Query: 64  DDGTASFEID--NQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSK 121
           +DG   F +D  N +  Y   I VG+P Q + +L DTGS+D+W   S+N YC  S  +  
Sbjct: 35  NDGEKCFSMDLINNNDHYLAEIEVGTPPQKLKVLFDTGSADLWFQSSDNEYCAASYPQG- 93

Query: 122 HVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDV 181
                     ++ TN  D   ++ S+                                  
Sbjct: 94  ----------DNSTNTNDNEQNMASF---------------------------------- 109

Query: 182 PTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDV 241
                         CS   T+    SS+F   G +F I Y + +++ G+W +D + + + 
Sbjct: 110 --------------CSSSRTYNFQRSSTFTPTGYKFFIDYVN-TFSRGIWAKDRLVIGNA 154

Query: 242 KVSDISLAVANISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKS 300
            VS +   V+NISN+T  G+LG+G   LE     + +P+   TY N P +L + GKI K 
Sbjct: 155 DVSGLQFGVSNISNTTINGILGVGYERLESVKGYSGAPNR--TYPNLPMLLKESGKIDKV 212

Query: 301 AYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXX 360
           AYS+F+N LN+   +V FG VD  KYTG L   PLVN  KS  +P+P +F +TL      
Sbjct: 213 AYSVFLNHLNSNVSTVTFGGVDSEKYTGDLYKFPLVNIYKS--IPRPSKFHITLQALEVH 270

Query: 361 --XXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISD 418
                        P PAL D+GT    +P  +   IA  ++A + ++   Y + C    D
Sbjct: 271 GNYSSLNKTVSNTPLPALFDTGTNGMVVPPNVAENIASTIHATFDEKFSLYLFACPAEED 330

Query: 419 SDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVV 478
             +LVFDFG   I++ L NF +   +     T+ C +A+IP + G   LG  FL + YVV
Sbjct: 331 DTKLVFDFGDIQIEAPLANFIVPAAELG---TEQCGVAIIPED-GTFTLGIPFLRSTYVV 386

Query: 479 YDLENLEISMAQANLD-GGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPIST 528
           Y+LE+ E+++AQAN    G   I  I+S +P A +A   ++ W + +  ST
Sbjct: 387 YNLEDYEVALAQANWKWDGKSKITPIISNIPGATQA--TATPWNTNMEQST 435

>SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 557

 Score =  209 bits (531), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 151/485 (31%), Positives = 236/485 (48%), Gaps = 84/485 (17%)

Query: 54  QIPRVKRVKRDDGTASFEIDNQDTFYS----VTIGVGSPAQDVTLLIDTGSSDIWVMGSN 109
           ++P  ++  + DG+A  E+D  +  YS    V I +G   Q++  + DTG SD WV+G N
Sbjct: 75  RMPVEEKFIKRDGSAR-ELDLYNRAYSGLLNVIISIGKEGQNMFFVADTGLSDTWVVGQN 133

Query: 110 NPYCEGSSGKSKHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTV 169
           + YC+  +G +                             A  TA +S + +A       
Sbjct: 134 SVYCDIENGTTP----------------------------ANHTANFSENTFAFKNHA-- 163

Query: 170 ETTSYWPDDTDVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALG 229
                +P                   C     F  + S+S  SN T F  Q+ D ++A G
Sbjct: 164 -----FP-------------------CYLADVFEVNYSTSIVSNNTDFFTQFYDYTFASG 199

Query: 230 VWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPA 289
            W +D + +  + +   +  VA  +N+T G LG+GL G E+TN         YTY+NFP 
Sbjct: 200 TWYQDTIEVGSIIIEKFNFGVAQETNATIGSLGLGLEGNEITN----EGDYTYTYENFPT 255

Query: 290 MLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTG-TLQTIPLVNSIKSAQVPKPI 348
            L + G I++  YS++   ++   GS+LFGAV+HS+Y G TL T+PLVN   ++    P+
Sbjct: 256 KLKNSGMIKRVIYSIYAGKIDTEDGSLLFGAVEHSRYVGDTLYTLPLVNVNNASS--DPV 313

Query: 349 QFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLN-AEYGDEDG 407
           +F VTL                  + ALL++G   T+LP +L S   KK   +E     G
Sbjct: 314 EFHVTLQNLVVSVNKTNTTIMSDRYAALLNTGAIVTYLPTHLFSDFIKKTGLSESQKYYG 373

Query: 408 FYRYQC-DEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEII 466
            Y   C  EIS S    +DFGGF I+S L+++ L   D+ +     CA+ +  ++   ++
Sbjct: 374 MYVTDCSSEISFS----YDFGGFKIESSLNDY-LFEIDESEIPGAKCAVTINSHDEKYLV 428

Query: 467 LGDNFLTAAYVVYDLENLEISMAQA----------NLDGGSEDIEEIVSTVPSAVKAPGY 516
           LG  F ++AYVV+DLE LE+S+AQA          N++  + D+E ++ ++PSA KA  Y
Sbjct: 429 LGSGFFSSAYVVFDLERLEVSIAQAAHVYDNFTYSNIE-DNPDVEIVIDSIPSATKAASY 487

Query: 517 SSTWT 521
           S+TWT
Sbjct: 488 SNTWT 492

>Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W
           (REAL)
          Length = 516

 Score =  203 bits (517), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 145/482 (30%), Positives = 232/482 (48%), Gaps = 79/482 (16%)

Query: 64  DDGTASFEIDNQ---DTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKS 120
           +DG+   E+  Q     +Y+ T+ +G+P+Q +T+L DTGS+D WVM S+NP+C   S  S
Sbjct: 27  NDGSGHLELSLQREEQMYYATTLDIGTPSQQLTVLFDTGSADFWVMDSSNPFCSPKSNPS 86

Query: 121 KHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTD 180
               L+++                         A Y+GS    + D              
Sbjct: 87  ----LYQN-------------------------ATYNGSKITPSVD-------------- 103

Query: 181 VPTATSMDSYQATISCSEYGTFATDSSSSFKS--NGTQFLIQYGDLSYALGVWGRDDVTL 238
                          CS   T+  +SSS+++   NG +F I Y D +++ G WG++ V++
Sbjct: 104 ---------------CSSMSTYNENSSSTYQDLDNG-RFYIIYADETFSDGSWGKETVSV 147

Query: 239 QDVKVSDISLAVANISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKI 297
             + + DI   +A  + +   GVLGIG P  E       +P D Y Y NFP +L  +  I
Sbjct: 148 NGIDIPDIQFGLAKYATTPVSGVLGIGFPRRESVKGYEGAP-DKY-YPNFPQLLKSEQII 205

Query: 298 RKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKS-AQVPKPIQFDVTLHX 356
              AYSLF+N  ++  GS++FGA+D SK+ G L T P+VN   +    P  +   +    
Sbjct: 206 DVVAYSLFLNSPDSGMGSIVFGAIDESKFYGDLLTFPMVNEYPTIVDAPATLAMTIQGLG 265

Query: 357 XXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEI 416
                           +P LLDSGT+  + P  +   +A  +NA Y  ++G Y   C + 
Sbjct: 266 AQNKSGCERETFMTTKYPVLLDSGTSLLNAPKTIADKMASFVNASYSADEGIYILNCPDS 325

Query: 417 SDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAY 476
           +D  E  FDFG   I   L +  L+     + E   C  A+ P N   ++LGD FL++AY
Sbjct: 326 ADDIEYTFDFGDLQINVPLTSLILSP----EVEGGYCGFAVQPTND-SMVLGDVFLSSAY 380

Query: 477 VVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSST----WTSAIPISTGGNI 532
           VV+DL+N +IS+AQAN +  SED +++++ +P+    PG  S     W++  P +   +I
Sbjct: 381 VVFDLDNYKISLAQANWN-ASEDSKQVIN-IPTDGSIPGGKSATAEPWSTNEPFTVTSDI 438

Query: 533 FT 534
           ++
Sbjct: 439 YS 440

>KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa]
           {ON} 
          Length = 531

 Score =  201 bits (510), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 142/342 (41%), Positives = 193/342 (56%), Gaps = 15/342 (4%)

Query: 195 SCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANIS 254
           S + YG F+   S+S K NGT+F  QY D + A G W  D V L D  VS+++ AV N +
Sbjct: 105 SSASYGVFSPKDSTSLKFNGTEFSTQYADGTTAYGEWCYDTVALGDTTVSNVTFAVVNDT 164

Query: 255 NSTFGVLGIGLPGLEVT--NALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNAT 312
           +S FGVLG+GL GLE T  NAL    S  Y Y NFP  LV QG I+ +AYSL++N  +A+
Sbjct: 165 DSNFGVLGLGLTGLEATYTNAL----SSPYQYDNFPVKLVRQGLIQANAYSLYLNKADAS 220

Query: 313 HGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXP 372
            G+VLFGAVDH+KYTGTL TIP VN+++S      I+F VTL                  
Sbjct: 221 SGNVLFGAVDHAKYTGTLHTIPFVNTLESLGYNSVIEFHVTLDGMDLSTNDGQTTLTTSK 280

Query: 373 FPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIK 432
           FP L+DSG TF++LP  L+  IA ++ A Y +E   Y   C    D   + ++FGGF+I 
Sbjct: 281 FPVLVDSGNTFSYLPDNLLQQIASQIGATYSNEYVGYVLTCPSEDDDTVISYNFGGFNID 340

Query: 433 SKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYV--VYDLENLEISMAQ 490
           + L   ++    DD N    C L + P       LGD FL   Y    + +E+L ++ AQ
Sbjct: 341 TPLSG-SVTELGDDSN---TCILMIAPSGSEFGQLGDTFLENVYASSTWTIESLSLAQAQ 396

Query: 491 ANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNI 532
                  E+IE I S++P A+KA GYS  W+++   ST GN+
Sbjct: 397 YT---DEEEIEIISSSIPGAIKAAGYSDIWSASAKNSTSGNV 435

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 48/79 (60%), Gaps = 2/79 (2%)

Query: 29  QDESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGVGSP 88
           +  S FV ++F++L G   + A + +   +  +KR +      + N+  FYS+ + +GS 
Sbjct: 26  ESSSGFVSMNFNRLYGASPDTAVSKR--SMSHIKRSENYEQVRLKNEACFYSMDLAIGSN 83

Query: 89  AQDVTLLIDTGSSDIWVMG 107
            Q+VT+L+DTGSSD+WV G
Sbjct: 84  HQNVTVLVDTGSSDLWVPG 102

>NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {ON}
           Anc_7.182
          Length = 547

 Score =  192 bits (489), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 145/499 (29%), Positives = 235/499 (47%), Gaps = 91/499 (18%)

Query: 56  PRVKRV-KRDD--GTASFEIDN-QDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNP 111
           P   R+ KR+D  G    ++++ Q T+Y+ T+ VG+P Q++T+L+D+GSSD W+M     
Sbjct: 29  PLSNRINKRNDISGHLHMKLEHIQQTYYATTLQVGTPPQNITVLLDSGSSDFWLMD---- 84

Query: 112 YCEGSSGKSKHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVET 171
                   SK+    E+                  Y  +T   +Y+              
Sbjct: 85  --------SKNPFCMEN------------------YCNSTEIPKYNND------------ 106

Query: 172 TSYWPDDTDVPTATSMDSYQATISCSEYGTFATDSSSSFK---SNGTQFLIQYGDLSYAL 228
                          + +   TI CS +  +  + SS+++   ++ ++F +QY D S+  
Sbjct: 107 ---------------LITQNLTIDCSYFNKYNPEISSTYQKLPNDNSRFYLQYTDGSFED 151

Query: 229 GVWGRDDVTLQDVKVSDISLAVANISNSTFG-VLGIGLPGLEVTN----ALAESPSDAYT 283
           G+W ++ V + +  ++ + LAVAN + +  G +LGI  P  E       AL E       
Sbjct: 152 GIWSKETVQIDNYNITSLQLAVANYATTPVGGLLGISFPRRESVKGYDGALNEY------ 205

Query: 284 YKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQ 343
           Y NFP +L ++  I    YS+++NDLN   GS+LFGA+D SK+ G + T P+VN +    
Sbjct: 206 YPNFPQVLKNENIIDIVLYSMYLNDLNQ-DGSLLFGAIDTSKFEGDMITYPMVN-VYPNV 263

Query: 344 VPKPIQFDVTLH---XXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNA 400
           V KP    +T+                     FP LLDSGTT    P  L   +A  +NA
Sbjct: 264 VDKPATLALTIQGVAAQNTNDCTQNETFMTSKFPVLLDSGTTLMSAPKELADKMADFVNA 323

Query: 401 EYGDEDGFYRYQC--DEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALI 458
            Y ++D  Y   C   E+ +  E +FDFGG  +K  L+ F L +    D+ +  CA  ++
Sbjct: 324 TYSEDDRIYILNCPSQEVLNDIEYIFDFGGLQVKIPLEKFILPS----DDGSGPCAFGVL 379

Query: 459 PYNRGE-IILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYS 517
           P    + ++LGD FL+  Y V+DL++ +IS+A  N +  SE  E+ +  +PS    PG  
Sbjct: 380 PETTTDRMVLGDIFLSFVYAVFDLDHYQISLANINKNANSESNEDSIINIPSNGAIPGAK 439

Query: 518 ----STWTSAIPISTGGNI 532
                 W++  PI+   NI
Sbjct: 440 VATVKPWSTHEPITVTTNI 458

>Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W
           (REAL)
          Length = 593

 Score =  194 bits (492), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 149/481 (30%), Positives = 227/481 (47%), Gaps = 77/481 (16%)

Query: 64  DDGTASFEIDNQ---DTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKS 120
           +DGT   E   Q   D +Y+ T+ +G+P+Q +T+L DTGS+D W+M S+NP+C  +S  S
Sbjct: 27  NDGTGRLEFSLQRKEDMYYATTLDIGTPSQQLTVLFDTGSADFWIMDSSNPFCLSTSSTS 86

Query: 121 KHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTD 180
                                    SYL AT    Y GS    + D              
Sbjct: 87  -------------------------SYLNAT----YDGSIITPSVDC------------- 104

Query: 181 VPTATSMDSYQATISCSEYGTFATDSSSSFKS--NGTQFLIQYGDLSYALGVWGRDDVTL 238
                     Q+ ++ SE       +SS++++  NG +F I Y D ++A G WG + V++
Sbjct: 105 ----------QSMVTYSE------GNSSTYQNLDNG-RFYIIYADGTFADGTWGTETVSI 147

Query: 239 QDVKVSDISLAVANISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKI 297
             + + +I   +A  + +   GVLGIG P  E       +P+    Y NFP +L  +  I
Sbjct: 148 DGIVIPNIQFGLAKYATTPVSGVLGIGFPRRESVKGYEGAPNKY--YPNFPQILKSEQII 205

Query: 298 RKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKS-AQVPKPIQFDVTLHX 356
              AYSLF+N   +  GS++FGA+D SK++G L T P+VN   +    P  +   +    
Sbjct: 206 DVVAYSLFLNSPESGTGSIIFGAIDESKFSGDLFTFPMVNEYPNIVDTPATLAMTIQGLG 265

Query: 357 XXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEI 416
                           +P LLDSGT+  + P  +   +A  +NA Y  E+G Y   C   
Sbjct: 266 AQNKNSCEYETFMTTKYPVLLDSGTSLLNAPKVIADKMASFVNATYSAEEGIYILDCPAF 325

Query: 417 SDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAY 476
           +D  E  FDFG   I   L +  L+     + E   C  A+ P N   ++LGD FL++AY
Sbjct: 326 ADEIEYTFDFGDLKISVPLTSLILS----PEAEGGYCGFAVQPTN-DSMVLGDVFLSSAY 380

Query: 477 VVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSST---WTSAIPISTGGNIF 533
           VV+DL+N +IS+AQAN D  SE   ++V+         G ++T   WT+  P +   NIF
Sbjct: 381 VVFDLDNYKISLAQANWD-VSEITTKLVNVRADGSIPGGKTATAEPWTANEPFTVTSNIF 439

Query: 534 T 534
           +
Sbjct: 440 S 440

>TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8.318
           YLR120C
          Length = 1000

 Score =  198 bits (504), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 120/348 (34%), Positives = 184/348 (52%), Gaps = 18/348 (5%)

Query: 192 ATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVA 251
            + +C  +G+F+   SS+F  N T+F I Y   +  +GVWG+D++ +  V  + +S  V 
Sbjct: 113 GSFNCERFGSFSISKSSTFTKNSTEFAITYVSGNNCIGVWGQDNLIIGGVNATGLSFGVV 172

Query: 252 NISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNA 311
           + + S+ G+LGIGLP  E T   A      Y Y NFP +L ++G I    YS++++  ++
Sbjct: 173 HTTTSSAGILGIGLPDTETT---AVGQYGHYKYDNFPMVLKNKGIISHQGYSIYLDSSSS 229

Query: 312 THGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLH-XXXXXXXXXXXXXXX 370
           T+G  L G VD SKYTGTL  +PLVN   +     P  F VTL                 
Sbjct: 230 TYGEFLLGGVDTSKYTGTLYKLPLVNWYNT-YFSSPGDFHVTLQGLGLITNSGSAVTLTE 288

Query: 371 XPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFH 430
                +LD+G+T T +P  L +A+   L   Y    G Y + C   +++ +LVF+FGG +
Sbjct: 289 TKMAVILDTGSTVTGIPATLYNALLSSLGGYYSSTHGAYVFTCP--TETSKLVFNFGGIN 346

Query: 431 IKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQ 490
            K  + +F + T  D     +VC+L +   +    ILGD+FL   Y  +DLEN EI +A 
Sbjct: 347 YKLPMSSF-INTLGD-----NVCSLKVSSRSDSNFILGDDFLRNVYAAFDLENKEIGLAM 400

Query: 491 ANLDGGSEDIEE-----IVSTVPSAVKAPGYSSTWTSAIPISTGGNIF 533
           A+ D  S +  E     + S +P AV+AP YS+TW +   + TGG++F
Sbjct: 401 ADFDSSSNNKREDTVIAMESGIPDAVQAPEYSATWVTYEAVVTGGSMF 448

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 53/99 (53%), Gaps = 10/99 (10%)

Query: 19  TAISAEAKYSQDESKFVKLSFDKLRGDLVE----NARAGQIPRVKRVKRDDGTASFEIDN 74
           T +SAE     D+   V + F K   D +E    N    +   VKR   D       + N
Sbjct: 15  TNVSAELIQFYDKKAAV-IPFRKYYADSLEELDYNTSTSETKLVKRDGED-----IVLTN 68

Query: 75  QDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYC 113
           ++TFYS  I VG+PAQ + +++DTGSSD+WV+G +N  C
Sbjct: 69  RNTFYSAEIEVGTPAQTMNVIVDTGSSDLWVIGHDNLTC 107

>YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspartyl
           protease secreted into the periplasmic space of mating
           type a cells, helps cells find mating partners, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest
          Length = 587

 Score =  192 bits (487), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 133/439 (30%), Positives = 205/439 (46%), Gaps = 73/439 (16%)

Query: 64  DDGTASFEI---DNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKS 120
           +DGT   E      ++ +Y+ T+ +G+P+Q +T+L DTGS+D WVM S+NP+C  +S  S
Sbjct: 27  NDGTGHLEFLLQHEEEMYYATTLDIGTPSQSLTVLFDTGSADFWVMDSSNPFCLPNSNTS 86

Query: 121 KHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTD 180
                                    SY  AT    Y+G                      
Sbjct: 87  -------------------------SYSNAT----YNG---------------------- 95

Query: 181 VPTATSMDSYQATISCSEYGTFATDSSSSFK--SNGTQFLIQYGDLSYALGVWGRDDVTL 238
                  +  + +I C    T+    SS+++   NG +F I Y D ++A G WG + V++
Sbjct: 96  -------EEVKPSIDCRSMSTYNEHRSSTYQYLENG-RFYITYADGTFADGSWGTETVSI 147

Query: 239 QDVKVSDISLAVANISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKI 297
             + + +I   VA  + +   GVLGIG P  E       +P++ Y   NFP +L  +  I
Sbjct: 148 NGIDIPNIQFGVAKYATTPVSGVLGIGFPRRESVKGYEGAPNEYY--PNFPQILKSEKII 205

Query: 298 RKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKS-AQVPKPIQFDVTLHX 356
              AYSLF+N  ++  GS++FGA+D SK++G L T P+VN   +    P  +   +    
Sbjct: 206 DVVAYSLFLNSPDSGTGSIVFGAIDESKFSGDLFTFPMVNEYPTIVDAPATLAMTIQGLG 265

Query: 357 XXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEI 416
                           +P LLDSGT+  + P  +   +A  +NA Y +E+G Y   C   
Sbjct: 266 AQNKSSCEHETFTTTKYPVLLDSGTSLLNAPKVIADKMASFVNASYSEEEGIYILDCPVS 325

Query: 417 SDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAY 476
               E  FDFG   I   L +  L+     + E   C  A+ P N   ++LGD FL++AY
Sbjct: 326 VGDVEYNFDFGDLQISVPLSSLILS----PETEGSYCGFAVQPTNDS-MVLGDVFLSSAY 380

Query: 477 VVYDLENLEISMAQANLDG 495
           VV+DL+N +IS+AQAN + 
Sbjct: 381 VVFDLDNYKISLAQANWNA 399

>SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 578

 Score =  183 bits (465), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 139/444 (31%), Positives = 214/444 (48%), Gaps = 75/444 (16%)

Query: 85  VGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDTNGKDFYSDL 144
           VG+P+Q +  L+DT SSDIW++ SN+ +CE  +G             + ++N        
Sbjct: 84  VGTPSQAIRFLLDTDSSDIWLLNSNSTFCESENGT---------VNIDSNSNST------ 128

Query: 145 LSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSEYGTFAT 204
                A  TA  S +Y     +V      ++P+D                          
Sbjct: 129 ----LANETASRSDAYQCKLVNV------FYPED-------------------------- 152

Query: 205 DSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIG 264
             SSSF  N   F +QY D SYA G W +D  +       ++++A+ + +N T G LG+G
Sbjct: 153 --SSSFVLNDLDFHVQYDDYSYANGTWSQDTFSFGYPSFYNVNIALVSETNLTVGSLGLG 210

Query: 265 LPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHS 324
           L   + TN       D + Y +    L  QG I K AYS++ ++LN T G + FG + H 
Sbjct: 211 LRANQATN----QGDDPFVYNSLLYRLKTQGWIEKIAYSVYTSELNGTGGGIFFGGLYHD 266

Query: 325 KYTGT-LQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTF 383
            Y G  L T+PLVN     ++ +P +F +TL                  +PALL +G+ F
Sbjct: 267 LYKGNVLYTLPLVN--VDPELDEPARFHITLQNLTTSINGTNFSVLSEKYPALLSTGSMF 324

Query: 384 THLPGYLVSAIAKKLNAEYG-DEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALAT 442
           T+LP  L  +   +++ E G      Y   CD    +   ++DFGGF I++ L  +   T
Sbjct: 325 TYLPEELFDSFVDEMDLEKGAKHKDLYVIPCDT---NATFIYDFGGFEIETPLSGY---T 378

Query: 443 YDDDDNET--DVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQAN----LDGG 496
           +  + N T  D+CA+ + P+N+  + LG+ F  A YV+++LE+LEISMA A+    LD  
Sbjct: 379 FKVESNRTADDMCAVMVKPHNKSYLTLGNGFFAATYVLFNLEDLEISMAPASGIEYLDAF 438

Query: 497 SEDIEEIVSTVPSAVKAPGYSSTW 520
             D E I S++PSA +A  YS+TW
Sbjct: 439 --DYEYIESSIPSASRAASYSNTW 460

>Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)
          Length = 304

 Score =  169 bits (427), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 131/241 (54%), Gaps = 11/241 (4%)

Query: 291 LVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQF 350
           L   GKI K AYSLF+N+  A  GS+LFGAVD SKY+G L T+P++ +  +     P  F
Sbjct: 3   LKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQLYTLPMLQAYDTLDSVSPGMF 62

Query: 351 DVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYR 410
                                 FP L DSGTT++ LP  +  AI K  + +Y   D  Y 
Sbjct: 63  VTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTEVAHAIGKSFDGKYSSGDQGYT 122

Query: 411 YQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDN 470
           + C ++ D+  L  DFGGF+I + + NF   T D        C L +   + G  +LGD 
Sbjct: 123 FDCSKVKDT-LLSIDFGGFNISANISNFVTRTKDH-------CLLNIEAADSG-FVLGDA 173

Query: 471 FLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTW--TSAIPIST 528
           FL  AYVV+DLE+ E+S+AQA+ D   E+IE I   VP A++APGYSSTW  T   PI T
Sbjct: 174 FLVDAYVVFDLESHEVSIAQASFDDKKEEIEVISDRVPGAIRAPGYSSTWVYTPGSPIGT 233

Query: 529 G 529
           G
Sbjct: 234 G 234

>ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]
           {ON} weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 521

 Score =  166 bits (420), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 120/353 (33%), Positives = 169/353 (47%), Gaps = 22/353 (6%)

Query: 193 TISCSEYGTFATDSSSSFKS-NGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVA 251
           TI C        +SSS F+  N  +F I Y D S+  G W  D+V+     +S +   VA
Sbjct: 103 TIDCQGLTALDVNSSSQFRDLNVGRFYINYTDGSFDDGYWATDEVSAAGAHISGLQFGVA 162

Query: 252 NISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLN 310
             ++    G+LG+G P  E       +P+  Y   NFP ML   G I   AYS+++ND N
Sbjct: 163 QYASEEIPGILGLGFPRRESVRGYPGAPNKFY--DNFPQMLKKDGIIDVVAYSMYLNDPN 220

Query: 311 ATHG-SVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXX 369
            + G SVLFG VD SKY+G L T P+ N   +  V KP    VTL               
Sbjct: 221 GSGGGSVLFGGVDPSKYSGDLYTFPMANQYPNI-VSKPATLAVTLQGFGAQKKSEGRQET 279

Query: 370 --XXPFPALLDSGTTFTHLPGYLVSAIAKKLN--AEYGDEDGFYRYQCDEISDSDELVFD 425
                +  LLDSGT+    P  +VS +A  +N  A + ++DG Y   C    D  E VFD
Sbjct: 280 FDTNNYAVLLDSGTSLMGAPEEVVSKMAHFINKNARFSEDDGIYVMDCPPKDDDTEFVFD 339

Query: 426 FGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLE 485
           FG   I   +    L    +       C L ++P + G   LGD FL+ AY+V+DL+N +
Sbjct: 340 FGDLQIAVPVSTLILPPSGES-----YCGLGVLPKD-GTWTLGDVFLSYAYLVFDLDNYK 393

Query: 486 ISMAQANLDGGSEDIEEIV----STVPSAVKAPGYSSTWTSAIPISTGGNIFT 534
           +SMA+A   G  +   +I      T+P A  A   +  W+S+ P +  G+IFT
Sbjct: 394 VSMAKAKFSGDGDQSPQIKIQTDGTIPGAKSAS--AKPWSSSEPSTVSGSIFT 444

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 2/49 (4%)

Query: 76  DTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYC--EGSSGKSKH 122
           D FYS T+ +GSPAQ + L++D+GS+D WVM S NP+C     SG SK+
Sbjct: 44  DEFYSTTLEIGSPAQKLDLVVDSGSADTWVMASTNPFCSSNAKSGASKN 92

>TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.182
           YIL015W
          Length = 552

 Score =  166 bits (420), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 115/349 (32%), Positives = 175/349 (50%), Gaps = 20/349 (5%)

Query: 194 ISCSEYGTFATDSSSSFKS-NGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVAN 252
           I C   GTF  + SSSF+  +  +F I+Y D S+A G W ++ + L  + +S +   VA+
Sbjct: 122 IDCKALGTFDYNGSSSFERLDIGRFYIKYSDESFADGFWAKEKLRLNGIDISTLQFGVAD 181

Query: 253 ISNSTFG-VLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNA 311
            +    G VLGIG P  E      ++P++ Y   NFP +L ++G I  +AYS+F+N++++
Sbjct: 182 YATVPVGGVLGIGFPRRESVKGYDDAPNEFY--PNFPQVLKNEGVIGVAAYSMFLNEVSS 239

Query: 312 THGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHX--XXXXXXXXXXXXX 369
             GS+LFGAVD +KYTG+L T P+VN   +  V KP    +TL                 
Sbjct: 240 DAGSILFGAVDPTKYTGSLYTFPMVNEYPNV-VDKPATLAMTLQALGAKSDSSCKYKTFT 298

Query: 370 XXPFPALLDSGTTFTHLPGYLVSAIAKKL-NAEYGDEDGFYRYQCDEISDSDELVFDFGG 428
                 LLDSGTT    P  +   +A       Y + +G + + C    D  E +FDFG 
Sbjct: 299 TTKQAVLLDSGTTLMTAPPEIAEEMAFFCWGPTYNESEGIFYFDCPSDDDDTEFIFDFGD 358

Query: 429 FHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISM 488
             I   L +  +++  D       C   L P +   + LG  FL++AYVVYDL+N +IS+
Sbjct: 359 LKITLPLASLVISSSGDGH-----CGFGLTPASYS-MTLGAIFLSSAYVVYDLDNYQISI 412

Query: 489 AQANLDGGSEDIEEIV----STVPSAVKAPGYSSTWTSAIPISTGGNIF 533
           AQA  DG       +      T+  A KA   ++ WT+  P+    ++F
Sbjct: 413 AQAKWDGNPSQKSRVRIPKDGTIYGATKAT--ATPWTTDEPVKVDYDMF 459

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 39/63 (61%), Gaps = 6/63 (9%)

Query: 59  KRVKRDDGTASFEIDNQD---TFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEG 115
           ++++R   T   EID Q     +YS  + +G+  Q++ +L D+GSSD+WV  S+NPYC  
Sbjct: 48  RKLQRRKST---EIDLQHESGIYYSAILEIGTSHQELPVLFDSGSSDMWVSSSSNPYCLE 104

Query: 116 SSG 118
           S G
Sbjct: 105 SEG 107

>CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa]
           {ON} similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015w BAR1
          Length = 541

 Score =  161 bits (408), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 108/317 (34%), Positives = 159/317 (50%), Gaps = 15/317 (4%)

Query: 191 QATISCSEYGTFATDSSSSFKS-NGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLA 249
           +  I CS    +  D S +F       F I Y D +Y  G+W  D +TL +  + D+   
Sbjct: 97  KCLIDCSGLVFYDMDKSQTFDYLKNVTFKIGYADTTYTSGIWIVDIITLPEGHLKDLQFG 156

Query: 250 VANISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVND 308
           +A  +N+TF GVLGIG P +E  N    +P   Y   NFP  L + G    +AYS+  ND
Sbjct: 157 MAFATNATFSGVLGIGFPAMESVNGYEFAPGKFY--PNFPLALKNAGFTNIAAYSIEYND 214

Query: 309 LNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXX 368
             +  GS+LFG++D S++ G L T P++N        +P    +TL              
Sbjct: 215 -ESKKGSILFGSIDTSRFIGPLYTFPMINEFPGI-ADEPSTLSLTLDGIGIDGSCEQWVI 272

Query: 369 XXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQC--DEISDSDELVFDF 426
                PALLD+G+T   LP  +  +IA  LNA + D+ G +   C  D+   + +L F F
Sbjct: 273 SNTKLPALLDTGSTLIELPHPITQSIASYLNATWSDDHGLFVLACPSDDFLTTTDLAFTF 332

Query: 427 GGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEI 486
           G  H+K  L +F L     D+    +C L  I  ++G +ILGD+FLT  Y V+DL+N  I
Sbjct: 333 GELHMKIPLRSFILLP---DEESNGLCGLG-ITSSKGRVILGDSFLTHVYTVFDLDNYMI 388

Query: 487 S---MAQANLDGGSEDI 500
           S   MA+++L G   +I
Sbjct: 389 SLAPMAKSSLPGKVIEI 405

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 9/68 (13%)

Query: 75  QDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYC-EGSSGKSKHVLLHEDSGFED 133
            + +Y   +  G+P Q + L++DTGSSD+WV    NP C    SGK    L+        
Sbjct: 49  NNLYYESVLEFGTPPQSIPLVLDTGSSDLWVTLIGNPLCYNKGSGKPPKCLI-------- 100

Query: 134 DTNGKDFY 141
           D +G  FY
Sbjct: 101 DCSGLVFY 108

>KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.182
           YIL015W
          Length = 563

 Score =  161 bits (407), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 106/346 (30%), Positives = 175/346 (50%), Gaps = 20/346 (5%)

Query: 194 ISCSEYGTFATDSSSSFKS-NGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVAN 252
           + CS+  T+  + S+SF+  N  +F I YGD ++A G+WG +      VK+ ++   +A+
Sbjct: 115 VDCSQIKTYNANRSTSFQELNNGRFYIIYGDKTFADGIWGTETFEFGGVKIPNVQFGLAD 174

Query: 253 ISNSTFG-VLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNA 311
            + +  G VLGIG    E       +P     Y NFP +L ++G I   AYSL +    +
Sbjct: 175 YATTPIGGVLGIGFQRRESVKGYTNAPE--VFYPNFPQVLKNEGIIDTVAYSLSLGQ--S 230

Query: 312 THGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHX--XXXXXXXXXXXXX 369
           +H  ++FGA+D + Y G + T P++N   +A V KP    +T+                 
Sbjct: 231 SH--IMFGAIDRNSYIGDMVTFPMINMFPNA-VSKPATLSITIQGLGAQNKQECKFQTFS 287

Query: 370 XXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGF 429
              +PALLDSG+T    P  +   +A  + A++ + DG Y  +C   + + + +FDFG  
Sbjct: 288 TTKYPALLDSGSTLISAPVEIADKMAAFIGAQWSESDGIYTLECPNDTTNIDYIFDFGDM 347

Query: 430 HIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMA 489
                L N  L +       ++VC   L   +  EI+LGD FL +  VV+DL++ +IS+A
Sbjct: 348 KFTLPLSNLILPS----QGGSNVCGFGL-QRSDNEIVLGDVFLCSTLVVFDLDHYQISLA 402

Query: 490 QANLDGGSEDIEEIVS--TVPSAVKAPGYSSTWTSAIPISTGGNIF 533
           ++N    +EDI  I S   +P A+ A   +  WT+  PI+   ++F
Sbjct: 403 KSNQKSSAEDIVNIPSDGKIPGAIIAK--AEAWTTYEPITATTDMF 446

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 31/42 (73%)

Query: 76  DTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSS 117
           ++FY+ T+ +G P Q++T++ D+GS+D WVM   NP+C  SS
Sbjct: 54  ESFYATTLKIGDPPQEITVIFDSGSADTWVMSRYNPFCLSSS 95

>AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL015W (BAR1)
          Length = 452

 Score =  150 bits (378), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 108/330 (32%), Positives = 155/330 (46%), Gaps = 20/330 (6%)

Query: 193 TISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVAN 252
           +I C    TF  +SS++ +     F I Y D ++  G W  D + +    VS +   V  
Sbjct: 98  SIDCRGIKTFCNESSTTLRILPNPFYIDYAD-TFVDGSWATDRLVIGGHDVSGMKFGVGR 156

Query: 253 ISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNA 311
            SN+   GVLG+G   LE     A +P+   TY N P  L   G ++K AYS+ +   + 
Sbjct: 157 TSNTELSGVLGVGHANLESVRGYAGAPN--ATYPNLPRQLKLDGSVQKLAYSVSLQKTSE 214

Query: 312 THGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHX--XXXXXXXXXXXXX 369
             G +LFGA+D SKY G L T P++N      +  P  F + L                 
Sbjct: 215 RDGEILFGAIDTSKYVGKLHTFPILN--IDPHLNSPSNFYIALQGIDIQGGRSSTGRPLI 272

Query: 370 XXPFPALLDSGTTFTHLPGYLVSAIAK----KLNAEYGDEDGFYRYQCDEISDSDELVFD 425
              F ALLD+GT      G +VS++A+     LNA Y  E   +  QC    D+ +  F+
Sbjct: 273 NSSFHALLDTGTG-----GMVVSSLAEDIGAALNATYDTEQCVFVIQCPTEDDTRQFNFN 327

Query: 426 FGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLE 485
           FG   I   + NF +        ET  CALA++P       LG  FL   Y V++LE+ E
Sbjct: 328 FGELQIAVPISNFVVPA---SGLETGQCALAIMPGTSETFALGIPFLKEVYTVFNLEDNE 384

Query: 486 ISMAQANLDGGSEDIEEIVSTVPSAVKAPG 515
           ISMA+AN +    DI  I + VP+A++  G
Sbjct: 385 ISMARANTNPQEPDIRPIPAGVPAAIRDSG 414

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 36/59 (61%)

Query: 65  DGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHV 123
           DG  +  + + D  Y + I VG+P Q +  ++DTGS+D+W+   NNP+C G+  + + V
Sbjct: 32  DGFLAMPLHHNDDHYDIEIEVGTPPQKLHAVLDTGSADLWLQAENNPFCVGAKDEKQEV 90

>Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C
           (REAL)
          Length = 227

 Score =  131 bits (329), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 86/234 (36%), Positives = 123/234 (52%), Gaps = 15/234 (6%)

Query: 265 LPGLEVTNALAE--SP-SDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAV 321
           LP +E T+ +    SP +  Y Y NFP  L  QGKI K AYSLF+N+ NA  GS+LFGAV
Sbjct: 1   LPSVEETDEIENVMSPDTTPYVYDNFPMALKRQGKIEKIAYSLFLNEPNARFGSILFGAV 60

Query: 322 DHSKYTGTLQTIPLVNSIK----SAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALL 377
           D SKY+G L T+P++ +      SA +    Q    L                  FP L 
Sbjct: 61  DKSKYSGQLYTLPMLKAYNTLDSSAGMEITAQSVAILSVAIIDSKSGNKTVSEVQFPVLF 120

Query: 378 DSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDN 437
           DSGT+ + LP  +  AI +  + +Y  ++  Y + C +++++  L  DFGGF+I + + N
Sbjct: 121 DSGTSTSALPTEIADAIGRSFDGKYSSDNQGYIFDCSKVNNT-LLSIDFGGFNISANISN 179

Query: 438 FALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQA 491
                  D       C L +   + G  +LGD FL   YVV+DLE+ E+S+AQA
Sbjct: 180 SVTPITKDH------CLLNIEADDSG-YVLGDAFLIDTYVVFDLESHEVSVAQA 226

>Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON}
           (50979..51989) [1011 nt, 337 aa]
          Length = 336

 Score =  111 bits (278), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 112/223 (50%), Gaps = 5/223 (2%)

Query: 193 TISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVAN 252
           +I+C+++GT+  D SS+      +  IQYGD S+A G W  D +T+    +  +   ++N
Sbjct: 111 SINCTKFGTYTRDKSSTSNKLDHRLFIQYGDGSFADGEWITDTLTIGPYDLQSVQFGISN 170

Query: 253 ISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNA 311
            +++   GVLG+G    E  +    SP+  Y   N PA L DQ     +A+SLF+N+ N 
Sbjct: 171 NASTIISGVLGLGFLRTESIDGYDGSPNKLY--YNLPAYLKDQEITNTNAFSLFLNNSND 228

Query: 312 THGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXX-XXXXXXXXXXXX 370
             G+VLFG +D+SK++G L T PLVN I    + +P  F +TL                 
Sbjct: 229 ASGTVLFGGIDYSKFSGDLVTFPLVN-IYPKLINEPCTFTITLQQLYGKINGGKSIGLIK 287

Query: 371 XPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQC 413
              PALLDSG++   +P  +   IA  +N+        +   C
Sbjct: 288 EKVPALLDSGSSLISMPIEITDEIALMVNSTLDTMTSLHNINC 330

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query: 48  ENARAGQIPRVKRVKRDDGTASFEIDNQ---DTFYSVTIGVGSPAQDVTLLIDTGSSDIW 104
           EN        V   +  D     E+D Q     FYS  +  G+P Q+VT+L+DTGSSD+W
Sbjct: 31  ENNFRSSNNNVHYSRSYDNHNYLELDIQYHYGQFYSTLLSFGNPVQNVTVLVDTGSSDLW 90

Query: 105 VMGSNNPYC 113
           V   NN YC
Sbjct: 91  VSSPNNIYC 99

>TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa]
           {ON} Anc_7.182 YIL015W
          Length = 395

 Score =  101 bits (251), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 107/437 (24%), Positives = 174/437 (39%), Gaps = 85/437 (19%)

Query: 76  DTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDT 135
           D++Y   I +G+P Q++ +L+DTGSSD+WV   NNP C   +           +GF    
Sbjct: 28  DSYYETNILIGNPPQNIGVLVDTGSSDLWVNSPNNPNCYNGNIDC--------TGF---- 75

Query: 136 NGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATIS 195
                     ++   + +  +S  Y  +   +  +  SY                     
Sbjct: 76  ----------TFFNKSNSKTFSNIYKNSIFQIGYQDASY--------------------- 104

Query: 196 CSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISN 255
              +G +  DS S   S        Y D +   G++           + +   A+A  SN
Sbjct: 105 --TFGKWGVDSISINSS--------YSDSNEDTGLYAN---------IPNAQFAIATNSN 145

Query: 256 STF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHG 314
                VLG+G P  E  N    + +    Y N P ++   G       ++++   N T+ 
Sbjct: 146 VPVQAVLGLGFPRREAVNGYKLATNKF--YPNLPQLIKQHGYSDNVTIAMYLGS-NETYN 202

Query: 315 SVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXX----XXXX 370
           S++FGA D ++Y G L   P+VN   +    KP  F +TL                    
Sbjct: 203 SIMFGAYDKTRYIGDLHNFPMVNQYPNV-TDKPATFAITLDSMYISMDNNQSDNIYISND 261

Query: 371 XPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRY--QCDEISDSDELV-FDFG 427
             +  +LDSGT+    P + VS IA  LNA + +    Y    + D     D ++ F F 
Sbjct: 262 EKYSVVLDSGTSLLSAPDHYVSKIAGLLNATFDNTTHMYLLPSETDLTLYKDMIINFKFM 321

Query: 428 GFHIKSKLDNFALATYDDDDNETDVCALALIP---YNRGEIILGDNFLTAAYVVYDLENL 484
            F++   +  F L  YDD          A++P    N G  +LGD FL   Y +++L+N 
Sbjct: 322 DFNVPINMLEFILP-YDDS------YVFAILPTKNVNTG-FVLGDIFLPHVYTIFNLDNY 373

Query: 485 EISMAQANLDGGSEDIE 501
            IS+  +N +  S + E
Sbjct: 374 TISLGLSNQNITSNERE 390

>Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W
           (REAL)
          Length = 333

 Score = 94.4 bits (233), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 93/165 (56%), Gaps = 11/165 (6%)

Query: 373 FPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIK 432
           +P LLDSGT+  + P  +   +A  +NA Y  ++G Y   C E +   E  FDFG   I 
Sbjct: 24  YPVLLDSGTSLLNAPKSIADKMASFVNASYSADEGIYILDCPESTYDVEYTFDFGDLQIN 83

Query: 433 SKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQAN 492
             L +  L+     + E   C  A+ P N   ++LGD FL++AYVV+DL+N +IS+AQAN
Sbjct: 84  VPLTSLILS----PETEGGYCGFAVQPTN-DSMVLGDVFLSSAYVVFDLDNYKISLAQAN 138

Query: 493 LDGGSEDIEEIVSTVPSAVKAP-GYSST---WTSAIPISTGGNIF 533
            +  S D +++V+ +P+    P G S+T   W++ +P +   +I+
Sbjct: 139 WN-ASNDSKQLVN-IPTDGSIPSGKSATAQPWSTNVPFTVTSDIY 181

>Suva_9.186 Chr9
           (310161..310220,310267..310332,310362..310451,
           310470..310622,310626..310658,310662..310688,
           310692..310742,310746..310787,310807..310833,
           310840..311922) [1632 bp, 543 aa] {OFF} YIL015W (PSEUDO)
          Length = 543

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 93/165 (56%), Gaps = 11/165 (6%)

Query: 373 FPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIK 432
           +P LLDSGT+  + P  +   +A  +NA Y  ++G Y   C E +   E  FDFG   I 
Sbjct: 234 YPVLLDSGTSLLNAPKSIADKMASFVNASYSADEGIYILDCPESTYDVEYTFDFGDLQIN 293

Query: 433 SKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQAN 492
             L +  L+     + E   C  A+ P N   ++LGD FL++AYVV+DL+N +IS+AQAN
Sbjct: 294 VPLTSLILS----PETEGGYCGFAVQPTN-DSMVLGDVFLSSAYVVFDLDNYKISLAQAN 348

Query: 493 LDGGSEDIEEIVSTVPSAVKAP-GYSST---WTSAIPISTGGNIF 533
            +  S D +++V+ +P+    P G S+T   W++ +P +   +I+
Sbjct: 349 WN-ASNDSKQLVN-IPTDGSIPSGKSATAQPWSTNVPFTVTSDIY 391

>KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 417

 Score = 85.5 bits (210), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 86/319 (26%), Positives = 139/319 (43%), Gaps = 56/319 (17%)

Query: 192 ATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVA 251
            +++C  +  ++ D+SSS+K+NGT F IQYG  S   G   +D +++ D+ +     A A
Sbjct: 135 GSLACFLHSKYSHDASSSYKANGTNFAIQYGSGSLE-GYISQDTLSIGDLTIPKQDFAEA 193

Query: 252 N------ISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSL 304
                   +   F G+LG+G   + V   +         YK      ++ G + +  ++ 
Sbjct: 194 TSEPGLAFAFGKFDGILGLGYDTIAVDKVVPP------VYK-----AINDGLLDEPRFAF 242

Query: 305 FVN---DLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFD-VTLHXXXXX 360
           ++N   D   + G V FG +D SKY G +  +P+       +    ++FD + L      
Sbjct: 243 YLNNADDSEESTGEVTFGGIDSSKYKGNITWLPV-----RRKAYWEVKFDGIGLGDEYAE 297

Query: 361 XXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGF---YRYQCDEIS 417
                         A +D+GT+   LP    S +A+ LNAE G + G+   Y   C+   
Sbjct: 298 LEGTG---------AAIDTGTSLIALP----SGLAEVLNAEIGAKKGWSGQYTVDCESRD 344

Query: 418 DSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-----IILGDNFL 472
              +L F F G        NF ++ YD     +  C  A  P +  E      I+GD FL
Sbjct: 345 QLPDLTFTFNG-------KNFTISAYDYTLEVSGSCISAFTPMDFPEPVGPLAIIGDAFL 397

Query: 473 TAAYVVYDLENLEISMAQA 491
              Y VYDL N  + +AQA
Sbjct: 398 RKFYSVYDLGNNAVGLAQA 416

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%)

Query: 79  YSVTIGVGSPAQDVTLLIDTGSSDIWV 105
           Y   I +G+P Q   +++DTGSS++WV
Sbjct: 103 YFTEITLGTPPQSFKVILDTGSSNLWV 129

>Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C
           (PEP4) - vacuolar proteinase A [contig 68] FULL
          Length = 412

 Score = 82.4 bits (202), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 84/318 (26%), Positives = 138/318 (43%), Gaps = 56/318 (17%)

Query: 193 TISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVAN 252
           +++C  +  ++ D+SSS+K+NGT F IQYG  S   G   +D +++ D+ +     A A 
Sbjct: 131 SLACFLHSKYSHDASSSYKANGTSFAIQYGSGSLE-GYISQDTLSIGDLTIPKQDFAEAT 189

Query: 253 ------ISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLF 305
                  +   F G+LG+G   + V   +         YK      ++ G + +  ++ +
Sbjct: 190 SEPGLAFAFGKFDGILGLGYDTISVDKVVPP------VYK-----AINDGLLDEPRFAFY 238

Query: 306 VN---DLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFD-VTLHXXXXXX 361
           +N   D   + G V FG +D SKY G +  +P+       +    ++FD + L       
Sbjct: 239 LNNADDSEESTGEVTFGGIDSSKYKGDITWLPVRR-----KAYWEVKFDGIGLGDEYAEL 293

Query: 362 XXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGF---YRYQCDEISD 418
                        A +D+GT+   LP    S +A+ LN+E G + G+   Y   C+    
Sbjct: 294 QGTG---------AAIDTGTSLIALP----SGLAEVLNSEIGAKKGWTGQYTVDCESRDQ 340

Query: 419 SDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-----IILGDNFLT 473
             +L F F G        NF +  YD     +  C  A  P +  E      I+GD FL 
Sbjct: 341 LPDLTFTFNG-------KNFTITAYDYTLEVSGSCISAFTPMDFPEPVGPLAIIGDAFLR 393

Query: 474 AAYVVYDLENLEISMAQA 491
             Y +YDL N  + +AQA
Sbjct: 394 KFYSIYDLGNNAVGLAQA 411

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%)

Query: 79  YSVTIGVGSPAQDVTLLIDTGSSDIWV 105
           Y   I +G+P Q   +++DTGSS++WV
Sbjct: 98  YFTEISLGTPPQSFKVILDTGSSNLWV 124

>SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|P07267 Saccharomyces
           cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
           (proteinase A) required for the posttranslational
           precursor maturation of vacuolar proteinases synthesized
           as a zymogen self-activates
          Length = 404

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 87/326 (26%), Positives = 137/326 (42%), Gaps = 54/326 (16%)

Query: 181 VPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQD 240
           VP+A        +++C  +  +  DSSSS+K+NG+ F IQYG  S   G   +D +++ D
Sbjct: 117 VPSAEC-----GSLACFLHAKYDHDSSSSYKANGSSFAIQYGSGSLE-GYISQDTLSIGD 170

Query: 241 VKVSDISLAVAN------ISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVD 293
           + +     A A        +   F G+LG+    + V   +         Y      L+D
Sbjct: 171 LTIPKQDFAEATSEPGLAFAFGKFDGILGLAYDSISVDKVVPP------VYNAIHNGLLD 224

Query: 294 QGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVT 353
           + K    ++ L   D +   G   FG +D SKY G +  +P+       +    ++FD  
Sbjct: 225 EPKF---SFYLGNADKSTDGGEATFGGIDSSKYEGNITWLPVRR-----KAYWEVKFD-- 274

Query: 354 LHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGF---YR 410
                                A +D+GT+   LP    S +A+ LNAE G + G+   Y 
Sbjct: 275 ------GIGLGDEYAILDGHGAAIDTGTSLIALP----SGLAEILNAEIGAKKGWSGQYS 324

Query: 411 YQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-----I 465
            +CD      +L  +FGG+       NF +  YD     +  C  A  P +  E      
Sbjct: 325 VECDTRDSLPDLTLNFGGY-------NFTITPYDYTLEVSGSCISAFTPMDFPEPVGPLA 377

Query: 466 ILGDNFLTAAYVVYDLENLEISMAQA 491
           I+GD FL   Y VYDL N  + +A+A
Sbjct: 378 IIGDAFLRKHYSVYDLGNDAVGLAKA 403

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 63/150 (42%), Gaps = 23/150 (15%)

Query: 8   AILGLAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVEN--ARAGQIPRVKRVKRDD 65
           ++L LA L+ ++   AEAK  + +    KL  D+L G   E      GQ   +   ++  
Sbjct: 5   SLLSLATLLVASVDIAEAKVHKAKIHKQKLE-DQLEGATFEQHITSLGQ-KYLSAYQKAY 62

Query: 66  GTASFEIDNQ---------------DTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNN 110
             A F  ++Q               +  Y   I +G+P Q+  +++DTGSS++WV  +  
Sbjct: 63  PEAEFAKEHQFYAEAGHDVPLTNYLNAQYYTEISLGTPPQNFKVILDTGSSNLWVPSAE- 121

Query: 111 PYCEGSSGKSKHVLLHEDSGFEDDTNGKDF 140
             C GS     H     DS      NG  F
Sbjct: 122 --C-GSLACFLHAKYDHDSSSSYKANGSSF 148

>KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8.677
           YPL154C
          Length = 415

 Score = 80.1 bits (196), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 82/318 (25%), Positives = 137/318 (43%), Gaps = 54/318 (16%)

Query: 192 ATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVA 251
            +++C  +  +   +SSS+K+NGT F IQYG  S   G   +D +++ D+ +     A A
Sbjct: 133 GSLACFLHEKYDHSASSSYKANGTDFSIQYGSGSLE-GYISQDTLSIGDLTIPKQDFAEA 191

Query: 252 N------ISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSL 304
                   +   F G+LG+    + V   +         Y      L+D+ K     ++ 
Sbjct: 192 TSEPGLAFAFGKFDGILGLAYDTISVDKVVPP------FYNALEQDLLDEAK-----FAF 240

Query: 305 FVNDLNATH---GSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXX 361
           ++ D N      G  +FG VD SKYTG +  +P         V +   ++V L       
Sbjct: 241 YLGDTNKDAEDGGEAIFGGVDKSKYTGDVTWLP---------VRRKAYWEVKLEGLGLGD 291

Query: 362 XXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGF---YRYQCDEISD 418
                        A +D+GT+   LP    S +A+ +N+E G + G+   Y  +C+    
Sbjct: 292 EYAELESHG----AAIDTGTSLITLP----SGLAEIINSEIGAKKGWTGQYTLECNTRDQ 343

Query: 419 SDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-----IILGDNFLT 473
             +L F+F G+       NF +  YD     +  C  A+ P +  E      I+GD FL 
Sbjct: 344 LPDLTFNFNGY-------NFTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLR 396

Query: 474 AAYVVYDLENLEISMAQA 491
             Y +YDLE+  + +A+A
Sbjct: 397 KYYSIYDLEHNAVGLAKA 414

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 39/89 (43%), Gaps = 21/89 (23%)

Query: 28  SQDESKFVKLSFDK----LRG---DLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYS 80
           +Q E  F ++SF K     +G   D  E A+  ++P    +                 Y 
Sbjct: 57  NQYEKAFPEVSFSKHHPFFKGSAQDSFEVAKGHEVPLSNYLNAQ--------------YY 102

Query: 81  VTIGVGSPAQDVTLLIDTGSSDIWVMGSN 109
             I +G+P Q   +++DTGSS++WV  S 
Sbjct: 103 TDITLGTPPQQFKVILDTGSSNLWVPSSE 131

>ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 418

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 86/316 (27%), Positives = 136/316 (43%), Gaps = 51/316 (16%)

Query: 192 ATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVA 251
           ++++C  +  +  DSSSS+K NGT+F I+YG  S   G   +D + L D+ ++    A A
Sbjct: 137 SSLACFLHSKYDHDSSSSYKPNGTEFAIRYGSGSLE-GYISQDTLNLGDLSITKQDFAEA 195

Query: 252 ------NISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSL 304
                   +   F G+LG+G   + V   +         Y  +   L+D+ K    A+ L
Sbjct: 196 TSEPGLQFAFGKFDGILGLGYDTISVDGVVPP------FYNAWKQGLLDEPKF---AFYL 246

Query: 305 FVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFD-VTLHXXXXXXXX 363
             +  +   G   FG VD SKY G +  +P+       +    ++FD + L         
Sbjct: 247 GRDGESQDGGVATFGGVDDSKYEGEITWLPI-----RRKAYWEVKFDGIGLGEEYAELEN 301

Query: 364 XXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDED---GFYRYQCDEISDSD 420
                      A +D+GT+   LP    S +A+ +NAE G +    G Y  +C+  S   
Sbjct: 302 HG---------AAIDTGTSLIALP----SGLAEIINAEIGAKKSWTGQYTVECEARSSLP 348

Query: 421 ELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-----IILGDNFLTAA 475
            + F  GG        NF L  YD     +  C  A+ P +  E      I+GD+FL   
Sbjct: 349 NMTFTLGG-------HNFELTAYDYILEVSGQCISAIFPMDFPEPVGPLAIIGDSFLRKY 401

Query: 476 YVVYDLENLEISMAQA 491
           Y +YDL N  + +A A
Sbjct: 402 YSIYDLGNNAVGLADA 417

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 20/27 (74%)

Query: 79  YSVTIGVGSPAQDVTLLIDTGSSDIWV 105
           Y   + +G+P Q+  +++DTGSS++WV
Sbjct: 105 YYTEVSLGTPPQNFKVILDTGSSNLWV 131

>TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {ON}
           Anc_8.677 YPL154C
          Length = 413

 Score = 79.0 bits (193), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 142/318 (44%), Gaps = 54/318 (16%)

Query: 192 ATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVA 251
            +++C  +  +  D SS++K+NG+ F IQYG  S   G   +D + + D+K++    A A
Sbjct: 131 GSLACYLHSKYNHDESSTYKANGSAFAIQYGSGSLE-GYISQDVMEIGDLKITKQDFAEA 189

Query: 252 ------NISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSL 304
                 + +   F G+LG+    + V N +     +A          ++QG + +  ++ 
Sbjct: 190 TSEPGISFAFGKFDGILGLAYDTIAV-NRVVPPVYNA----------INQGLLDEPKFAF 238

Query: 305 FVNDLNATH---GSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXX 361
           ++ D + +    G  +FG +D +K+ G +  +P         V +   ++V L       
Sbjct: 239 YLGDASKSKDNGGEAVFGGIDETKFEGDITWLP---------VRRKAYWEVKLEGLGLGE 289

Query: 362 XXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGF---YRYQCDEISD 418
                        A +D+GT+   LP    S +A+ +N+E G + G+   Y  +CD+ + 
Sbjct: 290 EYTELENHG----AAIDTGTSLITLP----SGLAEIINSEIGAKKGWTGQYTIECDKRAS 341

Query: 419 SDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-----IILGDNFLT 473
             ++ F F G+       NF ++ YD     +  C  A+ P +  E      I+GD FL 
Sbjct: 342 LPDMTFTFDGY-------NFTISPYDYTLEVSGSCISAITPMDFPEPVGPMAIIGDAFLR 394

Query: 474 AAYVVYDLENLEISMAQA 491
             Y VYDL N  + +A A
Sbjct: 395 KYYSVYDLGNDAVGLAPA 412

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%)

Query: 79  YSVTIGVGSPAQDVTLLIDTGSSDIWV 105
           Y   I +G+P Q   +++DTGSS++WV
Sbjct: 99  YFADIKIGTPPQSFKVVLDTGSSNLWV 125

>NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}
          Length = 408

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 79/318 (24%), Positives = 132/318 (41%), Gaps = 54/318 (16%)

Query: 192 ATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVA 251
            +++C  +  +  D SSS+K NGT F I+YG  S   G   +D + + D+ +     A A
Sbjct: 126 GSLACYLHSKYDHDKSSSYKPNGTDFAIRYGTGSLE-GYISQDTLNIGDLNIPKQDFAEA 184

Query: 252 NISNS-TF------GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSL 304
                 TF      G+LG+    + V   +         Y      L+D+ K     ++ 
Sbjct: 185 TSEPGLTFAFGKFDGILGLAYDSISVNKVVPP------FYNAIEQELLDEKK-----FAF 233

Query: 305 FVNDLNATH---GSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXX 361
           ++ D N      G +  G +D +K+ G +  +P         V +   ++V         
Sbjct: 234 YLGDANKKSEDGGEITIGGIDKTKFKGDIDWLP---------VRRKAYWEVKFEGIGLGD 284

Query: 362 XXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGF---YRYQCDEISD 418
                        A +D+GT+   LP    S +A+ +N E G + G+   Y  +CD   +
Sbjct: 285 QFAELENHG----AAIDTGTSLIALP----SGLAEIINTEIGAKKGWTGQYTVECDARPN 336

Query: 419 SDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-----IILGDNFLT 473
             +L F+F G        NF +  YD     +  C  A++P +  E      I+GD FL 
Sbjct: 337 LPDLTFNFNG-------KNFTIGPYDYTLEVSGSCISAIMPMDFPEPVGPMAIIGDAFLR 389

Query: 474 AAYVVYDLENLEISMAQA 491
             Y +YDLEN  + +A+A
Sbjct: 390 KYYSIYDLENNAVGLAEA 407

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 6/63 (9%)

Query: 79  YSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCE-GSSGKSKHVLLHEDSGFEDDTNG 137
           Y   I +G+P Q   +++DTGSS++WV     P  E GS     H     D       NG
Sbjct: 94  YFADITLGTPPQSFKVILDTGSSNLWV-----PSVECGSLACYLHSKYDHDKSSSYKPNG 148

Query: 138 KDF 140
            DF
Sbjct: 149 TDF 151

>Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)
          Length = 123

 Score = 72.4 bits (176), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 68/112 (60%), Gaps = 4/112 (3%)

Query: 179 TDVPTAT-SMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVT 237
           T++P+ T S +SY     C+ +GTF+  +SS+FK N TQF   YGD +Y  G +G D V+
Sbjct: 14  TELPSFTISSESYSTL--CAYWGTFSARNSSTFKCNDTQFDETYGDGTYYRGTYGTDVVS 71

Query: 238 LQDVKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAES-PSDAYTYKNFP 288
           L ++ +   S  VAN + +  G+LGI LP  E T++L  +  +  + Y+NFP
Sbjct: 72  LGNITLESFSFGVANNTENQGGILGISLPAGENTHSLGGAYNTTPFEYENFP 123

>NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {ON}
           Anc_8.677
          Length = 406

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/317 (24%), Positives = 136/317 (42%), Gaps = 54/317 (17%)

Query: 193 TISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVAN 252
           +++C  +  +  D+SSS+K+NGT+F IQYG  S   G   +D + + D+ +     A A 
Sbjct: 125 SLACFLHSKYDHDASSSYKANGTKFAIQYGSGSLE-GYISQDTLNIGDLTIPKQDFAEAT 183

Query: 253 ISNS-TF------GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLF 305
                TF      G+LG+    + V   +         + N     ++QG + +  ++ +
Sbjct: 184 SEPGLTFAFGKFDGILGLAYDTISVDKVVP-------PFYN----AIEQGLLDEKKFAFY 232

Query: 306 VNDLNATH---GSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXX 362
           + D        G +  G +D SK+ G ++ +P         V +   ++V          
Sbjct: 233 LGDTKKDEKNGGEITIGGIDESKFKGDIEWLP---------VRRKAYWEVKFEGIALGDQ 283

Query: 363 XXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGF---YRYQCDEISDS 419
                       A +D+GT+   LP    S +A+ +N E G + G+   Y   CD     
Sbjct: 284 YAALENHG----AAIDTGTSLITLP----SGLAEIINTEIGAKKGWTGQYTLDCDTRDGL 335

Query: 420 DELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-----IILGDNFLTA 474
            +L F+F G        NF ++ +D     +  C  A++P +  E      I+GD FL  
Sbjct: 336 PDLTFNFNG-------KNFTISPFDYTLEVSGSCISAIMPMDFPEPMGPMAIVGDAFLRK 388

Query: 475 AYVVYDLENLEISMAQA 491
            Y +YDL+N  + +A+A
Sbjct: 389 YYSIYDLDNHAVGLAEA 405

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 79  YSVTIGVGSPAQDVTLLIDTGSSDIWVMGS 108
           Y   I VG+P Q+  +++DTGSS++WV  S
Sbjct: 92  YFADISVGTPPQNFKVILDTGSSNLWVPSS 121

>YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON}
           PEP4Vacuolar aspartyl protease (proteinase A), required
           for the posttranslational precursor maturation of
           vacuolar proteinases; important for protein turnover
           after oxidative damage; synthesized as a zymogen,
           self-activates
          Length = 405

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/318 (24%), Positives = 137/318 (43%), Gaps = 54/318 (16%)

Query: 192 ATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVA 251
            +++C  +  +  ++SSS+K+NGT+F IQYG  S   G   +D +++ D+ +     A A
Sbjct: 123 GSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLE-GYISQDTLSIGDLTIPKQDFAEA 181

Query: 252 NISNS-TF------GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSL 304
                 TF      G+LG+G   + V   +         Y      L+D+ +     ++ 
Sbjct: 182 TSEPGLTFAFGKFDGILGLGYDTISVDKVVPP------FYNAIQQDLLDEKR-----FAF 230

Query: 305 FVNDLNA---THGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXX 361
           ++ D +      G   FG +D SK+ G +  +P         V +   ++V         
Sbjct: 231 YLGDTSKDTENGGEATFGGIDESKFKGDITWLP---------VRRKAYWEVKFEGIGLGD 281

Query: 362 XXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGF---YRYQCDEISD 418
                        A +D+GT+   LP    S +A+ +NAE G + G+   Y   C+   +
Sbjct: 282 EYAELESHG----AAIDTGTSLITLP----SGLAEMINAEIGAKKGWTGQYTLDCNTRDN 333

Query: 419 SDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-----IILGDNFLT 473
             +L+F+F G+       NF +  YD     +  C  A+ P +  E      I+GD FL 
Sbjct: 334 LPDLIFNFNGY-------NFTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLR 386

Query: 474 AAYVVYDLENLEISMAQA 491
             Y +YDL N  + +A+A
Sbjct: 387 KYYSIYDLGNNAVGLAKA 404

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 79  YSVTIGVGSPAQDVTLLIDTGSSDIWV 105
           Y   I +G+P Q+  +++DTGSS++WV
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWV 117

>Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {ON}
           YPL154C (REAL)
          Length = 405

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 80/318 (25%), Positives = 136/318 (42%), Gaps = 54/318 (16%)

Query: 192 ATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVA 251
            +++C  +  +  ++SSS+K+NGT+F IQYG  S   G   +D +++ D+ +     A A
Sbjct: 123 GSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLE-GYISQDTLSIGDLTIPKQDFAEA 181

Query: 252 NISNS-TF------GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSL 304
                 TF      G+LG+G   + V   +         Y      L+D+ K     ++ 
Sbjct: 182 TSEPGLTFAFGKFDGILGLGYDTISVDKVVPP------FYNAIQQDLLDEKK-----FAF 230

Query: 305 FVNDLNA---THGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXX 361
           ++ D +      G   FG +D SK+ G +  +P         V +   ++V         
Sbjct: 231 YLGDTSKDSENGGEATFGGIDESKFKGDITWLP---------VRRKAYWEVKFEGIGLGD 281

Query: 362 XXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGF---YRYQCDEISD 418
                        A +D+GT+   LP    S +A+ +NAE G + G+   Y   C+    
Sbjct: 282 EYAELEGHG----AAIDTGTSLITLP----SGLAEMINAELGAKKGWTGQYTLDCNTRDS 333

Query: 419 SDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-----IILGDNFLT 473
             +L+F+F G+       NF +  YD     +  C  A+ P +  E      I+GD FL 
Sbjct: 334 LPDLIFNFNGY-------NFTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLR 386

Query: 474 AAYVVYDLENLEISMAQA 491
             Y +YDL N  + +A+A
Sbjct: 387 KYYSIYDLGNDAVGLAKA 404

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 79  YSVTIGVGSPAQDVTLLIDTGSSDIWV 105
           Y   I +G+P Q+  +++DTGSS++WV
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWV 117

>Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C
           (REAL)
          Length = 405

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 79/318 (24%), Positives = 136/318 (42%), Gaps = 54/318 (16%)

Query: 192 ATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVA 251
            +++C  +  +  ++SSS+K+NGT+F IQYG  S   G   +D +++ D+ +     A A
Sbjct: 123 GSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLE-GYISQDTLSIGDLTIPKQDFAEA 181

Query: 252 NISNS-TF------GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSL 304
                 TF      G+LG+G   + V   +         Y      L+D+ K     ++ 
Sbjct: 182 TSEPGLTFAFGKFDGILGLGYDTISVDKVVPP------FYNAIQQDLLDEKK-----FAF 230

Query: 305 FVNDLNA---THGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXX 361
           ++ D +      G   FG +D SK+ G +  +P         V +   ++V         
Sbjct: 231 YLGDTSKDSENGGEATFGGIDESKFKGDITWLP---------VRRKAYWEVKFEGIGLGD 281

Query: 362 XXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGF---YRYQCDEISD 418
                        A +D+GT+   LP    S +A+ +NAE G + G+   Y   C+    
Sbjct: 282 EYAELESHG----AAIDTGTSLITLP----SGLAEMINAELGAKKGWTGQYTLDCNTRDS 333

Query: 419 SDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-----IILGDNFLT 473
             +L+F+F G+       N+ +  YD     +  C  A+ P +  E      I+GD FL 
Sbjct: 334 LPDLIFNFNGY-------NYTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIIGDAFLR 386

Query: 474 AAYVVYDLENLEISMAQA 491
             Y +YDL N  + +A+A
Sbjct: 387 KYYSIYDLGNNAVGLAKA 404

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 79  YSVTIGVGSPAQDVTLLIDTGSSDIWV 105
           Y   I +G+P Q+  +++DTGSS++WV
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWV 117

>Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {ON}
           YPL154C (REAL)
          Length = 406

 Score = 75.5 bits (184), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 80/318 (25%), Positives = 134/318 (42%), Gaps = 54/318 (16%)

Query: 192 ATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVA 251
            +++C  +  +  ++SSS+K NGT+F IQYG  S   G   +D +++ D+ +     A A
Sbjct: 124 GSLACFLHSKYDHEASSSYKPNGTEFAIQYGTGSLE-GYISQDTLSIGDLTIPKQDFAEA 182

Query: 252 NISNS-TF------GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSL 304
                 TF      G+LG+G   + V   +         Y      L+D+ K     ++ 
Sbjct: 183 TSEPGLTFAFGKFDGILGLGYDTISVDKVVPP------FYNAIQQDLLDEKK-----FAF 231

Query: 305 FVNDLNA---THGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXX 361
           ++ D +      G   FG +D SK+ G +  +P         V +   ++V         
Sbjct: 232 YLGDTSKDSENGGEATFGGIDKSKFKGDVTWLP---------VRRKAYWEVKFEGIGLGH 282

Query: 362 XXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGF---YRYQCDEISD 418
                        A +D+GT+   LP    S +A+ +NAE G + G+   Y   C+    
Sbjct: 283 EFAELEGHG----AAIDTGTSLITLP----SGLAEMINAEIGAKKGWSGQYALDCNTRDG 334

Query: 419 SDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-----IILGDNFLT 473
             +L F+F G+       NF +  YD     +  C  A+ P +  E      I+GD FL 
Sbjct: 335 LPDLTFNFNGY-------NFTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIIGDAFLR 387

Query: 474 AAYVVYDLENLEISMAQA 491
             Y +YDL N  + +A+A
Sbjct: 388 KYYSIYDLGNDAVGLAEA 405

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 79  YSVTIGVGSPAQDVTLLIDTGSSDIWV 105
           Y   I +G+P Q+  +++DTGSS++WV
Sbjct: 92  YYTDISLGNPPQNFKVILDTGSSNLWV 118

>YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}
           YPS7Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance; located in the cytoplasm and
           endoplasmic reticulum
          Length = 596

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 92/314 (29%), Positives = 143/314 (45%), Gaps = 35/314 (11%)

Query: 236 VTLQDVKVSDISLAVANIS-----NSTFGVLGI-GLPGLEVTNALAESPSDAYTYKN-FP 288
           VT  +V+ +  SL+++N+S     +S F   G+ GL G +VTN      S  YT ++ F 
Sbjct: 159 VTRDNVQFNSGSLSISNVSFFDIQSSNFKTSGLLGLSG-KVTNPGNAIDSSQYTEQSYFL 217

Query: 289 AMLVDQGKIRKSAYSLFVNDLNATH----------GSVLFGAVDHSKYTGTL---QTIPL 335
           ++L D   I  S+YSL++    +T+          G +L G VD S +TGTL     IP 
Sbjct: 218 SLLKDADIIESSSYSLWLAGDTSTYKTYRDPISNCGKLLLGGVDPSLFTGTLGKFDLIPY 277

Query: 336 VNSIKSA-QVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAI 394
           V+ + +A  V  PI     ++                  PALLDS ++ ++LP   +  I
Sbjct: 278 VDPVSNAVSVGYPIVPLGPIYIVSNSGQSLNMTSKDFLSPALLDSTSSVSYLPTSTIIQI 337

Query: 395 AKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNET---- 450
           A ++ A Y +    +  QC        L F      I+  L +   +TYD   N +    
Sbjct: 338 AVQIAATYVESLDRWLVQCSIADMGVSLGFRLRELTIEIPLRDLLSSTYDTSTNSSMFFS 397

Query: 451 ---DVCALALIP-YNRGEIILGDNFLTAAYVVYDLENLEISMAQANL---DGGSEDIEEI 503
              + C L L    N G  ILG+ F+   Y+  DLE+  I++AQA     D  +E+  E 
Sbjct: 398 SGQEACFLTLYANTNTGVNILGEAFIKNIYMAMDLEDNTIAIAQAKKVEDDAVTEETNET 457

Query: 504 V-STVPSAVKAPGY 516
             ST+   +K+ GY
Sbjct: 458 TASTIIKKIKS-GY 470

>Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {ON}
           YDR349C (REAL)
          Length = 586

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 127/286 (44%), Gaps = 25/286 (8%)

Query: 230 VWGRDDVTLQDVKVSDISLAVANISNSTFGVLGI-GLPGLEVTNALAESPSDAYT-YKNF 287
           V  +D++  +   +S  +++  NI +S F   G+ GL G +VTN   +  S  YT Y  F
Sbjct: 148 VENQDNIQFESGSLSISNVSFFNIESSNFKSSGLLGLSG-KVTNPGTDIDSSQYTEYSYF 206

Query: 288 PAMLVDQGKIRKSAYSLFVNDLNATH----------GSVLFGAVDHSKYTGTL---QTIP 334
            ++L D   I   +YSL++    +T+          G +L G VD S +TGTL     IP
Sbjct: 207 LSLLKDANFIESPSYSLWLAGDTSTYKTYRDPILNCGKLLLGGVDPSLFTGTLGQFDLIP 266

Query: 335 LVNSIKSA-QVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSA 393
             + + +A  +  PI     ++                  PALLDS ++ ++LP   +  
Sbjct: 267 YADPVTNAITIGYPIVPLGPIYIVSNSGESLNMTSKDFLSPALLDSTSSVSYLPTSTIIQ 326

Query: 394 IAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNET--- 450
           IA ++ A Y +    +  QC        L F      I+  L +   +TYD   N +   
Sbjct: 327 IAVQIAATYVESLDRWLVQCSMADMGVTLAFRLRDLFIEIPLRDLLSSTYDTSTNSSMLF 386

Query: 451 ----DVCALALIP-YNRGEIILGDNFLTAAYVVYDLENLEISMAQA 491
               + C L L    N G  ILG+ F+   Y+  DLE+  I++AQA
Sbjct: 387 SSGQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTIAIAQA 432

>KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 409

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 82/326 (25%), Positives = 135/326 (41%), Gaps = 54/326 (16%)

Query: 181 VPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQD 240
           VP+A        +++C  +  +  ++SS++K+NG++F IQYG  S   G   RD +T+ D
Sbjct: 122 VPSAEC-----GSLACFLHTKYDHEASSTYKANGSEFAIQYGSGSLE-GYVSRDLLTIGD 175

Query: 241 VKVSDISLAVAN------ISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVD 293
           + + D   A A        +   F G+LG+    + V   +         Y      L+D
Sbjct: 176 LVIPDQDFAEATSEPGLAFAFGKFDGILGLAYDSISVNRIVPP------VYNAIKNKLLD 229

Query: 294 QGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVT 353
                  A+ L  +D +   G   FG +D  KYTG +  +P         V +   ++V 
Sbjct: 230 DPVF---AFYLGDSDKSEDGGEASFGGIDEEKYTGEITWLP---------VRRKAYWEVK 277

Query: 354 LHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGF---YR 410
                                A +D+GT+   LP    S +A+ LNAE G + G+   Y 
Sbjct: 278 FEGIGLGEEYATLEGHG----AAIDTGTSLIALP----SGLAEILNAEIGAKKGWSGQYS 329

Query: 411 YQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-----I 465
             C+      +L  +F G+       NF +  YD     +  C  A  P +  E      
Sbjct: 330 VDCESRDSLPDLTLNFNGY-------NFTITAYDYTLEVSGSCISAFTPMDFPEPVGPLA 382

Query: 466 ILGDNFLTAAYVVYDLENLEISMAQA 491
           I+GD FL   Y +YD+ +  + +A+A
Sbjct: 383 IIGDAFLRKYYSIYDIGHDAVGLAKA 408

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 45/103 (43%), Gaps = 22/103 (21%)

Query: 23  AEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPR--VKRVKRDDGTASFEIDNQDTF-- 78
           AEAK  + + +  KL  D+L+ D+       Q+    +   +R     SF  DN D F  
Sbjct: 22  AEAKIHKAKIQKHKLE-DQLK-DVPFAEHVAQLGEKYLNSFQRAYPQESFSKDNVDVFVA 79

Query: 79  ----------------YSVTIGVGSPAQDVTLLIDTGSSDIWV 105
                           Y   I +GSP Q   +++DTGSS++WV
Sbjct: 80  PEGSHSVPLTNYLNAQYFTEITLGSPPQSFKVILDTGSSNLWV 122

>KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 596

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 100/224 (44%), Gaps = 24/224 (10%)

Query: 291 LVDQGKIRKSAYSLFVN----------DLNATHGSVLFGAVDHSKYTG---TLQTIPLVN 337
           LVD+  I  S++S+++           + +   G V+FGAVD S YTG      TIP  N
Sbjct: 208 LVDESLIYTSSFSMWMGADTRDPLESPEPSNGCGKVIFGAVDTSLYTGDFVKFDTIPFHN 267

Query: 338 SIKSAQVPK--PIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIA 395
           + ++ +  +  PI     ++                  P L+DS   + +LP  ++  IA
Sbjct: 268 A-RTGETSRGYPIIPLTKVNVQSKSGETKNMTSDSFLEPVLIDSRFRYNYLPLEIIVQIA 326

Query: 396 KKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNET----- 450
            + NA Y +    +   CD       ++F+FG   I   L+N    T+D D N T     
Sbjct: 327 MQANAYYVESLNRWLLACDVGRLGASIIFEFGNLSINVPLNNLMGPTFDSDTNGTLHFSN 386

Query: 451 --DVCALALIPYN-RGEIILGDNFLTAAYVVYDLENLEISMAQA 491
               C L L+P    G  +LG  F+   Y+  +LE+ ++++AQA
Sbjct: 387 KQQACELKLLPSTASGFNVLGGAFIKNVYMAAELESNQVALAQA 430

>Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {ON}
           YDR349C (REAL)
          Length = 596

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 90/313 (28%), Positives = 143/313 (45%), Gaps = 35/313 (11%)

Query: 237 TLQDVKVSDISLAVANIS-----NSTFGVLGI-GLPGLEVTNALAESPSDAYTYKN-FPA 289
           T  +V+ +  SL+++N+S     +S F   G+ GL G ++TN  + + S  YT ++ F +
Sbjct: 160 TRGNVQFNSGSLSISNVSFFSVESSNFKTSGLLGLSG-KITNPGSAADSSHYTEQSYFLS 218

Query: 290 MLVDQGKIRKSAYSLFVNDLNATH----------GSVLFGAVDHSKYTGTL---QTIPLV 336
           +L D   I   +YSL++    +T+          G +L G VD S +TGTL     IP V
Sbjct: 219 LLKDVNLIESPSYSLWLAGDTSTYQTHRDPIYNCGKLLLGGVDPSLFTGTLGKFDLIPYV 278

Query: 337 NSIKSA-QVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIA 395
           + + SA     PI     ++                  PALLDS ++ ++LP   +  IA
Sbjct: 279 DPVSSAVSTGYPIVPLGPIYIVSNSGQSLNMTSKDFLSPALLDSTSSVSYLPTNTIIQIA 338

Query: 396 KKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNET----- 450
            ++ A Y +    +  QC   +    L F      I+  L +   +TYD   N +     
Sbjct: 339 VQIAATYVESLDRWLVQCSMANMGVSLGFTLRELVIEIPLRDLLSSTYDTSTNSSMFFSS 398

Query: 451 --DVCALALIP-YNRGEIILGDNFLTAAYVVYDLENLEISMAQANL---DGGSEDIEEI- 503
             + C L L    N G  ILG+ F+   Y+  DLE+  I++AQA     D  ++D  E  
Sbjct: 399 GQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTIAIAQAKKIEDDAVNDDANETN 458

Query: 504 VSTVPSAVKAPGY 516
            STV   +K+ GY
Sbjct: 459 ASTVIKKIKS-GY 470

>TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.401
           YDR349C
          Length = 573

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 102/228 (44%), Gaps = 25/228 (10%)

Query: 291 LVDQGKIRKSAYSLF-------------VNDLNATHGSVLFGAVDHSKYTGTLQT---IP 334
           L++ G I+  +YSL+              +   A  G ++ GAVD S YTG L++   IP
Sbjct: 199 LMNLGIIKTPSYSLWFGADTVPYDRRKLASGTMADCGKLILGAVDPSLYTGILRSFKMIP 258

Query: 335 LVNSIKSAQVPK-PIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSA 393
            ++ +  AQ    PI    T++                  P LLDS  + T+LP   +  
Sbjct: 259 FIDPVSQAQSNNYPILPLGTIYINSANGKSLNMTSEEFVEPVLLDSRYSTTYLPIDAIVQ 318

Query: 394 IAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNET--- 450
           IA ++ A + +    +   C        L F FG   I+  L++F + TYD   N +   
Sbjct: 319 IAVQIGATFVESLDKWLVACSVAKLDVSLDFTFGNIEIRVPLEDFLVTTYDPKSNTSLHF 378

Query: 451 ----DVCALALIPYNR-GEIILGDNFLTAAYVVYDLENLEISMAQANL 493
               + C LA++  ++ G  +LG  FL   Y+  D+E+  I++AQA +
Sbjct: 379 STGEEACFLAMVSKDKTGYNVLGGPFLKNLYMAVDIEDSSIAIAQAKM 426

>TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.677
           YPL154C
          Length = 419

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 74/315 (23%), Positives = 134/315 (42%), Gaps = 49/315 (15%)

Query: 193 TISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQD---VKVSDISLA 249
           +++C  +  +  D S++++ NGT+F IQYG  S   G   RD + + D   +   D + A
Sbjct: 137 SLACYLHSKYDHDESTTYEKNGTKFTIQYGSGSMD-GYISRDTLIIGDDLVIPEQDFAEA 195

Query: 250 VAN----ISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSL 304
            +      +   F G+LG+    + V   +         + N     + QG + ++ ++ 
Sbjct: 196 TSEPGLAFAFGKFDGILGLAYDTIAVNKVVPP-------FYN----AIKQGILDENKFAF 244

Query: 305 FVNDLNATH---GSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXX 361
           ++ D N  +   G   FG  D SK+TG +  +P+       +    ++FD          
Sbjct: 245 YLGDTNKDNKSGGEATFGGYDKSKFTGDITWLPV-----RRKAYWEVKFD--------SI 291

Query: 362 XXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDE 421
                      + A +D+GT+   LP  L   I  ++ A+     G Y   CD      +
Sbjct: 292 ALGDEVASLDGYGAAIDTGTSLITLPSGLAEVINTQIGAK-KSWSGQYTIDCDTRDALPD 350

Query: 422 LVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-----IILGDNFLTAAY 476
           + F+F G+       NF ++ YD     +  C  A+ P +  E      I+GD FL   Y
Sbjct: 351 MTFNFNGY-------NFTVSPYDYTLEMSGSCISAITPMDFPEPVGPLAIIGDAFLRKYY 403

Query: 477 VVYDLENLEISMAQA 491
            +YDL+N  + +A++
Sbjct: 404 SIYDLDNNAVGLAKS 418

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 79  YSVTIGVGSPAQDVTLLIDTGSSDIWV 105
           Y   I +G+P Q+  +++DTGSS++WV
Sbjct: 104 YYTDISLGTPKQNFKVILDTGSSNLWV 130

>KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {ON}
           Anc_8.677 YPL154C
          Length = 416

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 78/309 (25%), Positives = 129/309 (41%), Gaps = 55/309 (17%)

Query: 193 TISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYAL-GVWGRDDVTLQDVKVSDISLAVA 251
           +++C  +  +    SS++  NGT+F I+YG  S AL G    D VT+ D+++     A A
Sbjct: 132 SLACFLHNKYDHRVSSTYVRNGTRFAIRYG--SGALEGYMSNDTVTVGDLQIPKQDFAEA 189

Query: 252 N------ISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSL 304
                   +   F G+ G+    + V  A+         + N     V++G +    ++ 
Sbjct: 190 TSEPGLAFAFGKFDGIFGLAFDTISVNRAVPP-------FYN----AVNRGLLDAPQFAF 238

Query: 305 FVND--LNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXX 362
           ++ D  L    G V FG  D +++TG +  +P         V +   ++V  +       
Sbjct: 239 YLGDKRLRKEGGEVTFGGYDETRFTGNITWLP---------VRREAYWEVDFNGISFGSQ 289

Query: 363 XXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDED---GFYRYQCDEISDS 419
                       A +D+GT+   LP    S +A+ LNA+ G      G Y   C   S  
Sbjct: 290 YAPLTATG----AAIDTGTSLITLP----SGLAEILNAQIGARKNWSGQYVLDCSRRSTL 341

Query: 420 DELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-----IILGDNFLTA 474
            ++ F+ GG        NF++  YD     +  C  A++P +  E      I+GD FL  
Sbjct: 342 PDITFNLGG-------SNFSIGPYDYTLEASGTCISAIVPMDFPEPVGPLAIIGDAFLRR 394

Query: 475 AYVVYDLEN 483
            Y VYDL N
Sbjct: 395 WYSVYDLGN 403

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 79  YSVTIGVGSPAQDVTLLIDTGSSDIWV 105
           Y   I +GSP Q   +++DTGSS++WV
Sbjct: 99  YFADISIGSPGQTFRVIMDTGSSNLWV 125

>Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C
           (REAL)
          Length = 252

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 99/213 (46%), Gaps = 58/213 (27%)

Query: 79  YSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDTNGK 138
           Y V + +G+P Q   L +DTGSSD+ V  +++ +C+                  DD N  
Sbjct: 94  YVVEMQIGTPPQTAYLELDTGSSDMCVNEADSAHCKS---------------LADDNN-- 136

Query: 139 DFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSE 198
                            ++ +Y  TAT    ET S           T + S     SCS 
Sbjct: 137 ----------------IWTSNYELTAT--ATETLS-----------TPLPSVHHITSCSY 167

Query: 199 YGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTF 258
           +GTF  + SS+FK N T F     DL+Y  G +G D V+L ++ +S+ +  V+N +  ++
Sbjct: 168 WGTFNPNISSTFKYNETIF-----DLTY--GTYGTDVVSLGNITLSNYTFGVSNDTTMSY 220

Query: 259 GVLGIGLPGLEVT----NALAESPSDAYTYKNF 287
           G+LGI LP  E+T    +AL+ + +  + Y NF
Sbjct: 221 GILGISLPSEEITDRGQDALSSNKT-PFAYDNF 252

>Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii ACR144W ACR143W
          Length = 415

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 74/311 (23%), Positives = 130/311 (41%), Gaps = 46/311 (14%)

Query: 195 SCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANIS 254
           +C  +  F  D SSS+  N ++F + YG  S   G    D + + D+ + +   A A + 
Sbjct: 136 ACLNHARFDHDRSSSYAKNDSRFSVSYGKGSME-GFVSYDTLKIGDLTIKNQGFAEATVE 194

Query: 255 -NSTF------GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVN 307
             S F      G+LG+   GL V N +     +A          V QG + +  ++ +++
Sbjct: 195 PGSAFVYGQFDGILGLAYDGLAV-NHIVPPFYEA----------VHQGLLDEPVFAFYLS 243

Query: 308 DL---NATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXX 364
           D    ++  G V+FG  D +K+TG +  +P++         +   ++V L+         
Sbjct: 244 DEKKGDSLAGEVVFGGYDETKFTGEISWLPVI---------RKAYWEVELNSITLGSQKF 294

Query: 365 XXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVF 424
                   +   LD+GT+F   P  L      K  A    +DG     C   S   +L F
Sbjct: 295 QLQN----YGGALDTGTSFITFPSELYQEFVSKTGATVDPDDGHIIAPCSG-SGFPDLTF 349

Query: 425 DFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRG----EIILGDNFLTAAYVVYD 480
           +  G        ++ +  +DD       CA+A+ P + G     +I+GD FL   Y +YD
Sbjct: 350 ELAGRSFTISSSDY-VVQWDD-----TTCAVAITPLDLGGAGKMVIIGDVFLRRWYSIYD 403

Query: 481 LENLEISMAQA 491
           L    + +A++
Sbjct: 404 LSKNAVGLAKS 414

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 45  DLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIW 104
           D++E  +      V+R   +    + +    + +YS  IG+G+P Q   +++DTGSS++W
Sbjct: 68  DILEKLKGAANGEVERASSNGHPIALDNFVNNQYYS-EIGLGTPPQSFKVVMDTGSSNLW 126

Query: 105 VMGSN 109
           V   N
Sbjct: 127 VPNKN 131

>Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON}
           YDR349C (REAL)
          Length = 598

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 83/304 (27%), Positives = 135/304 (44%), Gaps = 24/304 (7%)

Query: 233 RDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNF-PAML 291
           R+ V      +S  +++  NI +S FG  G+   G ++T++  +  S  +T  +F  ++L
Sbjct: 162 RNSVQFNSGSLSISNVSFFNIESSNFGTSGLLGLGGKITDSGTDYDSSQFTENSFFLSLL 221

Query: 292 VDQGKIRKSAYSLFVNDLNATH----------GSVLFGAVDHSKYTGTL---QTIPLVNS 338
            D   I   +YSL++    +T+          G +L G VD S +TGTL     IP V+ 
Sbjct: 222 TDASFIECPSYSLWLAGDTSTYQSYKESIPDCGKLLLGGVDPSLFTGTLGKFDLIPYVDP 281

Query: 339 IKSA-QVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKK 397
           + +      PI     ++                  PALLDS ++ ++LP   +  IA +
Sbjct: 282 VSNVVSTGYPIVPLGPIYIISNSGQSMNMTSKDFLSPALLDSTSSVSYLPTSTIIQIAVQ 341

Query: 398 LNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNET------- 450
           + A Y +    +  +C        L F F    IK  L +   +TYD   N +       
Sbjct: 342 IAATYVESLDRWLVECSMADMGVTLGFMFRSLTIKIPLSDLLSSTYDTTTNSSMFFSSGQ 401

Query: 451 DVCALALIP-YNRGEIILGDNFLTAAYVVYDLENLEISMAQA-NLDGGSEDIEEIVSTVP 508
           + C L L    N G  ILG+ F+   Y+  DLE+  I++AQA N++ G+   E   +   
Sbjct: 402 EACFLTLYANTNTGVNILGEAFMKNIYMAVDLEDNSIAIAQAKNIEDGAITDEANETNSV 461

Query: 509 SAVK 512
           SAVK
Sbjct: 462 SAVK 465

>KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 558

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 106/245 (43%), Gaps = 25/245 (10%)

Query: 287 FPAMLVDQGKIRKSAYSLFVNDLN----------ATHGSVLFGAVDHSKYTGTL---QTI 333
           F   L + G I  S+YSL+VN+ +          A  G++L G+VD   Y G L    +I
Sbjct: 194 FLTHLKNAGVIETSSYSLWVNNASNHSVDGQINRANAGTLLLGSVDPKYYDGDLISFGSI 253

Query: 334 PLVN-SIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVS 392
           P  + S        PI     +                   P  + S   +++LP  L+ 
Sbjct: 254 PFKDESSGYLSTGYPIVPMSRVSIANSEQEAVNLTDSSFLQPVFIHSRYLYSYLPLSLII 313

Query: 393 AIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNET-- 450
            ++ + NA Y +    +   CD       L+F+FG  +I     +F  ATY+   N +  
Sbjct: 314 QVSIQTNAVYVESLDRWLVACDIGDMGSNLIFEFGNLNISVPTVDFLGATYNMYSNSSLR 373

Query: 451 -----DVCALALIP-YNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIV 504
                + C L + P Y     +LG +F+  AY+V+D++N  I++AQA  D   E +E+  
Sbjct: 374 FTNGKEACYLKMYPNYATSFSVLGQSFIKNAYIVHDVDNSNIALAQAASD---EAVEKAA 430

Query: 505 STVPS 509
           +  P+
Sbjct: 431 NNSPA 435

>TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON}
           Anc_8.677 YPL154C
          Length = 408

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 77/321 (23%), Positives = 133/321 (41%), Gaps = 57/321 (17%)

Query: 192 ATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVA 251
            +++C  +  +   +SSS+K NGT F IQYG  S   G   +D +++ D+ +     A A
Sbjct: 123 GSLACFLHSKYDHSASSSYKPNGTDFAIQYGSGSLE-GYISQDTLSVGDLVIPKQDFAEA 181

Query: 252 N------ISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSL 304
                   +   F G+LG+    + V   +         + N     +DQ  + +  ++ 
Sbjct: 182 TSEPGLAFAFGKFDGILGLAYNTISVDKVVP-------PFYN----AIDQDLLDEPRFAF 230

Query: 305 FVNDLNATH------GSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXX 358
           ++ D + +       G   FG +D SK+ G +  +P         V +   ++V      
Sbjct: 231 YLGDSSDSEDSSVSGGVATFGGIDKSKFKGEISWLP---------VRRKAYWEVKFEGIG 281

Query: 359 XXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGF---YRYQCDE 415
                           A +D+GT+   LP    S +A+ +N+E G + G+   Y   C+ 
Sbjct: 282 LGDEFAILDGHG----AAIDTGTSLITLP----SGLAEIINSEIGAKKGWSGQYTVDCET 333

Query: 416 ISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-----IILGDN 470
            S   +L F+F G        N+ +  YD     +  C  A+ P +  E      I+GD 
Sbjct: 334 RSSLPDLTFNFSG-------KNYTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDT 386

Query: 471 FLTAAYVVYDLENLEISMAQA 491
           FL   Y VYDL N  + +A+A
Sbjct: 387 FLRRFYSVYDLGNNAVGLAKA 407

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 21/27 (77%)

Query: 79  YSVTIGVGSPAQDVTLLIDTGSSDIWV 105
           Y   I +G+PAQ+  +++DTGSS++WV
Sbjct: 91  YYTDISLGTPAQNFKVILDTGSSNLWV 117

>Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {ON}
           complement(35798..36997) [1200 nt, 400 aa]
          Length = 399

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 75/320 (23%), Positives = 135/320 (42%), Gaps = 59/320 (18%)

Query: 192 ATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVA 251
           ++++C  +  +    SS+++SNG+ F+IQYG  S   G   +D +T+ D+ +     A A
Sbjct: 118 SSLACYLHSKYDHSLSSTYRSNGSDFVIQYGSGSLK-GYISQDTLTIGDLIIPQQDFAEA 176

Query: 252 N------ISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAML--VDQGKIRKSAY 302
                   +   F G+LG+    + V  A+             P +   + +G + K  +
Sbjct: 177 TAEPGLAFAFGKFDGILGLAYDSISVNKAV-------------PPLYNAIHRGLLDKPMF 223

Query: 303 SLFVNDLNATH--GSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFD-VTLHXXXX 359
           + ++ D  ++   G   FG  D S++ G ++ +P+       +    +QFD + L     
Sbjct: 224 AFYLGDEKSSKNGGEATFGGYDPSRFEGEIKWLPV-----RRKAYWEVQFDGIKLGDKFM 278

Query: 360 XXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDE---DGFYRYQCDEI 416
                          A +D+GT+   LP    S IA  LN E G +   +G Y   C + 
Sbjct: 279 KLEGHG---------AAIDTGTSLITLP----SQIADFLNNEIGAKKSWNGQYTIDCKKR 325

Query: 417 SDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEI-----ILGDNF 471
               +L  +F          NF +  +D     +  C  A+ P +  +      I+GD F
Sbjct: 326 ESLPKLTLNFYN-------HNFTIDPFDYTLEISGSCISAITPMDFPQPVGPLSIIGDAF 378

Query: 472 LTAAYVVYDLENLEISMAQA 491
           L   Y +YDLEN  + +A++
Sbjct: 379 LRRFYSIYDLENNAVGLAKS 398

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 5/90 (5%)

Query: 21  ISAEAKYSQDESKFVKLS-FDKLRGDLVENARAGQIPRVKRVKRDDGTAS---FEIDNQ- 75
           +S E +   ++ K ++LS +    G    N      P V   K+D  T       +DN  
Sbjct: 23  VSLEKRDDSEDIKGIRLSDYISHLGRKYLNQFEKAFPEVHISKKDQFTIESHDVPLDNYL 82

Query: 76  DTFYSVTIGVGSPAQDVTLLIDTGSSDIWV 105
           +  Y   + +G+P Q   +++DTGSS++WV
Sbjct: 83  NAQYYTDVSIGTPPQKFKVILDTGSSNLWV 112

>AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
           (PEP4)
          Length = 268

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 122/296 (41%), Gaps = 42/296 (14%)

Query: 206 SSSSFKSNGTQFLIQYGDLSY----ALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVL 261
           +SS++KS+G +  +  G  S     +  V G  D  L +   ++ + +V     S  GV 
Sbjct: 4   NSSTYKSSGEEVELASGTGSMQGYLSTDVLGMGDAVLGEQGFAEATSSVLPFIASYQGVF 63

Query: 262 GIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFV--NDLNATHGSVLFG 319
           G+G         LA+       Y      ++++G+++   + +F+  N  +   G ++FG
Sbjct: 64  GLG------HRELAKGGQVPPIYN-----MMERGQLKDPMFGIFLPKNLAHINEGEIIFG 112

Query: 320 AVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDS 379
             D +K+ G+L+ +P+          K   ++V  +                   A+LD+
Sbjct: 113 GYDSTKFAGSLEWLPIT---------KKGFWEVEFNSISTGESTVQGEG----LGAILDT 159

Query: 380 GTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFA 439
           G++ T LP  +       L A  G + G  R  C     + E+VF+ GG         FA
Sbjct: 160 GSSLTLLPTEIFDKFNGALEAALGSKTG-GRVSCSARETAPEIVFELGG-------KKFA 211

Query: 440 LATYDDDDNETDVCALALIPYNRGE----IILGDNFLTAAYVVYDLENLEISMAQA 491
           +   +        C + + P   G     +ILG  FL   Y VYDL +  + +A+A
Sbjct: 212 ITGNEYIMPAGSECMVTIRPQASGAQSNVVILGTPFLRKFYSVYDLGSDRVGLAEA 267

>Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349C
           (YPS7) - GPI-anchored aspartic protease [contig 157]
           FULL
          Length = 593

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/261 (27%), Positives = 108/261 (41%), Gaps = 32/261 (12%)

Query: 259 GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSL-FVNDLNATH---- 313
           G LG+G    ++T A     S+      F   LV    I  S+YSL F  D+  ++    
Sbjct: 174 GALGLGG---KITQASDSDSSNYDDSFFFLDQLVQNNYINTSSYSLWFGGDVIESYAYSS 230

Query: 314 ----------GSVLFGAVDHSKYTGTL---QTIPLVNSIKSAQVPK--PIQFDVTLHXXX 358
                     G ++FG VD S YTG L    T+P  N +++    +  PI   V +    
Sbjct: 231 ALDSVAVENCGILIFGGVDRSLYTGDLVKIDTLPYYN-VRTGVTSRGYPIVPLVKVDVKS 289

Query: 359 XXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISD 418
                          P LLD+   + +LP  L+  IA + NA Y +    +   CD    
Sbjct: 290 KSGQVKNLTSEYFLEPVLLDTRYRYNYLPLDLIVKIATQANAYYVESLNRWLLACDVGKL 349

Query: 419 SDELVFDFGGFHIKSKLDNFALATYDDDDNET-------DVCALALIP-YNRGEIILGDN 470
              ++FDFG   I   L +    TYD   N T         C L  +P  + G  ILG  
Sbjct: 350 GASILFDFGEVVIDVPLSDLMGPTYDSTTNGTLYFSNADQACELRFLPNSDLGFSILGGP 409

Query: 471 FLTAAYVVYDLENLEISMAQA 491
           F+   Y+  +L++ ++++AQA
Sbjct: 410 FIKNVYLAAELQSNQVALAQA 430

>Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii ACR150W
          Length = 576

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 114/276 (41%), Gaps = 31/276 (11%)

Query: 241 VKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKS 300
           + + + S   A  SN   G LG+G     + +  AE  S   +   F  ML +   I+ +
Sbjct: 157 LSIPEFSFFRAEHSNIVDGSLGLGA---RILSGTAEDSSGFDSSFFFLDMLKNANFIKST 213

Query: 301 AYSLFVND----LNATH------GSVLFGAVDHSKYTGTL---QTIPLVNSIKSAQVPK- 346
           +YS+++ +    LNA+       G++L GAVD + + G     + +P  +S         
Sbjct: 214 SYSIWLGNDNSTLNASRLASSDVGTLLLGAVDPNYFIGNFYRFKMLPFRDSKTETTFNSL 273

Query: 347 PIQFDVTLHXXXXXXXXXXXXXXXXP---FPALLDSGTTFTHLPGYLVSAIAKKLNAEYG 403
           PI   V L                 P    P LLD   T ++LP  L+  IA + NA Y 
Sbjct: 274 PI---VPLTKVDIVNAKGTAVNVTQPGFMEPVLLDPRYTISYLPIELILQIAMQTNAVYV 330

Query: 404 DEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETD-------VCALA 456
                +   CD  +   ++ F FG   I   L +F  + Y      +         C L 
Sbjct: 331 KSLDLWLVDCDVANFDAKIRFQFGDLKIDVPLSHFVSSGYVGSPIASTQLGASNMTCQLN 390

Query: 457 LIP-YNRGEIILGDNFLTAAYVVYDLENLEISMAQA 491
           + P Y+ G  ILG  FL + Y+  DLE   ++MAQA
Sbjct: 391 VYPNYSSGFSILGGTFLRSVYLSVDLEGNSVAMAQA 426

>ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 720

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 8/126 (6%)

Query: 374 PALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKS 433
           P LLDS  +F+HLP   +  IA ++NA Y  E   +   C        + F+FG   I  
Sbjct: 437 PVLLDSRYSFSHLPAETIVQIAVQVNAIYMKEVDMFVVSCKIADMGVNIQFEFGDVSIDV 496

Query: 434 KLDNFALATYDDDDNET-------DVCALALIPYNR-GEIILGDNFLTAAYVVYDLENLE 485
              +F ++T++ + N T       + C + ++     G  ILG +FL   Y+  D ++  
Sbjct: 497 PFKDFLMSTHNPETNSTMKFSGGDEACFMTMVSSEETGFNILGTSFLRNVYLAVDHDDQS 556

Query: 486 ISMAQA 491
           I++AQA
Sbjct: 557 IAIAQA 562

>ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 408

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 67/314 (21%), Positives = 127/314 (40%), Gaps = 49/314 (15%)

Query: 194 ISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLA-VAN 252
           ++C  +  +  D SS++K NGT   + YG  S  +G    D   + D+++         +
Sbjct: 127 MACRLHKRYDHDRSSTYKENGTLTGVTYGSGS-IMGYVSEDTFRISDLEIPGQQFTETTD 185

Query: 253 ISNSTF------GVLGIGLP--GLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSL 304
              S F      G+LG+  P  G  VT    +              L+++  +++  + +
Sbjct: 186 EPGSVFVFAAFDGILGLAYPSLGYGVTPPFQQ--------------LMEKKLVKEPVFGM 231

Query: 305 FVNDLNAT--HGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFD-VTLHXXXXXX 361
           +++D+     +G ++ G  D +K+ G +  +P+       Q    + FD VT+       
Sbjct: 232 YLDDMKTGEGNGQLVLGGYDETKFKGEIAWLPV-----RRQAYWEVVFDSVTVGDDNIPL 286

Query: 362 XXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDE 421
                      + A +DSGT+    P  L +    KL+    D  G     C     +  
Sbjct: 287 EN---------YGAAIDSGTSLITFPSELFNQFISKLSGVTKDRQGNVYVDCANKQTAPP 337

Query: 422 LVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYN---RGEI-ILGDNFLTAAYV 477
           L F FGG       +++ ++       ++  C  A++  +    G++ I+GD FL   Y 
Sbjct: 338 LTFGFGGHKFSISGEDYIISV----PGQSARCMPAIVQLDIDSAGKVAIIGDVFLRRYYS 393

Query: 478 VYDLENLEISMAQA 491
           +YD  N  + +A A
Sbjct: 394 IYDFGNNAVGLATA 407

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 62  KRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGS 108
           K +DG  S   +  +  Y+  + +G+P QD  +++DTGSS +WV G 
Sbjct: 76  KNNDGHVSELANLANNIYAADVTIGTPPQDFRVVVDTGSSTLWVPGK 122

>TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.401
           YDR349C
          Length = 624

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 103/256 (40%), Gaps = 37/256 (14%)

Query: 314 GSVLFGAVDHSKYTGTL---QTIP-LVNSIKSAQV-PKPIQFDVTLHXXXXXXXXXXXXX 368
           G+++ GAVD   Y G L     +P L+N++  A     PI     ++             
Sbjct: 249 GNLVLGAVDQRYYEGRLVQFDMLPALLNNVTEAVTYGLPIIPMGPIYIENSSGTQLNLTT 308

Query: 369 XXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGG 428
                P LLDS  T   LP   V  IA +LNA Y +E G +  +C     +  L F+F G
Sbjct: 309 TNFLEPVLLDSRYTNARLPLNTVIQIATQLNAAYVEEFGSWIVECSLAEMNVNLNFNFQG 368

Query: 429 FHIKSKLDNFALATYDDDDNE--------TDVCALALIP-YNRGEIILGDNFLTAAYVVY 479
             I   L++F     +    E         D CALA+ P  + G  ILG  FL   Y+  
Sbjct: 369 LTIPVSLNDFLSRVINSTTGEPIKFSESSEDACALAVYPNTDIGFNILGGPFLKNIYLAI 428

Query: 480 DLENLEISMAQA------------------NLDGGSEDIEEIVS-----TVPSAVKAPGY 516
           D E   +++A+A                  N    S  +++  S     TV ++ K+  +
Sbjct: 429 DNEGRSVAIAKAVKEDDTSAINSISSNSSDNETHISTSVKKTTSHSGNSTVTTSTKSETF 488

Query: 517 SSTWTSAIPISTGGNI 532
            S  +  IP +T  NI
Sbjct: 489 GSIQSGTIPFATSYNI 504

>ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 393

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/309 (21%), Positives = 121/309 (39%), Gaps = 48/309 (15%)

Query: 196 CSEYGTFATDSSSSFKSNGTQFLIQY--GDLSYALGVWGRDDVTLQDVKVSDISLAVA-- 251
           C     + + +SS+FK+      +QY  GD    +     D +     K+ +     A  
Sbjct: 119 CRTRNRYRSGASSTFKATDKTLRLQYVKGDAKARVSY---DTLYFAGAKIENQGFGEAEA 175

Query: 252 ---NISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFV- 306
              + S + F G++GIG P +             Y  K     L+D G ++   + +++ 
Sbjct: 176 IGDDFSGARFDGIIGIGYPSI------------GYGIKPPINTLIDSGGLKDPMFGIYIS 223

Query: 307 --NDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXXX 364
              + N+  G ++ G  +  K+ G ++ +P++   K+        F V            
Sbjct: 224 NAQNRNSPVGEIVLGGYNTQKFKGDIKWLPVLR--KAFWETDLSAFKV-----------G 270

Query: 365 XXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVF 424
                     A+ D+G++F  +P    +    +      D DG     C  ++   +L  
Sbjct: 271 NFALDVQGLTAVFDTGSSFIIMPEDTYTDFVSQFPGASHD-DGTDYVDCSTVNSGPDLTL 329

Query: 425 DFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNR--GEIILGDNFLTAAYVVYDLE 482
           DFGG  +K    ++ +          + C LA+   +R  GE+ILGD FL   Y +Y+  
Sbjct: 330 DFGGVALKLSARDYVMQL------GRNTCILAVSGNSRVTGEVILGDTFLRRYYTIYNFG 383

Query: 483 NLEISMAQA 491
           +  I +A A
Sbjct: 384 DNTIGVASA 392

 Score = 34.7 bits (78), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 66  GTASFEIDNQDTF-YSVTIGVGSPAQDVTLLIDTGSSDIWV 105
           G  S  + N + F YSV I +G+PAQ+  + +DTGSS +W+
Sbjct: 69  GKFSANVYNFENFQYSVDITLGTPAQNFRVALDTGSSLLWI 109

>CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {ON}
           similar to uniprot|Q06325 Saccharomyces cerevisiae
           YDR349c YPS7
          Length = 587

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 84/331 (25%), Positives = 140/331 (42%), Gaps = 40/331 (12%)

Query: 213 NGTQFL--IQYGDLSYALGVWGRDD-VTLQD--VKVSDISLAVANISNS-TFGVLGIGLP 266
           NGT+++  ++  ++S +L V G D  V+ ++  + V ++S   A+ S+   +G LG+G  
Sbjct: 123 NGTRYMDVMRLMNVSSSLNVSGVDSGVSFRNHTLTVQNLSFFNADYSSGYLYGSLGLG-- 180

Query: 267 GLEVTNALAESPSDAYTYKNFPAMLVDQGK-IRKSAYSLFV-----------NDLNATHG 314
                N+  E   D   +  F    + + + I  S+YSL++           +D N   G
Sbjct: 181 --GTLNSDTELEGDFINHSFFFLDALKEARLINSSSYSLWLGSQKRNGFADTSDANEA-G 237

Query: 315 SVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPK-----PIQFDVTLHXXXXXXXXXXXXXX 369
            ++FGAVD +   G  +   ++  I   Q  K     P+     ++              
Sbjct: 238 YLIFGAVDPNLVEGEFRKFDMIPYIH-PQTGKVAYGYPVVPMGPIYITSSSGRSLNVTTD 296

Query: 370 XXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGF 429
               P LLD     ++LP   +  IA ++ A Y +    +   CD  S    + F FG  
Sbjct: 297 GFSAPVLLDPSFALSYLPTKAIIQIAIQIAAVYVESLDLWLVSCDVASSGATVDFSFGDL 356

Query: 430 HIKSKLDNFALATYDDDDNET-------DVCALALIPYN-RGEIILGDNFLTAAYVVYDL 481
            IK  L +   +T+D   N T       + C L L P    G  +LG  F+  AY+  DL
Sbjct: 357 TIKVPLSDLLASTHDQSTNTTLHFNTGQEACVLQLYPNTFTGYNVLGQAFMKNAYLAVDL 416

Query: 482 ENLEISMAQ-ANLDGGSEDIEEIVSTVPSAV 511
           E   ++M Q AN   G    +EI++   S V
Sbjct: 417 EGKGVAMGQAANFKSGER--KEIITRQASIV 445

>Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON}
           (10059..11267) [1209 nt, 403 aa]
          Length = 402

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 74/316 (23%), Positives = 126/316 (39%), Gaps = 53/316 (16%)

Query: 193 TISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVAN 252
           +++C  +  +    SS++K NGT F IQYG  S   G   +D + + D+ +     A A 
Sbjct: 122 SLACYLHAKYDHSDSSTYKKNGTTFSIQYGSGSME-GYISQDVLQIGDLVIPGQDFAEAT 180

Query: 253 ------ISNSTF-GVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLF 305
                  +   F G+LG+    + V   +         Y      LVD+       +S +
Sbjct: 181 SEPGLAFAFGKFDGILGLAYDTIAVNRVVPP------FYNAINKKLVDE-----PIFSFY 229

Query: 306 VNDLNATH--GSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHXXXXXXXX 363
           + D   +   G V FG  D S +TG +  +P+       +    ++FD            
Sbjct: 230 LGDDTKSEDGGQVTFGGYDSSLFTGDITWLPV-----RRKAYWEVKFDAIALGNEVADLV 284

Query: 364 XXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDED---GFYRYQCDEISDSD 420
                      A +D+GT+   LP    S +A+ +N++ G +    G +   C       
Sbjct: 285 NHG--------AAIDTGTSLITLP----SGLAEVINSQIGAKKSWSGQWIVDCKTRDTLP 332

Query: 421 ELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYN----RGEI-ILGDNFLTAA 475
           ++ F F G+       NF +  YD     +  C  A+ P +     G + I+GD FL   
Sbjct: 333 DMTFTFDGY-------NFTITPYDYTLEVSGSCISAITPMDFPAPVGPLAIVGDAFLRRY 385

Query: 476 YVVYDLENLEISMAQA 491
           Y +YD+ N  + +A A
Sbjct: 386 YSIYDVGNNAVGLAAA 401

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 20/27 (74%)

Query: 79  YSVTIGVGSPAQDVTLLIDTGSSDIWV 105
           Y   I +G+PAQ   +++DTGSS++WV
Sbjct: 89  YYTDITLGTPAQSFKVILDTGSSNLWV 115

>SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 632

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 85/223 (38%), Gaps = 30/223 (13%)

Query: 287 FPAMLVDQGKIRKSAYSLFVND------------LNATHGSVLFGAVDHSKYTG---TLQ 331
           F   LV    I  S+YSL++                   G ++ GAVD S YTG      
Sbjct: 207 FLEQLVANNVIDSSSYSLWLGQDVGQEDDEDEYYTEENCGKLVLGAVDPSLYTGDFVRFD 266

Query: 332 TIPLVNSIKSA-QVPKPIQFDVTLHXXXXXXXXXXXXXXXXP---FPALLDSGTTFTHLP 387
           TIP  +    A     PI   V L                 P    P LLD+   ++ LP
Sbjct: 267 TIPFHDVDTGATSFGYPI---VPLTKVSVKASSGQTLNVTSPDFAEPVLLDTRYLYSFLP 323

Query: 388 GYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDD 447
             L+  IA + NA Y +    +   C     +  ++F+F G  I   + +F   +YD   
Sbjct: 324 LKLIIQIAIQTNAYYVESLDRWLVSCSVGDLNASMIFEFNGLSIDVPIKDFLSNSYDSVS 383

Query: 448 NET-------DVCALALIP-YNRGEIILGDNFLTAAYVVYDLE 482
           N T         C L + P Y  G  +LG  F+  AY+  DLE
Sbjct: 384 NSTLHFSNGNSACYLKMYPNYATGFSVLGAAFVKNAYIAADLE 426

>TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.401
           YDR349C
          Length = 609

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 101/247 (40%), Gaps = 29/247 (11%)

Query: 271 TNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSL-FVN-------------DLNATHGSV 316
           TN     PSD ++  N    L++ G I+ ++YS+ F N             +  + +G +
Sbjct: 212 TNLGVTGPSDPFSLLN---ALLNSGVIQTASYSMWFANGSSYIDTKHFPYEEKKSDYGLI 268

Query: 317 LFGAVDHSKYTGTLQTIPLV----NSIKSAQVPKPIQFDVTLHXXXXXXXXXXXXXXXXP 372
           +FG VD S   GT Q+  ++     S        PI     ++                 
Sbjct: 269 VFGGVDSSLIDGTFQSFTMIPYEDTSDGLTTSGYPILPMGPIYIIANSGRTLNLTTLDFL 328

Query: 373 FPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIK 432
            P LLDS  T + LP   +  +A +L A Y +    +   C     +    F FG   I+
Sbjct: 329 EPVLLDSRITNSRLPASFIIQVAIQLEAMYLESLDRWVVPCSLADYNVNFDFSFGSVRIR 388

Query: 433 SKLDNFALATYDDDDNET-------DVCALALIP-YNRGEIILGDNFLTAAYVVYDLENL 484
             L++F + +    DN+T       D C LA+ P  + G  ILG  FL  A +  D  + 
Sbjct: 389 VPLEDFLVPSGLTGDNKTIHFSQNEDACYLAMYPNTDIGFNILGTPFLKNAVIAVDHSSS 448

Query: 485 EISMAQA 491
           +I++ +A
Sbjct: 449 QIAIGKA 455

>NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa]
           {ON} Anc_5.401 YDR349C
          Length = 609

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 83/197 (42%), Gaps = 12/197 (6%)

Query: 307 NDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVT----LHXXXXXXX 362
           N + ++ G ++ GAVD + +TG+     ++ +++S    + I + +     ++       
Sbjct: 238 NSVTSSFGKLILGAVDPTLFTGSFLQFEMLPALESDSATETIGYPIIPMGPIYVVSKSGE 297

Query: 363 XXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDEL 422
                      P  LDS  T T+LP  ++  +A ++ A Y +    +   C+  +    L
Sbjct: 298 MANVTSKDFLEPVFLDSTYTSTYLPLNMIIQVAIQIGAMYVESLERWLVPCNIANQHATL 357

Query: 423 VFDFGGFHIKSKLDNFALATYDDDDNET-------DVCALALIPYNR-GEIILGDNFLTA 474
            F F    I+  L +    TYD   N +       + C L +      G  ILG  FL  
Sbjct: 358 DFTFQDVSIRVPLTDLLGTTYDSSTNTSMHFSTGDEACYLKIFSNQMTGYNILGRPFLKH 417

Query: 475 AYVVYDLENLEISMAQA 491
            Y+  DL+   I++AQA
Sbjct: 418 VYMAVDLDGNNIAIAQA 434

>YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protein
           of unknown function
          Length = 77

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 30/43 (69%), Gaps = 1/43 (2%)

Query: 294 QGKI-RKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPL 335
           QGKI +K +YSLF+N  N   GS+LFGAVD SKY   L T P+
Sbjct: 6   QGKIEKKISYSLFLNGPNVHFGSILFGAVDKSKYAEELCTHPM 48

>KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.401
           YDR349C
          Length = 596

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 112/467 (23%), Positives = 180/467 (38%), Gaps = 93/467 (19%)

Query: 79  YSVTIGVGSPAQDVTLLIDTGSSDIWVMGSN--------NPYCEGSSGKSKHVLLHEDSG 130
           Y V   VG P Q+ +L++DT    +WV+  N        N  C   +  S +      S 
Sbjct: 74  YYVNASVGEPQQEQSLVLDTTEPYLWVISGNVEMNCTDTNNVC---NANSLYYYNESSSA 130

Query: 131 FEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSY 190
              D N  D+  D L+Y++  G+                                   SY
Sbjct: 131 VAIDENA-DYQMDFLNYVSFAGS-----------------------------------SY 154

Query: 191 QATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAV 250
             TI+ ++          S K+N T  L+Q  +LS  + +   D + +++V   D + A 
Sbjct: 155 MDTINFTDI---------SIKNNYTNTLLQ-SNLSAYVNL-TNDHLWVKNVSFLDSTTAT 203

Query: 251 ANISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKS-AYSLF-VND 308
           +  S    GVLG+G     +T++     S  Y    F      +  I +S +YSL+ V D
Sbjct: 204 SLYS----GVLGLGG---SITSSNEYENSGNYDSSYFIFNKFKEANITQSNSYSLWLVED 256

Query: 309 LNA------------THGSVLFGAVDHSKYTGTL---QTIPLVN--SIKSAQVPKPIQFD 351
            ++            T G +L G +D + Y G+L     IP V+  S+ S+Q   PI   
Sbjct: 257 ESSLTTTSTKFEEEGTFGKLLLGVIDPALYRGSLYQFDMIPYVDPESLVSSQ-GYPILPM 315

Query: 352 VTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRY 411
             ++                  P LLDS     +LP   +  IA ++ A Y +    +  
Sbjct: 316 GVIYVKSESGARLNVTSKDFLEPVLLDSSQQGNYLPENAIIQIAIQIGATYIESMDRWLV 375

Query: 412 QCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNET-------DVCALALI-PYNRG 463
            CD  S    ++F F G  I   L+N    T++   N +         CAL +    N G
Sbjct: 376 SCDMASYGASVLFTFDGLEIDVPLENLLTNTFETGSNSSIYYSDGETACALTIYDNANMG 435

Query: 464 EIILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSA 510
             +LG  F    Y+  DLE   +++AQA      +      +T+P+A
Sbjct: 436 YNLLGSAFFRNTYIAVDLEGNTVAIAQAKPSDEDDSSNLSATTLPAA 482

>NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {ON}
           Anc_5.401 YDR349C
          Length = 645

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 110/475 (23%), Positives = 180/475 (37%), Gaps = 96/475 (20%)

Query: 75  QDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVM-GSNNPYCEG--SSGKSKHVLLHEDSGF 131
            D  Y V + +GSP Q   L IDT    +WV+ G+++  C    S   S +    E+S  
Sbjct: 47  NDGVYYVNVTIGSPPQQEMLRIDTSQPFVWVLSGADDKQCNRLDSGCLSGNRFYPEESTT 106

Query: 132 EDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQ 191
            +       YS  L++L    T   +GS       + V+  ++   +TD+  A       
Sbjct: 107 GESATNSTIYS--LNFL---DTFRVNGS-------IVVDNLNF--TNTDITAAL------ 146

Query: 192 ATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVA 251
                 +Y TF +  ++S    G  FL+         G    +D    D+     SL ++
Sbjct: 147 ------DYTTFNSSKNNSIIDIGDDFLVIKN-----FGFINAEDSYPTDMG----SLGLS 191

Query: 252 NISNSTFGVLGIGLPGLEVTNALAESPSDAY-TYKNFPAMLVDQGKIRKSAYSLFVN--- 307
           +  N T                L  SPS  + T  +  AML + G I   +YSL++    
Sbjct: 192 STFNET----------------LNYSPSGNFNTSFSMLAMLAESGLIDSQSYSLWLGNGA 235

Query: 308 ------------DLNATHGSVLFGAVDHSKYTG---TLQTIPLVN---SIKSAQVPK-PI 348
                       D    +G +L G+VD S +         +P V+    I+S   P  P+
Sbjct: 236 ERDTQLSSQRTPDPQYNNGKLLLGSVDPSLFKEPFYQFDVLPYVDPNTQIESFSFPVIPM 295

Query: 349 QFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGF 408
                ++                  P LL+S     +LP   +  IA ++ A Y +    
Sbjct: 296 N---AIYIVSKTGTGTNVTSEDFLEPVLLNSNFRSNYLPLNSIIQIAIQVGATYVESLDR 352

Query: 409 YRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDN-------ETDVCALALIPYN 461
           +   C   +++    F F   +IK+ L +F  +T+D   N        ++ C L L P  
Sbjct: 353 WLLPCSIANENVHFEFTFDKLNIKAPLIDFLESTFDSTTNTSMHFSDNSEACFLKLYPNT 412

Query: 462 R-GEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPG 515
             G   LG  FL + Y+  + E   + MAQA        ++E+ ST  +A   P 
Sbjct: 413 YVGFNALGRPFLKSVYLAVEQEGRIVGMAQA--------VQEMNSTFLNADVVPA 459

>Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON}
           (70588..72576) [1989 nt, 663 aa]
          Length = 662

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 58/126 (46%), Gaps = 8/126 (6%)

Query: 374 PALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKS 433
           P LLDS  T + LP   +  IA +++A Y ++   +   C  + +S  L F FG   IK 
Sbjct: 312 PVLLDSRYTNSRLPIEAIIQIAIQIDASYVEQLNSWVVSCSILKESVVLEFSFGPLRIKV 371

Query: 434 KLDNFALATYDDD-------DNETDVCALALIP-YNRGEIILGDNFLTAAYVVYDLENLE 485
            L  F     D D        N    C L+L P ++ G  ILG  F+ + Y+  D E   
Sbjct: 372 PLKQFLKKAIDPDTGNARTLSNGDQACILSLYPNHDIGYNILGAPFMKSIYLAVDNEGGT 431

Query: 486 ISMAQA 491
           I++ Q+
Sbjct: 432 IALGQS 437

>CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa]
           {ON} similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154c PEP4 aspartyl protease Saccharopepsin precursor
          Length = 415

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 82/323 (25%), Positives = 130/323 (40%), Gaps = 57/323 (17%)

Query: 192 ATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRD-----DVTLQDVK---- 242
            +++C  +  +    SS++  +G    I YG  S   G    D     D+T+Q+ K    
Sbjct: 123 GSLACFLHNKYDHSQSSTYIKDGRPLSISYGSGSIE-GYISEDNLQIGDLTIQNQKFGET 181

Query: 243 VSDISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAY 302
            S+  LA A       G+LG+        + +A+       Y      L+D+ K   S Y
Sbjct: 182 TSEPGLAFA--FGKFDGILGLAY------DTIAQDDITPPFYSAIQQHLLDESKF--SFY 231

Query: 303 SLFVNDLNATHGSV------LFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHX 356
              VND  A  GS         G VD SK+ G L  IPL        V +   ++V L+ 
Sbjct: 232 LKSVNDPAAEGGSASDGGVFTLGGVDSSKFKGDL--IPL-------HVRRQAYWEVPLNA 282

Query: 357 XXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGF---YRYQC 413
                             A +D+GT+   LP    S +A+ +NA+ G + G+   Y  +C
Sbjct: 283 IKLGDQSTGKLENTG---AAIDTGTSLITLP----SDMAEIINAQIGAKKGWTGQYTLEC 335

Query: 414 DEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-----IILG 468
              +   +L F   G        +F L+ ++     +  C   + P +  E      ILG
Sbjct: 336 STRAKLPDLTFTLDG-------HDFVLSPFEYTLEVSGSCISVITPMDFPEPIGRMAILG 388

Query: 469 DNFLTAAYVVYDLENLEISMAQA 491
           D FL   Y V+DL+   +S+A+A
Sbjct: 389 DAFLRRYYSVFDLDANVVSLAEA 411

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 50/117 (42%), Gaps = 12/117 (10%)

Query: 1   MRISSST----AILGLAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDL-------VEN 49
           MR+S S     A++ L     +    AE K  +   + ++L F+     L        E 
Sbjct: 1   MRLSLSVLMPLALMLLGDYADAKVFQAELKKEKLTKEMLELGFEAHVQQLGHKYVSQYEK 60

Query: 50  ARAGQIPRVKRVKRDDGTASFEIDN-QDTFYSVTIGVGSPAQDVTLLIDTGSSDIWV 105
           A  G +     +   D   +  + N  D  Y   I +G+P Q   +++DTGSS++WV
Sbjct: 61  ANPGTVLPRDHLFYPDQVHNVPLSNYMDAQYFADISLGTPPQKFKVILDTGSSNLWV 117

>KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5.401
           YDR349C
          Length = 598

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 103/258 (39%), Gaps = 28/258 (10%)

Query: 297 IRKSAYSLFVNDLNAT-------------HGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQ 343
           I+  +YSL++ +   T              G ++ GAVD S Y G       ++ I+ + 
Sbjct: 214 IKSKSYSLWLGNCRRTIDTITPDADNGSVAGKLILGAVDPSLYEGEFFQFNTISYIEPSH 273

Query: 344 ----VPKPIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAIAKKLN 399
                  PI     ++                  PALLDS    + LP   +  IA ++ 
Sbjct: 274 NLSTFGYPILPMGPIYMTSQAGRRLNMTSEQYLQPALLDSSFVGSFLPANTIIQIAIQIG 333

Query: 400 AEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNET-------DV 452
           A Y +    +   C   S    + F F G  IK  L +   ++ D   N T         
Sbjct: 334 AIYIESLNRWVVPCSVASMGAHIDFTFDGLDIKVPLSDLLTSSKDPATNSTMHFAEGESA 393

Query: 453 CALALIPYN-RGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAV 511
           C L L   N  G  +LG +F+  AY+  DL+  ++++AQA    G  D   IV+ +P A+
Sbjct: 394 CFLMLYSNNAMGFNVLGTSFIKNAYIAVDLDGTKVAIAQAKNTTG--DSTSIVTVIP-AL 450

Query: 512 KAPGYSSTWTSAIPISTG 529
              G ++   +   IS+G
Sbjct: 451 TGGGSTTAVRTVRKISSG 468

>Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)
          Length = 110

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 62  KRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYC 113
           KRDD   S  I N    Y V + +G+P Q   L +DTGSSD++V  +++PYC
Sbjct: 51  KRDDVLNSTLI-NAVGMYVVKVEIGTPPQTAYLQLDTGSSDMYVNDADSPYC 101

>ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR349C (YPS7)
          Length = 553

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 102/263 (38%), Gaps = 35/263 (13%)

Query: 291 LVDQGKIRKSAYSLFVNDLNATH----------GSVLFGAVDHSKYTGTLQT---IPLVN 337
           + D G I   +YSL+  + N +           G+++ GAVD   Y G       +P V+
Sbjct: 196 MRDAGLISSRSYSLWFGNDNTSAVDLPTVLEDIGTLMLGAVDPRLYYGNFYQYDGVPSVD 255

Query: 338 SIKSAQVPK---PIQFDVTLHXXXXXXXXXXXXXXXXPFPALLDSGTTFTHLPGYLVSAI 394
            I S Q  +   PI     +                   P LL+S    + LP  +V  I
Sbjct: 256 -IASGQHTRGGYPIVPLTRVQLLGTEGRQLNLTDDTFAEPVLLNSRFMTSFLPKSIVQQI 314

Query: 395 AKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALAT--------YDDD 446
           A++ NA +         +C  + +     F FG   ++  L +F   T           D
Sbjct: 315 ARQTNAVFTKSSNRLIVECSLLKEEASFRFHFGELVVEVPLSDFIGPTNLRAGTSILAPD 374

Query: 447 DNETDVCALALIP-YNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVS 505
            NET  C L L+P    G  +LG   L   Y+  D E+  + MA A        ++  V+
Sbjct: 375 TNET--CYLKLMPSTGMGFSMLGMPILRKLYIAADTESGAVGMALA-----VRPVDRNVT 427

Query: 506 TVPSAVKAPGYSSTWTSAIPIST 528
           ++P +      ++  + +IP +T
Sbjct: 428 SLPRSTGE--VAAIRSGSIPFAT 448

>YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein with
           similarity to GPI-anchored aspartic proteases such as
           Yap1p and Yap3p
          Length = 165

 Score = 36.6 bits (83), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%)

Query: 79  YSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKH 122
           Y V + +G+P Q V L +DTGSSD+ V  ++  YC+  S  S +
Sbjct: 67  YVVKMEIGTPPQTVYLQLDTGSSDMIVNNADIAYCKSMSDGSDY 110

>SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A),
           required for the posttranslational precursor maturation
           of vacuolar proteinases; synthesized as a zymogen,
           self-activates
          Length = 506

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 466 ILGDNFLTAAYVVYDLENLEISMAQAN 492
           ILGD FL   Y V+D+EN  +  A+ N
Sbjct: 405 ILGDVFLEGIYAVFDVENQRLGFAEGN 431

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,438,851
Number of extensions: 2739894
Number of successful extensions: 7402
Number of sequences better than 10.0: 172
Number of HSP's gapped: 7133
Number of HSP's successfully gapped: 281
Length of query: 629
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 513
Effective length of database: 40,180,143
Effective search space: 20612413359
Effective search space used: 20612413359
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)