Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.238328.258ON41941922630.0
KLTH0G13772g8.258ON42042019600.0
SAKL0H17138g8.258ON41942016100.0
ZYRO0C01738g8.258ON41441915670.0
Suva_10.1698.258ON43843815290.0
KAFR0B027008.258ON42042215240.0
YLR085C (ARP6)8.258ON43843815240.0
Skud_12.1538.258ON43843815230.0
NCAS0B049908.258ON42042115080.0
Smik_12.1448.258ON43843815070.0
Ecym_43128.258ON41141914800.0
TDEL0F038508.258ON41942014660.0
AGR091W8.258ON41041614630.0
Kpol_543.368.258ON42742714530.0
CAGL0L12166g8.258ON42141914320.0
KLLA0F19063g8.258ON41542414290.0
TBLA0H014608.258ON44244214230.0
NDAI0B019608.258ON43943914220.0
KNAG0G020108.258ON42442213860.0
TPHA0A018308.258ON42142413780.0
NCAS0C037008.23ON3754232701e-25
NDAI0G030408.23ON3754232701e-25
ZYRO0F02772g8.23ON3754222702e-25
TBLA0C004408.23ON3754232692e-25
TPHA0D002508.23ON3754232683e-25
KNAG0L002508.23ON3754232674e-25
KAFR0D009408.23ON3754232674e-25
TDEL0C004708.23ON3754232658e-25
CAGL0K12694g8.23ON3754232658e-25
Suva_6.188.23ON3754232658e-25
Smik_6.398.23ON3754232658e-25
YFL039C (ACT1)8.23ON3754232658e-25
KLLA0D05357g8.23ON3754232648e-25
Kpol_1058.158.23ON3754232641e-24
Ecym_15208.23ON3764232631e-24
SAKL0B00968g8.23ON3754232612e-24
ABR222W8.23ON3764232613e-24
KLTH0G18832g8.23ON3754232551e-23
TBLA0F008703.161ON3913892481e-22
Skud_6.318.23ON3603772401e-21
NDAI0G029003.161ON3913782393e-21
ZYRO0B04928g3.161ON3913862393e-21
CAGL0K01595g3.161ON3913822375e-21
Kwal_14.11098.23ON3603772322e-20
KLLA0E22925g2.117ON3804192312e-20
TDEL0D046103.161ON3913782303e-20
KNAG0K01130na 1ON3933842295e-20
Kpol_479.253.161ON3913822286e-20
NCAS0C035503.161ON3923782287e-20
KLTH0F06490g3.161ON3913792261e-19
Ecym_52373.161ON3913772252e-19
KLLA0C03850g3.161ON3913822234e-19
Smik_4.2063.161ON3913822234e-19
YDL029W (ARP2)3.161ON3913822234e-19
TPHA0A009203.161ON3913782216e-19
Suva_4.2203.161ON3913822208e-19
SAKL0C07370g3.161ON3913822191e-18
Skud_4.2223.161ON3913722172e-18
ADR316W3.161ON3913842172e-18
AFR051W2.117ON4053652092e-17
Ecym_63852.117ON3774242083e-17
KAFR0C01040na 1ON3373282055e-17
Kwal_33.141773.161ON3373282021e-16
ZYRO0G05676g2.117ON3813722003e-16
SAKL0E11814g2.117ON3793651994e-16
NDAI0B044602.117ON3813731968e-16
Kpol_1023.188.23ON3193381931e-15
NCAS0B071302.117ON3813681862e-14
TPHA0I013002.117ON3793761819e-14
TBLA0B010702.117ON3833891782e-13
KNAG0I018602.248ON7531701802e-13
Kwal_33.146422.117ON3834241746e-13
KAFR0F005902.117ON3863861711e-12
KLTH0B05940g2.117ON3834241702e-12
CAGL0H09042g2.117ON3873881684e-12
ADL253C2.248ON7511651686e-12
SAKL0E08602g2.248ON7471701686e-12
TDEL0B048102.117ON3734171657e-12
YHR129C (ARP1)2.117ON3843701641e-11
Skud_8.1902.117ON3843811641e-11
Suva_15.3262.117ON3843711613e-11
TDEL0C041402.248ON7491621633e-11
Kpol_1003.162.248ON7491461624e-11
Kwal_23.48482.248ON7451661607e-11
KLTH0G09482g2.248ON7451661599e-11
NDAI0D010602.248ON7531651571e-10
Smik_8.2102.117ON3843711551e-10
ZYRO0G01936g1.514ON4613221524e-10
KNAG0H036502.117ON3874281514e-10
TPHA0C031602.248ON7551651518e-10
YNL059C (ARP5)2.248ON7551651519e-10
Ecym_32852.248ON7461431491e-09
Suva_14.2812.248ON7551671491e-09
KLLA0F03421g2.248ON7471641473e-09
KLLA0B13904g1.514ON4562531453e-09
TBLA0D036801.514ON4582031453e-09
Smik_14.2672.248ON7551661454e-09
TPHA0O010401.514ON4582571444e-09
SAKL0D12804g1.514ON4561911435e-09
KNAG0B001701.514ON4531911435e-09
CAGL0F00517g1.514ON4541841436e-09
CAGL0J10054g2.248ON7541651436e-09
TDEL0F004701.514ON4611861427e-09
KAFR0D037001.514ON4491911411e-08
Ecym_31531.514ON4581861411e-08
Smik_10.3551.514ON4491931401e-08
Suva_12.1541.514ON4491931401e-08
Kpol_1056.161.514ON4601911401e-08
ZYRO0A01584g2.248ON7481671402e-08
NDAI0A039701.514ON4621861392e-08
Skud_10.2891.514ON4491931382e-08
NCAS0A122701.514ON4541861382e-08
YJR065C (ARP3)1.514ON4491931373e-08
AFR419C1.514ON4551861363e-08
Kwal_27.99581.514ON4451861364e-08
Skud_14.2722.248ON7551661374e-08
TBLA0E038602.248ON7591621356e-08
KAFR0J011602.248ON7511651356e-08
KLTH0C02508g1.514ON4511911347e-08
YJL081C (ARP4)1.287ON4892211312e-07
Smik_10.1611.287ON4892211312e-07
CAGL0M03201g1.287ON4932361284e-07
Suva_6.1541.287ON4892211284e-07
KNAG0B019201.287ON5052391266e-07
Kpol_282.41.287ON5012061268e-07
Skud_10.1321.287ON4882211268e-07
NDAI0G055801.287ON5152301231e-06
KLLA0D02288g1.287ON5202211178e-06
ZYRO0G21428g1.287ON4832321179e-06
Kwal_14.23771.287ON4812231179e-06
AFR105C1.287ON4792231161e-05
KLTH0H09702g1.287ON4812271133e-05
KAFR0A015601.287ON4852221123e-05
SAKL0D05874g1.287ON4972401123e-05
Ecym_63301.287ON4801061114e-05
TBLA0D053601.287ON5961581098e-05
NCAS0B060601.287ON4972321099e-05
NCAS0G030502.248ON7431511099e-05
TPHA0I010301.287ON5031071081e-04
TDEL0D015501.287ON4801131062e-04
SAKL0F13772g7.448ON422339980.002
Kwal_27.105527.448ON351208920.007
Kpol_520.117.448ON488202850.062
KLTH0C05324g7.448ON399210830.11
NCAS0A147207.448ON485176800.23
ACR184C7.448ON40185770.61
TBLA0F004507.448ON482101760.79
Ecym_35058.251ON305105712.6
AGL029W8.63ON344101713.1
NDAI0A002001.11ON33033695.2
KAFR0D010308.50ON73025695.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23832
         (419 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   876   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   759   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   624   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   608   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   593   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   591   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   591   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   591   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   585   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   585   0.0  
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   574   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   569   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   568   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   564   0.0  
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   556   0.0  
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   555   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   552   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   552   0.0  
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   538   0.0  
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   535   0.0  
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   108   1e-25
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   108   1e-25
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   108   2e-25
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   108   2e-25
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   107   3e-25
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   107   4e-25
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   107   4e-25
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   106   8e-25
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   106   8e-25
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   106   8e-25
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   106   8e-25
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   106   8e-25
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...   106   8e-25
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   106   1e-24
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...   105   1e-24
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   105   2e-24
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   105   3e-24
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...   102   1e-23
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...   100   1e-22
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    97   1e-21
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    97   3e-21
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    97   3e-21
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    96   5e-21
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    94   2e-20
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    94   2e-20
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    93   3e-20
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    93   5e-20
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    92   6e-20
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    92   7e-20
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    92   1e-19
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    91   2e-19
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    91   4e-19
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    91   4e-19
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    91   4e-19
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    90   6e-19
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    89   8e-19
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    89   1e-18
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    88   2e-18
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    88   2e-18
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    85   2e-17
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    85   3e-17
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    84   5e-17
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    82   1e-16
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    82   3e-16
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    81   4e-16
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    80   8e-16
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    79   1e-15
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    76   2e-14
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    74   9e-14
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    73   2e-13
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    74   2e-13
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    72   6e-13
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    70   1e-12
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    70   2e-12
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    69   4e-12
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    69   6e-12
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    69   6e-12
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    68   7e-12
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    68   1e-11
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    68   1e-11
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    67   3e-11
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    67   3e-11
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    67   4e-11
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    66   7e-11
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    66   9e-11
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    65   1e-10
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    64   1e-10
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    63   4e-10
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    63   4e-10
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    63   8e-10
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    63   9e-10
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    62   1e-09
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    62   1e-09
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    61   3e-09
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    60   3e-09
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    60   3e-09
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    60   4e-09
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    60   4e-09
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    60   5e-09
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    60   5e-09
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    60   6e-09
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    60   6e-09
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    59   7e-09
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    59   1e-08
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    59   1e-08
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    59   1e-08
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    59   1e-08
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    59   1e-08
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    59   2e-08
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     58   2e-08
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    58   2e-08
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    58   2e-08
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    57   3e-08
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    57   3e-08
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    57   4e-08
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    57   4e-08
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    57   6e-08
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    57   6e-08
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    56   7e-08
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    55   2e-07
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    55   2e-07
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    54   4e-07
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    54   4e-07
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    53   6e-07
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    53   8e-07
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    53   8e-07
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    52   1e-06
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    50   8e-06
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    50   9e-06
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    50   9e-06
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    49   1e-05
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    48   3e-05
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    48   3e-05
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    48   3e-05
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    47   4e-05
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    47   8e-05
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    47   9e-05
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    47   9e-05
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    46   1e-04
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    45   2e-04
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    42   0.002
Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {...    40   0.007
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    37   0.062
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    37   0.11 
NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON} Anc_7...    35   0.23 
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    34   0.61 
TBLA0F00450 Chr6 (119190..120638) [1449 bp, 482 aa] {ON} Anc_7.4...    34   0.79 
Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON} ...    32   2.6  
AGL029W Chr7 (654197..655231) [1035 bp, 344 aa] {ON} Syntenic ho...    32   3.1  
NDAI0A00200 Chr1 (19148..20140) [993 bp, 330 aa] {ON} Anc_1.11         31   5.2  
KAFR0D01030 Chr4 (212780..212792,212864..215043) [2193 bp, 730 a...    31   5.5  

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  876 bits (2263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/419 (100%), Positives = 419/419 (100%)

Query: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60
           MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP
Sbjct: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60

Query: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120
           HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF
Sbjct: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120

Query: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFN 180
           EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFN
Sbjct: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFN 180

Query: 181 CSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMS 240
           CSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMS
Sbjct: 181 CSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMS 240

Query: 241 PNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETFFH 300
           PNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETFFH
Sbjct: 241 PNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETFFH 300

Query: 301 PEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT 360
           PEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT
Sbjct: 301 PEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT 360

Query: 361 DWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL 419
           DWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL
Sbjct: 361 DWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL 419

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/420 (83%), Positives = 391/420 (93%), Gaps = 1/420 (0%)

Query: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60
           MEE+P++IDNGSYEIKFG+ S  EP  ALNSIAKDKYGNYHLSNQVRSIKDISSV FNRP
Sbjct: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60

Query: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120
           H+LGQLVSWELE+QIWDYCLFNPD+F+GWS+DTTK KHLI SESCMT+PELSKNMDQVVF
Sbjct: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120

Query: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESE-VAPAKNYNDFQLVIDSGF 179
           EEYE++++FKAPVPVFVPFN    +TH+LVAKED++V  S+  +  K+Y D++LVIDSGF
Sbjct: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGF 180

Query: 180 NCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFM 239
           NC+W+VPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKE CLFM
Sbjct: 181 NCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFM 240

Query: 240 SPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETFF 299
           SPN+YF+SFQSR KTAKEYVLPDF+TSFQGYLRKPGQ LP +SQTI+LQDELFAVPETFF
Sbjct: 241 SPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPETFF 300

Query: 300 HPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCP 359
           HPEIASLLN GI+E ILESISMLPEA+RPL+VGN+V+TGGNFNIPNFASRLATELQRQCP
Sbjct: 301 HPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIPNFASRLATELQRQCP 360

Query: 360 TDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL 419
           TDWSCRVS+P GDA LYGWKCMQKFSET+ Y ESRV+R+EYYEHGVDWCT+KRFGYQAWL
Sbjct: 361 TDWSCRVSVPTGDARLYGWKCMQKFSETQAYRESRVSREEYYEHGVDWCTSKRFGYQAWL 420

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/420 (69%), Positives = 339/420 (80%), Gaps = 2/420 (0%)

Query: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60
           M+++P+IIDNGSYE+KFG  +   P RALN++A+DKYGN HLSNQV  +KDIS+V F RP
Sbjct: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60

Query: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120
           HELGQL SWEL++ IWDYCL+NPD+FN W I  TKGKHL+ SE CM++PELSK  DQVVF
Sbjct: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119

Query: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFN 180
           EEYEF + FK PV  FVPFN      +M+ AKEDS   +        YNDFQLVIDSGFN
Sbjct: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFN 179

Query: 181 CSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMS 240
           C+W+VP++KG+PYYKA+KKLDIGGRFLNGFL+E LSFRHYNVMDETILVN+IKE CLFMS
Sbjct: 180 CTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMS 239

Query: 241 PNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETFFH 300
           P +YF SFQ +  T  EYVLPDF TSFQGY+++  Q +P +SQTI L DELF++PETFFH
Sbjct: 240 PVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFFH 299

Query: 301 PEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT 360
           PEIASLL  GIVETILESISMLPEAIRPLMV N V+TGGNFNI NFA RLATELQRQCPT
Sbjct: 300 PEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPT 359

Query: 361 DWSCRVSLPKG-DAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL 419
           DW   VS+P   D  L+GW  M++FS+T  Y ++RVTR+EYYEHGVDWCT +RFGYQ WL
Sbjct: 360 DWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQKWL 419

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/419 (66%), Positives = 340/419 (81%), Gaps = 5/419 (1%)

Query: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60
           ME  P+++DNGSYEIKFG+   + PHRA N++A+DK+G+Y+LSNQ+++IKDISSVVF RP
Sbjct: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60

Query: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120
           HE GQL SWELE+ IWDYC FNPD+FNG+ +  +KG+HL+ SE+CMTIPELSKNMDQVVF
Sbjct: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120

Query: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFN 180
           EEYEF +MFK+P+  F PF  G+ S  +    +D    ++E      Y  FQLVID GFN
Sbjct: 121 EEYEFASMFKSPIAGFAPF--GRPSIAISGKGDDQPNRKAE---PDAYEPFQLVIDVGFN 175

Query: 181 CSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMS 240
           C+W+VPVIKG+PYYKAVKKLDIGGRFLNG L+E LSFRHYNVMDETILVN+IKENCLF+S
Sbjct: 176 CTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVS 235

Query: 241 PNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETFFH 300
           P +YFESF+ + +TA EYVLPDF TSF GY++ P + LP +SQT+ L+DELF+VPETFFH
Sbjct: 236 PVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFH 295

Query: 301 PEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT 360
           PEI  LL  GI+ETILES+S+LPE +RPLM+GNIV TGGNFN+PNFA+RLATELQRQ PT
Sbjct: 296 PEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPT 355

Query: 361 DWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL 419
           DW+C V LP G   LYGW  M  F+ +  Y ++RVTR+EY+EHGVDWCT  RFGYQ W+
Sbjct: 356 DWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNWM 414

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/438 (61%), Positives = 339/438 (77%), Gaps = 19/438 (4%)

Query: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60
           ME  P++IDNGSYEIKFG  + K P RALN++AKDK+G  +LSN +++IKDISSV F RP
Sbjct: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120
           HELGQL  WELE+ IWDYCLFNP +F+G+ +   KG HL+ SESCMT+PELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEES----------------EVAP 164
           EEYEF+++FK+PV VFVPF    K     ++ +D + + +                E   
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180

Query: 165 AKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMD 224
             +Y+DFQLVIDSGF+C+WI+PV+KG+PYYKAVKKLDIGGRFL G L+E LSFRHYN+MD
Sbjct: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQ---VLPAE 281
           ETILVN+IKE CLF+SP +YF+SF+S++K   EYVLPDF TSF GY+R P +    LP +
Sbjct: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
           +Q+I L DELF +PETFFHPEI+ ++  GIVE ILES+SMLPE +RPLM+GNIV TGGNF
Sbjct: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
           N+PNFA RLA ELQRQ PTDW+C VS+P+GD  L+GW+ M +F++TE Y  +RVTR+EYY
Sbjct: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY 420

Query: 402 EHGVDWCTAKRFGYQAWL 419
           EHG DWCT  RFGYQ W+
Sbjct: 421 EHGPDWCTKHRFGYQNWI 438

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/422 (64%), Positives = 341/422 (80%), Gaps = 5/422 (1%)

Query: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60
           MEE+P++IDNGSY +KFG  S + P+ ALN+IA DKY   +LSNQ++SIKDISSV   RP
Sbjct: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRP 60

Query: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120
           H LGQL SWE++T IWDYCL+NPD+FNG++I  TK KHLITSE+CMT+PEL KNMDQV+F
Sbjct: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120

Query: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFN 180
           EEYEF ++ K+PV  ++PF    K   +++ + D+E    E    + Y DFQLV+DSGFN
Sbjct: 121 EEYEFGSLMKSPVAGYMPFLRNTKD-QIIIGERDTE-PFVETPSTEEYRDFQLVVDSGFN 178

Query: 181 CSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMS 240
           C+WI+PVIKG+PYYKAVKKLDIGGRFLNG L+E LSFRHYNVMDETILVN+IKE CLF+S
Sbjct: 179 CTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVS 238

Query: 241 PNAYFESFQSRSKTAKEYVLPDFNTSFQGYLR---KPGQVLPAESQTIVLQDELFAVPET 297
           P +YF+SF+++  T++EYVLPDF TSF GY+R   + G+ LP +SQ+I L+DELFAVPET
Sbjct: 239 PASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPET 298

Query: 298 FFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQ 357
           FFHPEI+ +L  G+VETILES+SM+PE IRPLMV NI+  GGNFN+P+FASR+A ELQRQ
Sbjct: 299 FFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQ 358

Query: 358 CPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQA 417
            PTDW CR+++ KG++ L GWK M  F+ T+ Y  +RVTR+EYYEHG+DWCT  RFGYQ 
Sbjct: 359 LPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQN 418

Query: 418 WL 419
           W+
Sbjct: 419 WV 420

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/438 (61%), Positives = 340/438 (77%), Gaps = 19/438 (4%)

Query: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60
           ME  P++IDNGSYEIKFG  + K+P RALN++AKDK+G  +LSN +++IKDISS+ F RP
Sbjct: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120
           HELGQL  WELE+ IWDYCLFNP +F+G+ +   KG HL+ SESCMT+PELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVE----------------ESEVAP 164
           EEYEF+++FK+PV VFVPF    K     ++ +D +++                ++    
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDS 180

Query: 165 AKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMD 224
             +Y+DFQLVIDSGFNC+WI+PV+KG+PYYKAVKKLDIGGRFL G L+E LSFRHYN+MD
Sbjct: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQ---VLPAE 281
           ETILVN+IKE CLF+SP +YF+SF+++ K A EYVLPDF TSF GY+R P +    LP +
Sbjct: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
           +Q I L DELF +PETFFHPEI+ +   GIVE ILES+SMLPE +RPLMVGNIV TGGNF
Sbjct: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
           N+PNFA RLA ELQRQ PTDW+C VS+P+GD  L+GW+ M +F++T+ Y ++RVTR+EYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYY 420

Query: 402 EHGVDWCTAKRFGYQAWL 419
           EHG DWCT  RFGYQ W+
Sbjct: 421 EHGPDWCTKHRFGYQNWI 438

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/438 (62%), Positives = 336/438 (76%), Gaps = 19/438 (4%)

Query: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60
           ME SP++IDNGSYEIKF   + + P RALN++AKDK+G  +LSN +++IKDISS+ F RP
Sbjct: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120
           HELGQL  WELE+ IWDYC FNP +F G+ +   KG HL+ SESCMT+PELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVE------------ESEVAPAKN- 167
           EEYEF+++FK+PV VFVPF    K     ++ +D E +              E   A+N 
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180

Query: 168 ---YNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMD 224
              Y+DFQLVIDSGFNC+WI+PV+KG+PYYKAVKKLDIGGRFL G L+E LSFRHYN+MD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQ---VLPAE 281
           ETILVN++KE CLF+SP +YF+SF+++ K A EYVLPDF TSF GY+R P +    LP +
Sbjct: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
           +QTI L DELF +PETFFHPEI+ +   GIVE ILES+SMLPE +RPLMVGNIV TGGNF
Sbjct: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
           N+PNFA RLA ELQRQ PTDW+C VS+P GD  L+GW+ M +F++TE Y  +RVTR EYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY 420

Query: 402 EHGVDWCTAKRFGYQAWL 419
           EHG DWCT +RFGYQ W+
Sbjct: 421 EHGPDWCTKQRFGYQNWI 438

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/421 (63%), Positives = 338/421 (80%), Gaps = 3/421 (0%)

Query: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60
           ME SP+ IDNGSYEIKFG+     P+RA+N+ A DKY   +LSNQ+++IKDI+SV F RP
Sbjct: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60

Query: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120
           HELGQL SWELE+ IWDY LFNPD+F G+ ++  KGKHLI SE+CMT+PELSKNMDQVVF
Sbjct: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAK--EDSEVEESEVAPAKNYNDFQLVIDSG 178
           EEYEF++ +K+ +  F+ F    K+T ++  K  ED  ++       K YND+QLVIDSG
Sbjct: 121 EEYEFDSYYKSSIAGFIQF-ADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSG 179

Query: 179 FNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLF 238
           FNC+WI+PVIKGVPYYKAVKKLDIGGRFL+G L+E LSFRHY+VMDETILVN+IKENCLF
Sbjct: 180 FNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLF 239

Query: 239 MSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETF 298
           +SP +YF+SF+++++TA EYVLP+F T+F G++R   + LP  +QTI L DELF+VPETF
Sbjct: 240 VSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETF 299

Query: 299 FHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQC 358
           FHPEIA +L  G+VETILES+SM+PE +RPL+VGN+V TGGNFN+P+FA+RL +ELQRQ 
Sbjct: 300 FHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQL 359

Query: 359 PTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAW 418
           PTDW CR S+P  +  L+GWK M +F+ TE Y ++RVTR+EYYEHG DW T  RFGYQ W
Sbjct: 360 PTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQNW 419

Query: 419 L 419
           +
Sbjct: 420 I 420

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/438 (62%), Positives = 336/438 (76%), Gaps = 19/438 (4%)

Query: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60
           ME +P++IDNGSYEIKFG  + ++P RALN++AKDK+G  +LSN +++IKDISSV F RP
Sbjct: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120
           HELGQL  WELE+ IWDYC FNP +F+G+ +   KG HL+ SESCMT+PELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSE----VEESEVA--PAKN------- 167
           EEYEF+++FK+PV  FVPF    KS    ++ +D +    V +S  A  P+ N       
Sbjct: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180

Query: 168 ---YNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMD 224
              Y+DFQLVIDSGFNC+WI+PV+KG+PYYKAVKKLD+GGRFL G L+E LSFRHYN+MD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLR---KPGQVLPAE 281
           ETILVN+IKE CLF+SP +YF+SF+ + K A EYVLPDF TSF GY+R   K    L  +
Sbjct: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
           +QTI L DELF +PETFFHPEIA +   GIVE ILES+SMLPE +RPLMVGNIV TGGNF
Sbjct: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
           N+PNFA RLA ELQRQ PTDW+C VS+P+ D  L+GW+ M +FS T  Y  +RVTR+EYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY 420

Query: 402 EHGVDWCTAKRFGYQAWL 419
           EHG DWCT  RFGYQ W+
Sbjct: 421 EHGSDWCTKHRFGYQNWI 438

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/419 (63%), Positives = 325/419 (77%), Gaps = 15/419 (3%)

Query: 5   PLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRPHELG 64
           P+IIDNGSYEIKFG  S K P+RALN +A+DKYG YHLSNQ++ I+++S+    RP ELG
Sbjct: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELG 63

Query: 65  QLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVFEEYE 124
           QLVSWELE  IWDYCLFN D+F+ W +  +K   LI SE+CM+IPE+SK+MDQVVFEEYE
Sbjct: 64  QLVSWELEEHIWDYCLFNSDEFS-WDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYE 122

Query: 125 FETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPA----KNYNDFQLVIDSGFN 180
           F ++ K PV  ++PF+             D +V  S+  P      +YNDFQLV+DSGFN
Sbjct: 123 FGSLMKCPVAQYIPFDN----------MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFN 172

Query: 181 CSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMS 240
           C+W++PVIKGVPYYKAVKKLDIGGRFL G L+E +SFRHYN+MDETIL N+IKE C FM 
Sbjct: 173 CTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMP 232

Query: 241 PNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETFFH 300
           P +YF+SFQ +++T  +YVLPDF TS  GY+R+P Q +P +SQT+ L+DELF +PETFFH
Sbjct: 233 PVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFH 292

Query: 301 PEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT 360
           PEIA++L  G++ET+LESISMLPE IRPLMV NI + GGNFNI NFASRLATELQRQCPT
Sbjct: 293 PEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPT 352

Query: 361 DWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL 419
           DWS RV LPKGD  L GWK M +FS T+ Y + RVTR EY EHGVDWCT  RFGY+ W+
Sbjct: 353 DWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/420 (61%), Positives = 332/420 (79%), Gaps = 2/420 (0%)

Query: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60
           ME  PL++DNGSYE+KFG  +  +P RALN++A+DK+G  +LSNQ+  IKDISSV F RP
Sbjct: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60

Query: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120
           HE GQL SWEL++ +WDYC FNP++F+G+ +  +KG+HLI SE+CMT+PELSKNMDQVVF
Sbjct: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFN 180
           EEYEF+++ KAP+  F+PF+   ++T ++  K DSE   S  +  K+Y  FQ+VIDSGFN
Sbjct: 121 EEYEFDSLLKAPISGFMPFSKHTENTKVISGKGDSESGTS-TSETKDYEPFQMVIDSGFN 179

Query: 181 CSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMS 240
           C+W+VP+IKGVP+YKAVKKLD+GGRF+NG L+E LSFRHYNVMDETILVN+IKE CLFMS
Sbjct: 180 CTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMS 239

Query: 241 PNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETFFH 300
           P +YF+SF  + +TA EYVLPDF T+F GY+         ++QT+ L+DELF+VPETFFH
Sbjct: 240 PVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFH 299

Query: 301 PEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT 360
           PEIA LL  GI+ETILES+S++PE +RPLMV NI+ TGGNFN+P+F  RLATELQRQ PT
Sbjct: 300 PEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPT 359

Query: 361 DWSCRVSLPKGDAG-LYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL 419
           DWS ++ LP+  +  L GW  M  F+ T+ Y  +RV+RQEYYEHGV+W T  RFGYQ W+
Sbjct: 360 DWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQNWI 419

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/416 (63%), Positives = 320/416 (76%), Gaps = 10/416 (2%)

Query: 5   PLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRPHELG 64
           PL+++NGSYEIKFG  + + P+RA N + +D+YG YHLSNQ+  I+DIS     RP ELG
Sbjct: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELG 63

Query: 65  QLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVFEEYE 124
           QL+SWELE QIWDYCLFNPD+F GW +  +K   LI SE+CMTIPE+SKNMDQVVFEEYE
Sbjct: 64  QLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122

Query: 125 FETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKN-YNDFQLVIDSGFNCSW 183
           F +M K PV  FVPF+  +    +  A         EV  AK+ YN+FQLV+DSGFNC+W
Sbjct: 123 FGSMMKCPVAQFVPFDRARDYDIVGGA--------GEVVEAKSGYNNFQLVVDSGFNCTW 174

Query: 184 IVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMSPNA 243
           ++PVIKGVPYYKA KKLDIGGRFLNG L+E +SFRHYNVMDETIL+N+IKE C FM P +
Sbjct: 175 VMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVS 234

Query: 244 YFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETFFHPEI 303
           YF+SFQ + +T  EY+LPDF TS  GY+R+P Q +P  SQ + L+DELF VPETFFHPEI
Sbjct: 235 YFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEI 294

Query: 304 ASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWS 363
           +++L  G+VETILE +SM+PE +RPL+V NIV  GGNFNI NFA+RLATELQRQCPTDW 
Sbjct: 295 SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWK 354

Query: 364 CRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL 419
            RV  PK DA L GWK M++FS+T+ Y  SRVTR EY EHG DWCT  RFGY+ W+
Sbjct: 355 VRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/427 (61%), Positives = 331/427 (77%), Gaps = 8/427 (1%)

Query: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60
           ME++P++IDNGSYE+KFG    K P+RALN++AKDKYG ++LSNQ+ +IKDISSV   RP
Sbjct: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60

Query: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120
           HELGQLVSWELE  +WDYC FNPD+F  +++  TKG HL+ SE+CMT+PELS NMDQV+F
Sbjct: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120

Query: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSE----VEESEVAPAKN-YNDFQLVI 175
           EEYEFE++FK+PV  FVPF   + +  M+  K D      +   +    KN Y+DF LVI
Sbjct: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVI 180

Query: 176 DSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEN 235
           DSGFNC+WI+P+IKGVPYYKAVKK+++GGRFLNG  +E +S+RHY+V DETILVN+IKE 
Sbjct: 181 DSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEK 240

Query: 236 CLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYL--RKPGQVLPAESQTIVLQDELFA 293
           CLFMSP +Y +SF+++ + + +YVLPDF TSF GY+  +K    LP  SQ I L DELF+
Sbjct: 241 CLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFS 300

Query: 294 VPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATE 353
           VPET FHPE+A LL  GIVETILES+S++PE IRPL+V NIV  GGNFN+PNF SRLATE
Sbjct: 301 VPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATE 360

Query: 354 LQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETED-YHESRVTRQEYYEHGVDWCTAKR 412
           LQRQ PTDW C + +P+ D  L GWK M +F++  D Y ++R++R+EYYEHG DW T KR
Sbjct: 361 LQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKR 420

Query: 413 FGYQAWL 419
           FGYQ W+
Sbjct: 421 FGYQNWI 427

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/419 (59%), Positives = 322/419 (76%), Gaps = 3/419 (0%)

Query: 3   ESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRPHE 62
           +  ++IDNGSY++KFG  SE  P  ALN++AKDKYG  HLSNQV++IKDISSVVF RPHE
Sbjct: 4   DQAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHE 63

Query: 63  LGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVFEE 122
           LGQL SWELE+ IWDYCL+NPD+F G    + + +H++ SE+CMT+PELSKN DQV+FEE
Sbjct: 64  LGQLTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEE 122

Query: 123 YEFETMFKAPVPVFVPFNTGKKSTHMLVAKED-SEVE-ESEVAPAKNYNDFQLVIDSGFN 180
           YE ++++KAP   ++PF T  ++   +  K D  E++ E ++   K YNDF LVIDSGFN
Sbjct: 123 YEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSGFN 182

Query: 181 CSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMS 240
           C+W++P++KGVPYYKAVKKLD+GGRFLNG L+E +SFRHYNVMDE+ILVN+IKE CL++ 
Sbjct: 183 CTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYVD 242

Query: 241 PNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETFFH 300
           P +YFE+F+++ K   ++VLPDF TSFQGY+R P   LP  +Q + L DE F+VPE FFH
Sbjct: 243 PVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFFH 302

Query: 301 PEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT 360
           PEI+  L  GI+ET+LESI MLPE +RPLM  NIV  GGNFN+P F  RL +ELQRQ PT
Sbjct: 303 PEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPT 362

Query: 361 DWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL 419
           DW CR  +  GD  L GW  M KF+ T+ Y ++RVT+++Y+EHG+DW T +RFGYQ W+
Sbjct: 363 DWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNWV 421

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/424 (60%), Positives = 321/424 (75%), Gaps = 14/424 (3%)

Query: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60
           M E  L+IDNGSYEIKFG     +P RALN + KDKY  +HLSNQ + ++DIS  +  RP
Sbjct: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60

Query: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSI---DTTKGKHLITSESCMTIPELSKNMDQ 117
           HELGQLVSWELE+++WDYC +N DDF+ W++   + TK  HL+ SE+ MTIPELSKNMDQ
Sbjct: 61  HELGQLVSWELESEVWDYCFYNEDDFH-WNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119

Query: 118 VVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDS 177
           V+FEEY+F++MFK PV  ++PF  G+     + A ED +          +Y DFQLVIDS
Sbjct: 120 VIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKK--------TSSYKDFQLVIDS 171

Query: 178 GFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCL 237
           GFNC+W VP+IKGVPYYKA+KKLDIGGRFL G L+E +SFRHYNVM+ETILVN+IKE C 
Sbjct: 172 GFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCT 231

Query: 238 FMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPG-QVLPAESQTIVLQDELFAVPE 296
           F+ P +YF SF ++  T  EYVLPDF TSF GY++KPG + L  ++QT++L DE+F+VPE
Sbjct: 232 FVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKLTDDAQTLLLTDEVFSVPE 291

Query: 297 TFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQR 356
           TFFHPEIA +L  GIVETILE I+M PE +RPL+V NIV TGGNFNIPNF  RL TELQR
Sbjct: 292 TFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQR 351

Query: 357 QCPTDWSCRVSLPK-GDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGY 415
           QCP DWSC+V  P+  D  L+GW+ M+ F+ ++ +  +RVTR+EY EHG+DWCT  RFGY
Sbjct: 352 QCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGY 411

Query: 416 QAWL 419
           Q WL
Sbjct: 412 QQWL 415

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/442 (56%), Positives = 331/442 (74%), Gaps = 23/442 (5%)

Query: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60
           M++ P++IDNGSYEIKFG  + + P RA+N+IAKDKY   +LSNQ++ IKDISSV F RP
Sbjct: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60

Query: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120
           +ELGQL SWELE+ IWDYC +NP++F+G+ ++ T  KHL+ SE+C+++PE S+N+D ++F
Sbjct: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120

Query: 121 EEYEFETMFKAPVPVFVPF--------------------NTGKKSTHMLVAKEDSEV--E 158
           EEY + +++K+PV  F+PF                    N  K    ++    ++ +  E
Sbjct: 121 EEYNYGSIYKSPVAGFIPFADLTKDVISISGKADDDDDDNNAKFQEQLVTNDLNTYISSE 180

Query: 159 ESEVAPAKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFR 218
           E  V     Y DFQL+IDSGFNC+WI+PVIKG+PYYKA+KK+DIGGRFL G L+E LSFR
Sbjct: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240

Query: 219 HYNVMDETILVNSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQV- 277
           HYNV DETILVN+IKE CLF++P +Y ESF+ ++KTA EYVLPDF+T+F GY++   +  
Sbjct: 241 HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTK 300

Query: 278 LPAESQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVIT 337
           LP  +Q I L+DELF+V ET FHPEI+ +L  GI+ETI+ES+SMLPE IRPLMV NIV  
Sbjct: 301 LPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCI 360

Query: 338 GGNFNIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTR 397
           GGNFN+PNF+ RL +ELQRQ PTDW+  V +PK DA L+GWK M +FS+T+ Y ++R+TR
Sbjct: 361 GGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITR 420

Query: 398 QEYYEHGVDWCTAKRFGYQAWL 419
           +EY EHGV+WCT  RFGYQ W+
Sbjct: 421 EEYMEHGVEWCTKHRFGYQNWI 442

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/439 (56%), Positives = 340/439 (77%), Gaps = 20/439 (4%)

Query: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60
           M+ +PL++DNGSYEIKFG  + + P+RALN  A DKYG+ +LSNQ++ I+++S V   RP
Sbjct: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60

Query: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120
           HELGQL SWELE+ IWDYCL+NPD+F+G+ +  +  KHLI SE CMT+PELSKNMDQV+F
Sbjct: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120

Query: 121 EEYEFETMFKAPVPVFVPFN-------------TGKKSTHMLVAKEDS------EVEESE 161
           EEYEF+++FKAP   ++PF              +GKK+   ++ + ++       +++ +
Sbjct: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180

Query: 162 VAPAKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYN 221
              + +Y D++LVIDSGFNC+WI+P+IKGVPYYKA+KKLDIGGRFL G L+E LSFRHY+
Sbjct: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240

Query: 222 VMDETILVNSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRK-PGQVLPA 280
           +MDET+LVN+IKE CLF+SP +YF+SF+++ +T+ EY+LPD ++S+ GY R+   + LP 
Sbjct: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPE 300

Query: 281 ESQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGN 340
            SQ + L DELF+VPETFFHPEI+ +L  GIVETILES+SM+PE +RPL+V NIV TGGN
Sbjct: 301 GSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360

Query: 341 FNIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEY 400
           FN+P+FA+RLA ELQRQ PTDW+CR+S+PK +  L+ WK M +F+ T+ Y ++R++++EY
Sbjct: 361 FNLPHFAARLAAELQRQLPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEY 420

Query: 401 YEHGVDWCTAKRFGYQAWL 419
           YEHG DW T  +FGYQ WL
Sbjct: 421 YEHGPDWLTKHKFGYQNWL 439

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/422 (59%), Positives = 316/422 (74%), Gaps = 7/422 (1%)

Query: 5   PLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRPHELG 64
           P +IDNGSYEIKFG  +   P RA N IAKDKYG  +LSN +++I+DISS    RPHELG
Sbjct: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62

Query: 65  QLVSWELETQIWDYCLFNPDDFNGWSI-DTTKGKHLITSESCMTIPELSKNMDQVVFEEY 123
           QLVSWELE  IWDYCL+NPD+F+G+ + D T+ + LI +E+C T+PELSKN DQVVFEEY
Sbjct: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122

Query: 124 EFETMFKAPVPVFVPFNT--GKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFNC 181
           EF TMFK+P   F+PF    G K+   L  K+ +   +   A  K Y DFQLVIDSGFNC
Sbjct: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKEYRDFQLVIDSGFNC 182

Query: 182 SWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMSP 241
           +W+VP+IKGVP+YKA+KK+DIGGRFLNG L+E LSFRHYN+MDETIL+N+IKE CLF+SP
Sbjct: 183 TWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVSP 242

Query: 242 NAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQ---VLPAESQTIVLQDELFAVPETF 298
            +YF+SF+++ + A EYVLPDF TSF GYL        +     QTI L DE FAVPETF
Sbjct: 243 VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPETF 302

Query: 299 FHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQC 358
           FHPE+A++L  G+VETILE+ISM+PE +RP++V NIV  GGNF +P+ +SRL +ELQRQ 
Sbjct: 303 FHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQL 362

Query: 359 PTDWSCRVSLP-KGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQA 417
           PTDW+CRV++P   D  L  W  M +FS T+ Y  +RVTR+EY EHG DWC+  RF YQ 
Sbjct: 363 PTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQN 422

Query: 418 WL 419
           W+
Sbjct: 423 WI 424

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/424 (59%), Positives = 326/424 (76%), Gaps = 8/424 (1%)

Query: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60
           M E+PL+IDNGSYEIKFG  +++ P  ALN++AKDKY  Y+LSNQ+ +IKDISSV   RP
Sbjct: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60

Query: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120
           H+LGQLVSWELE +IWDYC +N DDF G+ ++     HL+ +E+ MT+PELS+N DQVVF
Sbjct: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120

Query: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHM-LVAKEDSEVEESEVAPAKNYNDFQLVIDSGF 179
           EEY F++++KAP   F+PF     ++ + L  K  + ++ S+     NY DF LVIDSG+
Sbjct: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSK---ENNYQDFNLVIDSGY 177

Query: 180 NCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFM 239
           NCSWI+P+IKGVPYYKAVKK+D+GGRFLNG L+E +S+RHY+V DE++LVN+IKENC+F+
Sbjct: 178 NCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFI 237

Query: 240 SPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLR--KPGQVLPAESQTIVLQDELFAVPET 297
           SP +Y ESF+ ++ T  EYVLPDF TSF GY+R  K    LP  SQ+I+L+DELF+VPE 
Sbjct: 238 SPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEG 297

Query: 298 FFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQ 357
           FFHPE+A++L  GI+ETILES+ +LPE++R LMV NIV TGGNFNIPNF SR+ TELQ+Q
Sbjct: 298 FFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQ 357

Query: 358 CPTDWSCRVSLPKGDAGLYGWKCMQKFSET--EDYHESRVTRQEYYEHGVDWCTAKRFGY 415
             T+W C VS+PK +A L  WK M+ F+E   E Y  +RVT+QEY EHG +W T +RFGY
Sbjct: 358 VQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGY 417

Query: 416 QAWL 419
           Q WL
Sbjct: 418 QNWL 421

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  108 bits (270), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 97/423 (22%), Positives = 176/423 (41%), Gaps = 80/423 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 60  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 150

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G     A+ ++D+ GR L  +L + LS R Y  +   
Sbjct: 151 ------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTA 204

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSFQGYLRKPGQVLPAE 281
           E  +V  IKE   +++ + + +  Q+ ++++   K Y LPD                   
Sbjct: 205 EREIVRDIKEKLCYVALD-FEQEMQTAAQSSSIEKSYELPD------------------- 244

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
            Q I + +E F  PE  FHP I SL ++GI +T   SI      +R  + GNIV++GG  
Sbjct: 245 GQVITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTT 304

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
             P  A R+  E+    P+    ++  P  +     W      +    + +  +++QEY 
Sbjct: 305 MFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYD 363

Query: 402 EHG 404
           E G
Sbjct: 364 ESG 366

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  108 bits (270), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 97/423 (22%), Positives = 176/423 (41%), Gaps = 80/423 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 60  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 150

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G     A+ ++D+ GR L  +L + LS R Y  +   
Sbjct: 151 ------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTA 204

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSFQGYLRKPGQVLPAE 281
           E  +V  IKE   +++ + + +  Q+ S+++   K Y LPD                   
Sbjct: 205 EREIVRDIKEKLCYVALD-FEQEMQTASQSSSIEKSYELPD------------------- 244

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
            Q I + +E F  PE  FHP +  L +SGI +T   SI      +R  + GNIV++GG+ 
Sbjct: 245 GQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGST 304

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
             P  A R+  E+    P+    ++  P  +     W      +    + +  +++QEY 
Sbjct: 305 MFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYD 363

Query: 402 EHG 404
           E G
Sbjct: 364 ESG 366

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  108 bits (270), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 96/422 (22%), Positives = 171/422 (40%), Gaps = 78/422 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 60  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 150

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G     A+ ++D+ GR L  +L + LS R Y  +   
Sbjct: 151 ------IVLDSGDGVTHVVPIYAGFSMPHAILRIDLAGRDLTDYLMKILSERGYSFSTTA 204

Query: 225 ETILVNSIKENCLFMSPN--AYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAES 282
           E  +V  IKE   +++ +     ++    S   K Y LPD                    
Sbjct: 205 EREIVRDIKEKLCYVALDFEQEMQTAAQSSSVEKSYELPD-------------------G 245

Query: 283 QTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFN 342
           Q I + +E F  PE  FHP + SL +SG+ +T   SI      +R  + GNIV++GG   
Sbjct: 246 QVITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSGGTTM 305

Query: 343 IPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYE 402
            P  A R+  E+    P+    ++  P  +     W      +    + +  +++QEY E
Sbjct: 306 FPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDE 364

Query: 403 HG 404
            G
Sbjct: 365 SG 366

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  108 bits (269), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 96/423 (22%), Positives = 176/423 (41%), Gaps = 80/423 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 60  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 150

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G     A+ ++D+ GR L  +L + LS R Y  +   
Sbjct: 151 ------IVLDSGDGVTHVVPIYAGFSLPHAIMRIDLAGRDLTDYLMKILSERGYSFSTTA 204

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSFQGYLRKPGQVLPAE 281
           E  +V  IKE   +++ + + +  Q+ ++++   K Y LPD                   
Sbjct: 205 EREIVRDIKEKLCYVALD-FEQEMQTAAQSSSIEKSYELPD------------------- 244

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
            Q I + +E F  PE  FHP + SL ++GI +T   SI      +R  + GNIV++GG  
Sbjct: 245 GQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTT 304

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
             P  A R+  E+    P+    ++  P  +     W      +    + +  +++QEY 
Sbjct: 305 MFPGIAERMQKEITALAPSSMEVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYD 363

Query: 402 EHG 404
           E G
Sbjct: 364 ESG 366

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  107 bits (268), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 96/423 (22%), Positives = 176/423 (41%), Gaps = 80/423 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 60  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 150

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G     A+ ++D+ GR L  +L + LS R Y  +   
Sbjct: 151 ------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTA 204

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSFQGYLRKPGQVLPAE 281
           E  +V  IKE   +++ + + +  Q+ ++++   K Y LPD                   
Sbjct: 205 EREIVRDIKEKLCYVALD-FEQEMQTAAQSSSIEKSYELPD------------------- 244

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
            Q I + +E F  PE  FHP + SL ++GI +T   SI      +R  + GNIV++GG  
Sbjct: 245 GQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSGGTT 304

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
             P  A R+  E+    P+    ++  P  +     W      +    + +  +++QEY 
Sbjct: 305 MFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYD 363

Query: 402 EHG 404
           E G
Sbjct: 364 ESG 366

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  107 bits (267), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 96/423 (22%), Positives = 175/423 (41%), Gaps = 80/423 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 60  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 150

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G     A+ ++D+ GR L  +L + LS R Y  +   
Sbjct: 151 ------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTA 204

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSFQGYLRKPGQVLPAE 281
           E  +V  IKE   +++ + + +  Q+ ++++   K Y LPD                   
Sbjct: 205 EREIVRDIKEKLCYVALD-FEQEMQTAAQSSSIEKSYELPD------------------- 244

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
            Q I + +E F  PE  FHP +  L +SGI +T   SI      +R  + GNIV++GG  
Sbjct: 245 GQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTT 304

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
             P  A R+  E+    P+    ++  P  +     W      +    + +  +++QEY 
Sbjct: 305 MFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYD 363

Query: 402 EHG 404
           E G
Sbjct: 364 ESG 366

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  107 bits (267), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 96/423 (22%), Positives = 175/423 (41%), Gaps = 80/423 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 60  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 150

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G     A+ ++D+ GR L  +L + LS R Y  +   
Sbjct: 151 ------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTA 204

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSFQGYLRKPGQVLPAE 281
           E  +V  IKE   +++ + + +  Q+ ++++   K Y LPD                   
Sbjct: 205 EREIVRDIKEKLCYVALD-FEQEMQTAAQSSSIEKSYELPD------------------- 244

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
            Q I + +E F  PE  FHP +  L +SGI +T   SI      +R  + GNIV++GG  
Sbjct: 245 GQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTT 304

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
             P  A R+  E+    P+    ++  P  +     W      +    + +  +++QEY 
Sbjct: 305 MFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYD 363

Query: 402 EHG 404
           E G
Sbjct: 364 ESG 366

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  106 bits (265), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 95/423 (22%), Positives = 175/423 (41%), Gaps = 80/423 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 60  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 150

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G     A+ ++D+ GR L  +L + LS R Y  +   
Sbjct: 151 ------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTA 204

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSFQGYLRKPGQVLPAE 281
           E  +V  IKE   +++ + + +  Q+ ++++   K Y LPD                   
Sbjct: 205 EREIVRDIKEKLCYVALD-FEQEMQTAAQSSSIEKSYELPD------------------- 244

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
            Q I + +E F  PE  FHP +  L ++GI +T   SI      +R  + GNIV++GG  
Sbjct: 245 GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTT 304

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
             P  A R+  E+    P+    ++  P  +     W      +    + +  +++QEY 
Sbjct: 305 MFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYD 363

Query: 402 EHG 404
           E G
Sbjct: 364 ESG 366

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  106 bits (265), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 95/423 (22%), Positives = 175/423 (41%), Gaps = 80/423 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 60  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 150

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G     A+ ++D+ GR L  +L + LS R Y  +   
Sbjct: 151 ------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTA 204

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSFQGYLRKPGQVLPAE 281
           E  +V  IKE   +++ + + +  Q+ ++++   K Y LPD                   
Sbjct: 205 EREIVRDIKEKLCYVALD-FEQEMQTAAQSSSIEKSYELPD------------------- 244

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
            Q I + +E F  PE  FHP +  L ++GI +T   SI      +R  + GNIV++GG  
Sbjct: 245 GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTT 304

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
             P  A R+  E+    P+    ++  P  +     W      +    + +  +++QEY 
Sbjct: 305 MFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYD 363

Query: 402 EHG 404
           E G
Sbjct: 364 ESG 366

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  106 bits (265), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 95/423 (22%), Positives = 175/423 (41%), Gaps = 80/423 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 60  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 150

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G     A+ ++D+ GR L  +L + LS R Y  +   
Sbjct: 151 ------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTA 204

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSFQGYLRKPGQVLPAE 281
           E  +V  IKE   +++ + + +  Q+ ++++   K Y LPD                   
Sbjct: 205 EREIVRDIKEKLCYVALD-FEQEMQTAAQSSSIEKSYELPD------------------- 244

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
            Q I + +E F  PE  FHP +  L ++GI +T   SI      +R  + GNIV++GG  
Sbjct: 245 GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTT 304

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
             P  A R+  E+    P+    ++  P  +     W      +    + +  +++QEY 
Sbjct: 305 MFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYD 363

Query: 402 EHG 404
           E G
Sbjct: 364 ESG 366

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  106 bits (265), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 95/423 (22%), Positives = 175/423 (41%), Gaps = 80/423 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 60  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 150

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G     A+ ++D+ GR L  +L + LS R Y  +   
Sbjct: 151 ------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTA 204

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSFQGYLRKPGQVLPAE 281
           E  +V  IKE   +++ + + +  Q+ ++++   K Y LPD                   
Sbjct: 205 EREIVRDIKEKLCYVALD-FEQEMQTAAQSSSIEKSYELPD------------------- 244

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
            Q I + +E F  PE  FHP +  L ++GI +T   SI      +R  + GNIV++GG  
Sbjct: 245 GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTT 304

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
             P  A R+  E+    P+    ++  P  +     W      +    + +  +++QEY 
Sbjct: 305 MFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYD 363

Query: 402 EHG 404
           E G
Sbjct: 364 ESG 366

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  106 bits (265), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 95/423 (22%), Positives = 175/423 (41%), Gaps = 80/423 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 60  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 150

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G     A+ ++D+ GR L  +L + LS R Y  +   
Sbjct: 151 ------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTA 204

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSFQGYLRKPGQVLPAE 281
           E  +V  IKE   +++ + + +  Q+ ++++   K Y LPD                   
Sbjct: 205 EREIVRDIKEKLCYVALD-FEQEMQTAAQSSSIEKSYELPD------------------- 244

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
            Q I + +E F  PE  FHP +  L ++GI +T   SI      +R  + GNIV++GG  
Sbjct: 245 GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTT 304

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
             P  A R+  E+    P+    ++  P  +     W      +    + +  +++QEY 
Sbjct: 305 MFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYD 363

Query: 402 EHG 404
           E G
Sbjct: 364 ESG 366

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  106 bits (264), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 95/423 (22%), Positives = 175/423 (41%), Gaps = 80/423 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 60  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 111 NPKNNREKMTQILFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 150

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G     A+ ++D+ GR +  +L + L+ R Y  +   
Sbjct: 151 ------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDITDYLMKILAERGYSFSTTA 204

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSFQGYLRKPGQVLPAE 281
           E  +V  IKE   +++ + + +  Q+ S+++   K Y LPD                   
Sbjct: 205 EREIVRDIKEKLCYVALD-FEQEMQTASQSSAVEKSYELPD------------------- 244

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
            Q I + +E F  PE  FHP + SL  +GI +T   SI      +R  + GNIV++GG  
Sbjct: 245 GQVITIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTT 304

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
             P  A R+  E+    P+    ++  P  +     W      +    + +  +++QEY 
Sbjct: 305 MFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYD 363

Query: 402 EHG 404
           E G
Sbjct: 364 ESG 366

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  106 bits (264), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 95/423 (22%), Positives = 174/423 (41%), Gaps = 80/423 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 60  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 150

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G      + ++D+ GR L  +L + LS R Y  +   
Sbjct: 151 ------IVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTA 204

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSFQGYLRKPGQVLPAE 281
           E  +V  IKE   +++ + + +  Q+ ++++   K Y LPD                   
Sbjct: 205 EREIVRDIKEKLCYVALD-FEQEMQTAAQSSSIEKSYELPD------------------- 244

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
            Q I + +E F  PE  FHP +  L +SGI +T   SI      +R  + GNIV++GG  
Sbjct: 245 GQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTT 304

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
             P  A R+  E+    P+    ++  P  +     W      +    + +  +++QEY 
Sbjct: 305 MFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYD 363

Query: 402 EHG 404
           E G
Sbjct: 364 ESG 366

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 95/423 (22%), Positives = 174/423 (41%), Gaps = 80/423 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDCY----VGDEAQ 60

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 61  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 111

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 112 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 151

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G     A+ ++D+ GR +  +L + LS R Y  +   
Sbjct: 152 ------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTA 205

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSFQGYLRKPGQVLPAE 281
           E  +V  IKE   +++ + Y +  Q+ ++++   K Y LPD                   
Sbjct: 206 EREIVRDIKEKLCYVALD-YDQEMQTAAQSSAIEKSYELPD------------------- 245

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
            Q I + +E F  PE  FHP +  L  +GI +T   SI      +R  + GNIV++GG  
Sbjct: 246 GQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTT 305

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
             P  A R+  E+    P+    ++  P  +     W      +    + +  +++QEY 
Sbjct: 306 MFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYD 364

Query: 402 EHG 404
           E G
Sbjct: 365 ESG 367

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  105 bits (261), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 94/423 (22%), Positives = 174/423 (41%), Gaps = 80/423 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 60  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 111 NPKSNREKMTQILFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 150

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G     A+ ++D+ GR +  +L + LS R Y  +   
Sbjct: 151 ------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTA 204

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSFQGYLRKPGQVLPAE 281
           E  +V  IKE   +++ + + +  Q+ ++++   K Y LPD                   
Sbjct: 205 EREIVRDIKEKLCYVALD-FEQEMQTAAQSSAIEKSYELPD------------------- 244

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
            Q I + +E F  PE  FHP +  L  +GI +T   SI      +R  + GNIV++GG  
Sbjct: 245 GQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTT 304

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
             P  A R+  E+    P+    ++  P  +     W      +    + +  +++QEY 
Sbjct: 305 MFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYD 363

Query: 402 EHG 404
           E G
Sbjct: 364 ESG 366

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  105 bits (261), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 94/423 (22%), Positives = 174/423 (41%), Gaps = 80/423 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 60

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 61  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 111

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 112 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 151

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G     A+ ++D+ GR +  +L + LS R Y  +   
Sbjct: 152 ------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTA 205

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSFQGYLRKPGQVLPAE 281
           E  +V  IKE   +++ + + +  Q+ ++++   K Y LPD                   
Sbjct: 206 EREIVRDIKEKLCYVALD-FEQEMQTAAQSSAIEKSYELPD------------------- 245

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
            Q I + +E F  PE  FHP +  L  +GI +T   SI      +R  + GNIV++GG  
Sbjct: 246 GQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTT 305

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
             P  A R+  E+    P+    ++  P  +     W      +    + +  +++QEY 
Sbjct: 306 MFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYD 364

Query: 402 EHG 404
           E G
Sbjct: 365 ESG 367

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  102 bits (255), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 93/423 (21%), Positives = 173/423 (40%), Gaps = 80/423 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 60  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 111 NPKSNREKMTQILFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 150

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G      + ++D+ GR +  +L + LS R Y  +   
Sbjct: 151 ------IVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYSFSTTA 204

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSFQGYLRKPGQVLPAE 281
           E  +V  IKE   +++ + + +  Q+ ++++   K Y LPD                   
Sbjct: 205 EREIVRDIKEKLCYVALD-FEQEMQTAAQSSAIEKSYELPD------------------- 244

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
            Q I + +E F  PE  FHP +  L  +GI +T   SI      +R  + GNIV++GG  
Sbjct: 245 GQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTT 304

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401
             P  A R+  E+    P+    ++  P  +     W      +    + +  +++QEY 
Sbjct: 305 MFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYD 363

Query: 402 EHG 404
           E G
Sbjct: 364 ESG 366

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  100 bits (248), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 102/389 (26%), Positives = 159/389 (40%), Gaps = 79/389 (20%)

Query: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRS-----IKDI------ 52
           SP+++D G+  +K G   E  P     SI     G   L  + R      +KDI      
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERGTISTPLKDIMIGDEA 60

Query: 53  ----SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTI 108
               S +  + P E G + +W     +WDY  FN        + TT G  ++ +E  M  
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MKLPTTSGGKVLLTEPPMNP 115

Query: 109 PELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNY 168
            +  + M +V+FE Y+F  ++ A   V   +  G  S                       
Sbjct: 116 VKNRERMCEVMFERYDFGGVYVAIQAVLALYAQGLSSG---------------------- 153

Query: 169 NDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 226
               +V+DSG   + IVPV + V      ++LD+ GR +   L + LS R Y  N   + 
Sbjct: 154 ----VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYSFNRTADF 209

Query: 227 ILVNSIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVLPAESQT 284
             V  IKE   ++S +   ++  +R  T   +EY LPD      G + K GQ        
Sbjct: 210 ETVRQIKEKVCYVSYDLNLDTKLARETTTLVQEYELPD------GRIIKVGQ-------- 255

Query: 285 IVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIP 344
                E F  PE  F P++  + + G+ E +  +I      +R  +   IV++GG+   P
Sbjct: 256 -----ERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYP 310

Query: 345 NFASRLATELQRQCPTDWSCRVSLPKGDA 373
              SRL  EL++     W  R+   KGDA
Sbjct: 311 GLPSRLERELKQL----WFTRIL--KGDA 333

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 97.1 bits (240), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 83/377 (22%), Positives = 160/377 (42%), Gaps = 66/377 (17%)

Query: 34  KDKYGNYHLSNQVRSIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDT 93
           KD Y    + ++ +S + I ++ +  P E G + +W+   +IW +  +N        +  
Sbjct: 35  KDSY----VGDEAQSKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRV 81

Query: 94  TKGKH-LITSESCMTIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAK 152
              +H ++ +E+ M      + M Q++FE +     + +   V   +++G+ +       
Sbjct: 82  APEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG------ 135

Query: 153 EDSEVEESEVAPAKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLR 212
                               +V+DSG   + +VP+  G     A+ ++D+ GR L  +L 
Sbjct: 136 --------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLM 175

Query: 213 EALSFRHY--NVMDETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSF 267
           + LS R Y  +   E  +V  IKE   +++ + + +  Q+ ++++   K Y LPD     
Sbjct: 176 KILSERGYSFSTTAEREIVRDIKEKLCYVALD-FEQEMQTAAQSSSIEKSYELPD----- 229

Query: 268 QGYLRKPGQVLPAESQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIR 327
                          Q I + +E F  PE  FHP +  L ++GI +T   SI      +R
Sbjct: 230 --------------GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVR 275

Query: 328 PLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSET 387
             + GNIV++GG    P  A R+  E+    P+    ++  P  +     W      +  
Sbjct: 276 KELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASL 334

Query: 388 EDYHESRVTRQEYYEHG 404
             + +  +++QEY E G
Sbjct: 335 TTFQQMWISKQEYDESG 351

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 96.7 bits (239), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 96/378 (25%), Positives = 153/378 (40%), Gaps = 69/378 (18%)

Query: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSI-AKDKYGNYHLSNQVRSIKDI---------- 52
           SP+++D G+  +K G   E  P     SI  +        +N    ++DI          
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEASDVR 64

Query: 53  SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELS 112
           S +  + P E G + +W     +WDY  FN    N    +T+ GK L+T E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLN----NTSGGKILLT-EPPMNPLKNR 119

Query: 113 KNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQ 172
           + M +V+FE+Y+F  ++ A   V   +  G  S                           
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 173 LVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILVN 230
           +V+DSG   + IVPV + V      ++LD+ GR +   L + LS R Y  N   +   V 
Sbjct: 154 VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVR 213

Query: 231 SIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQ 288
            IKE   ++S +   ++  +R  T   + Y LPD                    +TI + 
Sbjct: 214 QIKEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------GRTIKVG 254

Query: 289 DELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFAS 348
            E F  PE  F P +  +   G+ E +  +I      +R  +   IV++GG+   P   S
Sbjct: 255 QERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAIVLSGGSSMYPGLPS 314

Query: 349 RLATELQRQCPTDWSCRV 366
           RL  EL++     W  RV
Sbjct: 315 RLEKELKQL----WYTRV 328

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 96.7 bits (239), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 98/386 (25%), Positives = 157/386 (40%), Gaps = 71/386 (18%)

Query: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRS-IKDI---------- 52
           SP+++D G+  +K G   E  P     SI             + + +KDI          
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGSISTPLKDIMIGEEASDVR 64

Query: 53  SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELS 112
           S +  + P E G + +W+    +WDY  +N   F      +T G  ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKF-----PSTSGGKILLTEPPMNPLKNR 119

Query: 113 KNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQ 172
           + M +V+FE+Y+F  ++ A   V   +  G  S                           
Sbjct: 120 ELMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 173 LVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILVN 230
           +V+DSG   + IVPV + V      ++LD+ GR +   L + LS R Y  N   +   V 
Sbjct: 154 VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVR 213

Query: 231 SIKENCLFMSPNAYFESFQSRSKTA--KEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQ 288
            IKE   ++S +   ++  +R  T   + Y LPD      G + K GQ            
Sbjct: 214 QIKEKLSYVSYDLNLDTKLARETTVLVENYELPD------GRVIKVGQ------------ 255

Query: 289 DELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFAS 348
            E F  PE  F P++  +   GI E +  +I      IR  +   IV++GG+   P   S
Sbjct: 256 -ERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAIVLSGGSSMYPGLPS 314

Query: 349 RLATELQRQCPTDWSCRVSLPKGDAG 374
           RL  EL++     W  R+   +GDA 
Sbjct: 315 RLEKELKQL----WYTRIL--RGDAA 334

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 95.9 bits (237), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 98/382 (25%), Positives = 155/382 (40%), Gaps = 77/382 (20%)

Query: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRS-----IKDI------ 52
           +P+++D G+  +K G   E  P     SI     G   L  + R+     +KDI      
Sbjct: 5   NPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERATINKPLKDIMIGDEA 60

Query: 53  ----SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTI 108
               S +  + P E G + +W     +WDY  FN        + TT G  ++ +E  M  
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MQLPTTSGGKILLTEPPMNP 115

Query: 109 PELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNY 168
            +  + M +V+FE+Y+F  ++ A   V   +  G  S                       
Sbjct: 116 VKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG---------------------- 153

Query: 169 NDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 226
               +V+DSG   + IVPV + V      ++LD+ GR +   L + LS R Y  N   + 
Sbjct: 154 ----VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADF 209

Query: 227 ILVNSIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVLPAESQT 284
             V  IKE   ++S +   ++  +R  T   + Y LPD      G + K GQ        
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPD------GRIIKVGQ-------- 255

Query: 285 IVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIP 344
                E F  PE  F P +  +  +GI E +  +I      +R  +   IV++GG+   P
Sbjct: 256 -----ERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYP 310

Query: 345 NFASRLATELQRQCPTDWSCRV 366
              SRL  EL++     W  RV
Sbjct: 311 GLPSRLEKELKQL----WFTRV 328

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/377 (21%), Positives = 158/377 (41%), Gaps = 66/377 (17%)

Query: 34  KDKYGNYHLSNQVRSIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDT 93
           KD Y    + ++ +S + I ++ +  P E G + +W+   +IW +  +N        +  
Sbjct: 35  KDSY----VGDEAQSKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRV 81

Query: 94  TKGKH-LITSESCMTIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAK 152
              +H ++ +E+ M      + M Q++FE +     + +   V   +++G+ +       
Sbjct: 82  APEEHPVLLTEAPMNPKSNREKMTQILFETFNVPAFYVSIQAVLSLYSSGRTTG------ 135

Query: 153 EDSEVEESEVAPAKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLR 212
                               +V+DSG   + +VP+  G      + ++D+ GR +  +L 
Sbjct: 136 --------------------IVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLM 175

Query: 213 EALSFRHY--NVMDETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSF 267
           + LS R Y  +   E  +V  IKE   +++ + + +  Q+ ++++   K Y LPD     
Sbjct: 176 KILSERGYSFSTTAEREIVRDIKEKLCYVALD-FEQEMQTAAQSSAIEKSYELPD----- 229

Query: 268 QGYLRKPGQVLPAESQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIR 327
                          Q I + +E F  PE  FHP +  L  +GI +T   SI      +R
Sbjct: 230 --------------GQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVR 275

Query: 328 PLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSET 387
             + GNIV++GG    P  A R+  E+    P+    ++  P  +     W      +  
Sbjct: 276 KELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILASL 334

Query: 388 EDYHESRVTRQEYYEHG 404
             + +  +++QEY E G
Sbjct: 335 TTFQQMWISKQEYDESG 351

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 93.6 bits (231), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 95/419 (22%), Positives = 173/419 (41%), Gaps = 61/419 (14%)

Query: 5   PLIIDNGSYEIKFGSGSEKEPHRALNS-IAKDKY---------GNYHLSNQVRSIKDISS 54
           P+++DNGS  IK G G E +P    +S +   KY         GN  + NQ + I+ +  
Sbjct: 12  PIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDGNTFVGNQAQEIRGL-- 69

Query: 55  VVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKN 114
           +    P E G +  W    Q+W +         G  + + +   ++ +E+ +   +  + 
Sbjct: 70  LKLRHPLEHGVVTDWNALEQLWGHVF-----EKGLQLSSLQDHPVLVTEAPLNPKKNREQ 124

Query: 115 MDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLV 174
           M +++FE +    ++ +   V   + +G+ +                            V
Sbjct: 125 MCELLFETFSVPAVYVSIQAVLSLYASGRTTG--------------------------CV 158

Query: 175 IDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKE 234
           +DSG  CS  VPV  G     A++++DI GR ++  L + L  +   V   ++L +S +E
Sbjct: 159 LDSGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELL-QVLIRKSTGV---SLLSSSERE 214

Query: 235 NCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAV 294
               +   A + +   + +  K Y +    T F+         LP + + I L +E F  
Sbjct: 215 IVRIIKEKACYIALDPKEE-EKNYTMHGKQTMFR---------LP-DGKQIELDNEKFRA 263

Query: 295 PETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATEL 354
           PE  F+P++       + E + ESI  +   +R  +  NIV +GG   IP F  R+  EL
Sbjct: 264 PEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFSNIVFSGGTTMIPGFGDRVLKEL 323

Query: 355 QRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
           +  C      ++  P  +     W      S    + +  VT++E+ E+    C   RF
Sbjct: 324 KLSCEPQTKIKIFAPP-ERKYSTWIGGSILSGLSTFKKIWVTKKEWEEN--PRCVHARF 379

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 93.2 bits (230), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 94/378 (24%), Positives = 152/378 (40%), Gaps = 69/378 (18%)

Query: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSI-AKDKYGNYHLSNQVRSIKDI---------- 52
           +P+++D G+  +K G   E  P     SI  +        +N    +KDI          
Sbjct: 5   NPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEASDVR 64

Query: 53  SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELS 112
           S +  + P E G + +W     +WDY  F+        + TT    ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFDQ-----MKLPTTSNGKILLTEPPMNPVKNR 119

Query: 113 KNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQ 172
           + M +V+FE+Y+F  ++ A   V   +  G  S                           
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 173 LVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILVN 230
           +V+DSG   + IVPV + V      ++LD+ GR +   L + LS R Y  N   +   V 
Sbjct: 154 VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVR 213

Query: 231 SIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQ 288
            IKE   ++S +   ++  +R  T   + Y LPD      G + K GQ            
Sbjct: 214 QIKEKVCYVSYDLDLDTKLARETTTLVENYELPD------GRVIKVGQ------------ 255

Query: 289 DELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFAS 348
            E F  PE  F P +  +  +G+ E +  +I      IR  +   IV++GG+   P   S
Sbjct: 256 -ERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAIVLSGGSSMYPGLPS 314

Query: 349 RLATELQRQCPTDWSCRV 366
           RL  EL++     W  RV
Sbjct: 315 RLEKELKQL----WFTRV 328

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 92.8 bits (229), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 100/384 (26%), Positives = 153/384 (39%), Gaps = 79/384 (20%)

Query: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRS-------IKDI---- 52
           SP+++D G+  +K G   E  P     SI     G   L  + RS       IKDI    
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDFTFPSIV----GRPILRAEERSFMDSKTPIKDIMVGE 60

Query: 53  ------SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCM 106
                 S +  + P E G +  W     +WD+  F         + +T G  ++ +E  M
Sbjct: 61  EASDVRSYLQISYPMENGIIKHWTDMELLWDHAFFEK-----MKLPSTSGGKILLTEPPM 115

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
              +  + M QV+FE+Y+F  ++ A   V   +  G  S                     
Sbjct: 116 NPLKNREMMCQVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------- 155

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + IVPV + V      ++LD+ GR +   L + LS R Y  N   
Sbjct: 156 ------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSA 209

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVLPAES 282
           +   V  IKE   ++S +  F++  +R  T   + Y LPD      G + K GQ      
Sbjct: 210 DFETVRQIKEKLSYVSYDLDFDTKLARETTTLVENYELPD------GRIIKVGQ------ 257

Query: 283 QTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFN 342
                  E F  PE  F P +  +   G+ E +  +I      IR  +   IV++GG+  
Sbjct: 258 -------ERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYKAIVLSGGSSM 310

Query: 343 IPNFASRLATELQRQCPTDWSCRV 366
            P   SRL  EL++     W  RV
Sbjct: 311 YPGLPSRLEKELKQL----WFTRV 330

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 92.4 bits (228), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 95/382 (24%), Positives = 156/382 (40%), Gaps = 77/382 (20%)

Query: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRS-----IKDI------ 52
           SP+++D G+  +K G   E  P     SI     G   L  + R+     +KDI      
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASISTPLKDIMIGDEA 60

Query: 53  ----SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTI 108
               S +  + P E G + +W     +WDY  +         + +T G  ++ +E  M  
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPMNP 115

Query: 109 PELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNY 168
            +  + M +V+FE+Y+F  ++ A   V   +  G  S                       
Sbjct: 116 LKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG---------------------- 153

Query: 169 NDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 226
               +V+DSG   + IVPV + V      ++LD+ GR +   L + LS R Y  N   + 
Sbjct: 154 ----VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADF 209

Query: 227 ILVNSIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVLPAESQT 284
             V  IKE   ++S +   ++  +R  T   ++Y LPD      G + K GQ        
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTRLARETTTLVEKYELPD------GRIIKVGQ-------- 255

Query: 285 IVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIP 344
                E F  PE  F P +  + ++G+ E +  +I      +R  +   IV++GG+   P
Sbjct: 256 -----ERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYP 310

Query: 345 NFASRLATELQRQCPTDWSCRV 366
              SRL  EL++     W  RV
Sbjct: 311 GLPSRLEKELKQL----WFTRV 328

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 92.4 bits (228), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 91/378 (24%), Positives = 150/378 (39%), Gaps = 69/378 (18%)

Query: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSI-AKDKYGNYHLSNQVRSIKDI---------- 52
           SP+++D G+  +K G   E  P     SI  +        +N    +KDI          
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64

Query: 53  SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELS 112
           S +  + P E G + +W     +WDY  F         + TT    ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQ-----MKLPTTSNGKILLTEPPMNPTKNR 119

Query: 113 KNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQ 172
           + M +V+FE+Y+F  ++ A   V   +  G  S                           
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 173 LVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILVN 230
           +V+DSG   + IVPV + V      ++LD+ GR +   L + LS R Y  N   +   V 
Sbjct: 154 VVVDSGDGVTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVR 213

Query: 231 SIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQ 288
            IKE   ++S +   ++  +R  T   + Y LPD                    +TI + 
Sbjct: 214 QIKEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------GRTIKVG 254

Query: 289 DELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFAS 348
            E F  PE  F P +  +   G+ E + +++      +R  +   IV++GG+   P   S
Sbjct: 255 QERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPS 314

Query: 349 RLATELQRQCPTDWSCRV 366
           RL  EL++     W  RV
Sbjct: 315 RLEKELKQL----WFTRV 328

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 92/379 (24%), Positives = 152/379 (40%), Gaps = 69/379 (18%)

Query: 3   ESPLIIDNGSYEIKFGSGSEKEPHRALNSI-AKDKYGNYHLSNQVRSIKDI--------- 52
            +P+++D G+  +K G   E  P     SI  +        +N V  +KDI         
Sbjct: 4   RTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAV 63

Query: 53  -SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPEL 111
            S +  + P E G + +W     +WDY  ++        + +T G  ++ +E  M     
Sbjct: 64  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQ-----MKLPSTSGGKVMLTEPPMNPLRN 118

Query: 112 SKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDF 171
            + M +V+FE+Y+F  ++ A   V   +  G  S                          
Sbjct: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------------- 153

Query: 172 QLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILV 229
            +V+DSG   + IVPV + V      ++LD+ GR +   L + LS R Y  N   +   V
Sbjct: 154 -VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETV 212

Query: 230 NSIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVL 287
             IKE   ++S +   ++  +R  T   + Y LPD            G+V+   S     
Sbjct: 213 RQIKEKLSYVSYDLDLDTKLARETTTLVENYELPD------------GRVIKVGS----- 255

Query: 288 QDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFA 347
             E F  PE  F P +  +   G+ E +  +I      +R  +   IV++GG+   P   
Sbjct: 256 --ERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLP 313

Query: 348 SRLATELQRQCPTDWSCRV 366
           SRL  EL++     W  RV
Sbjct: 314 SRLEKELKQL----WFTRV 328

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 94/377 (24%), Positives = 151/377 (40%), Gaps = 69/377 (18%)

Query: 5   PLIIDNGSYEIKFGSGSEKEPHRALNSI-AKDKYGNYHLSNQVRSIKDI----------S 53
           P+++D G+  +K G   E  P     SI  +        SN    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEASNVRS 65

Query: 54  SVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSK 113
            +  + P E G + +W    Q+WDY  ++        I +T G  ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWADMEQLWDYAFYDQ-----MKIPSTAGHKVLLTEPPMNPLKNRE 120

Query: 114 NMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQL 173
            M +V+FE+Y+F  ++ A   V   +  G  S                           +
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG--------------------------V 154

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILVNS 231
           V+DSG   + IVPV + V      ++LD+ GR +  +L + LS R Y  N   +   V  
Sbjct: 155 VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLSRRGYAFNKTADFETVRQ 214

Query: 232 IKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQD 289
           IKE   ++S +   ++  +   T   + Y LPD            G+V+   S       
Sbjct: 215 IKEKLCYVSYDLDLDTKLAHETTTLVETYELPD------------GRVIKVGS------- 255

Query: 290 ELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASR 349
           E F  PE  F P +  +   GI E +  +I      I   +   IV++GG+   P   SR
Sbjct: 256 ERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAIVLSGGSSMYPGLPSR 315

Query: 350 LATELQRQCPTDWSCRV 366
           L  EL++     W  RV
Sbjct: 316 LEKELKQL----WFTRV 328

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 90.5 bits (223), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 94/382 (24%), Positives = 149/382 (39%), Gaps = 77/382 (20%)

Query: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRS-----IKDI------ 52
           +P+++D G+  +K G   E  P     SI     G   L  + R      +KDI      
Sbjct: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERGHASTPLKDIMIGDEA 60

Query: 53  ----SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTI 108
               S +  + P E G + +W     +WDY  F         + TT G  ++ +E  M  
Sbjct: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQ-----MKLPTTSGGKVLLTEPPMNP 115

Query: 109 PELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNY 168
            +  + M +V+FE+Y+F   + A   V   +  G  S                       
Sbjct: 116 IKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLSSG---------------------- 153

Query: 169 NDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 226
               +V+DSG   + IVPV + V      ++LD+ GR +   L + LS R Y  N   + 
Sbjct: 154 ----VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADF 209

Query: 227 ILVNSIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVLPAESQT 284
             V  IKE   ++S +   ++  +R  T   + Y LPD                    + 
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------GRV 250

Query: 285 IVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIP 344
           I +  E F  PE  F P +  +   G+ E +  +I      IR  +   IV++GG+   P
Sbjct: 251 IKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYP 310

Query: 345 NFASRLATELQRQCPTDWSCRV 366
              SRL  EL++     W  RV
Sbjct: 311 GLPSRLEKELKQL----WFTRV 328

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 90.5 bits (223), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 97/382 (25%), Positives = 153/382 (40%), Gaps = 77/382 (20%)

Query: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRS-----IKDI------ 52
           +P+++D G+  +K G   E  P     SI     G   L  + R+     +KDI      
Sbjct: 5   NPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASVTTPLKDIMIGDEA 60

Query: 53  ----SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTI 108
               S +  + P E G + +W     +WDY  F           T+ GK L+T E  M  
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPS----TSNGKILLT-EPPMNP 115

Query: 109 PELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNY 168
            +  + M +V+FE+Y+F  ++ A   V   +  G  S                       
Sbjct: 116 LKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG---------------------- 153

Query: 169 NDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 226
               +V+DSG   + IVPV + V      ++LD+ GR +   L + LS R Y  N   + 
Sbjct: 154 ----VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADF 209

Query: 227 ILVNSIKENCLFMSPNAYFESFQSRSKTA--KEYVLPDFNTSFQGYLRKPGQVLPAESQT 284
             V  IKE   ++S +   ++  +R  TA  + Y LPD                    +T
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPD-------------------GRT 250

Query: 285 IVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIP 344
           I +  E F  PE  F P +  +   G+ E +  ++      IR  +   IV++GG+   P
Sbjct: 251 IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYP 310

Query: 345 NFASRLATELQRQCPTDWSCRV 366
              SRL  EL++     W  RV
Sbjct: 311 GLPSRLEKELKQL----WFSRV 328

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 90.5 bits (223), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 97/382 (25%), Positives = 153/382 (40%), Gaps = 77/382 (20%)

Query: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRS-----IKDI------ 52
           +P+++D G+  +K G   E  P     SI     G   L  + R+     +KDI      
Sbjct: 5   NPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASVATPLKDIMIGDEA 60

Query: 53  ----SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTI 108
               S +  + P E G + +W     +WDY  F           T+ GK L+T E  M  
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPS----TSNGKILLT-EPPMNP 115

Query: 109 PELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNY 168
            +  + M +V+FE+Y+F  ++ A   V   +  G  S                       
Sbjct: 116 LKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG---------------------- 153

Query: 169 NDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 226
               +V+DSG   + IVPV + V      ++LD+ GR +   L + LS R Y  N   + 
Sbjct: 154 ----VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADF 209

Query: 227 ILVNSIKENCLFMSPNAYFESFQSRSKTA--KEYVLPDFNTSFQGYLRKPGQVLPAESQT 284
             V  IKE   ++S +   ++  +R  TA  + Y LPD                    +T
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPD-------------------GRT 250

Query: 285 IVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIP 344
           I +  E F  PE  F P +  +   G+ E +  ++      IR  +   IV++GG+   P
Sbjct: 251 IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYP 310

Query: 345 NFASRLATELQRQCPTDWSCRV 366
              SRL  EL++     W  RV
Sbjct: 311 GLPSRLEKELKQL----WFSRV 328

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 89.7 bits (221), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 91/378 (24%), Positives = 155/378 (41%), Gaps = 69/378 (18%)

Query: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSIA------KDKYGNYHLSNQVRSIKDISSVV- 56
           SP+++D G+  +K G   E  P     SI        ++ GN ++  +   I + +S V 
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64

Query: 57  ----FNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELS 112
                + P E G + +W     +WDY  +         + +T G  ++ +E  +   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPLNPLKNR 119

Query: 113 KNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQ 172
           + M +V+FE+Y+F  ++ A   V   +  G  S                           
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 173 LVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILVN 230
           +VIDSG   + IVPV + V      ++LD+ GR +   L + LS R Y  N   +   V 
Sbjct: 154 VVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVR 213

Query: 231 SIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQ 288
            IKE   ++S +   ++  +R  T   + Y LPD      G + K GQ            
Sbjct: 214 QIKEKLCYVSYDLELDTKLARETTTLVENYELPD------GRVIKVGQ------------ 255

Query: 289 DELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFAS 348
            E F   E  F P +  + ++G+ E +  +I      +R  +   IV++GG+   P   S
Sbjct: 256 -ERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPS 314

Query: 349 RLATELQRQCPTDWSCRV 366
           R+  EL++     W  RV
Sbjct: 315 RIEKELKQL----WYTRV 328

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 89.4 bits (220), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 96/382 (25%), Positives = 152/382 (39%), Gaps = 77/382 (20%)

Query: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRS-----IKDI------ 52
           +P+++D G+  +K G   E  P     SI     G   L  + R+     +KDI      
Sbjct: 5   NPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASVTTPLKDIMIGDEA 60

Query: 53  ----SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTI 108
               S +  + P E G + +W     +WDY  F           T+ GK L+T E  M  
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLQS----TSNGKILLT-EPPMNP 115

Query: 109 PELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNY 168
            +  + M +V+FE+Y+F  ++ A   V   +  G  S                       
Sbjct: 116 LKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG---------------------- 153

Query: 169 NDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 226
               +V+DSG   + IVPV + V      ++LD+ GR +   L + LS R Y  N   + 
Sbjct: 154 ----VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADF 209

Query: 227 ILVNSIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVLPAESQT 284
             V  IKE   ++S +   ++  +R  T   + Y LPD                    +T
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------GRT 250

Query: 285 IVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIP 344
           I +  E F  PE  F P +  +   G+ E +  ++      IR  +   IV++GG+   P
Sbjct: 251 IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYP 310

Query: 345 NFASRLATELQRQCPTDWSCRV 366
              SRL  EL++     W  RV
Sbjct: 311 GLPSRLEKELKQL----WFSRV 328

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 92/382 (24%), Positives = 152/382 (39%), Gaps = 77/382 (20%)

Query: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRS-----IKDI------ 52
           +P+++D G+  +K G   E  P     SI     G   L  + R+     +KDI      
Sbjct: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASITTPLKDIMIGDEA 60

Query: 53  ----SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTI 108
               S +  + P E G + +W     +WDY  +         + +T G  ++ +E  M  
Sbjct: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPMNP 115

Query: 109 PELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNY 168
               + M +V+FE+Y+F  ++ A   V   +  G  S                       
Sbjct: 116 LRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG---------------------- 153

Query: 169 NDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 226
               +V+DSG   + IVPV + V      K+LD+ GR +   L + LS R Y  N   + 
Sbjct: 154 ----VVVDSGDGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADF 209

Query: 227 ILVNSIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVLPAESQT 284
             V  IKE   ++S +   ++  +R  T   + Y LPD            G+V+   S  
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPD------------GRVIKVGS-- 255

Query: 285 IVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIP 344
                E F  PE  F P +  +   G+ E +  ++      +R  +   +V++GG+   P
Sbjct: 256 -----ERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYP 310

Query: 345 NFASRLATELQRQCPTDWSCRV 366
              SRL  EL++     W  RV
Sbjct: 311 GLPSRLEKELKQL----WFTRV 328

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 93/372 (25%), Positives = 149/372 (40%), Gaps = 73/372 (19%)

Query: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRS-----IKDI------ 52
           +P+++D G+  +K G   E  P     SI     G   L  + R+     +KDI      
Sbjct: 5   NPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASVATPLKDIMIGDEA 60

Query: 53  ----SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTI 108
               S +  + P E G + +W     +WDY  F           T+ GK L+T E  M  
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPS----TSNGKILLT-EPPMNP 115

Query: 109 PELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNY 168
            +  + M +V+FE+Y+F  ++ A   V   +  G  S                       
Sbjct: 116 LKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG---------------------- 153

Query: 169 NDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 226
               +V+DSG   + IVPV + V      ++LD+ GR +   L + LS R Y  N   + 
Sbjct: 154 ----VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADF 209

Query: 227 ILVNSIKENCLFMSPNAYFESFQSRSKTA--KEYVLPDFNTSFQGYLRKPGQVLPAESQT 284
             V  IKE   ++S +   ++  +R  T   + Y LPD                    +T
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTVLVESYELPD-------------------GRT 250

Query: 285 IVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIP 344
           I +  E F  PE  F P +  +   G+ E +  ++      IR  +   IV++GG+   P
Sbjct: 251 IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAIVLSGGSSMYP 310

Query: 345 NFASRLATELQR 356
              SRL  EL++
Sbjct: 311 GLPSRLEKELKQ 322

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 93/384 (24%), Positives = 149/384 (38%), Gaps = 79/384 (20%)

Query: 3   ESPLIIDNGSYEIKFGSGSEKEPHRALNSIA------KDKYGNYHL----------SNQV 46
           + P+++D G+  +K G   E  P     SI        D+  N             ++QV
Sbjct: 4   QKPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEASQV 63

Query: 47  RSIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCM 106
           RS   IS      P E G +  W     +WDY  +         + +T G  ++ +E  M
Sbjct: 64  RSYLQISY-----PMENGIIRDWADMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPM 113

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M +V+FE+Y+F  ++     V   +  G  S                     
Sbjct: 114 NPLRNREQMCEVMFEKYDFGGVYVGIQAVLALYAQGLSSG-------------------- 153

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + IVPV + V      ++LD+ GR +  +L + LS R Y  N   
Sbjct: 154 ------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLLSRRGYAFNKTA 207

Query: 225 ETILVNSIKENCLFMSPNAYFES--FQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAES 282
           +   V  IKE   ++S +   ++   Q  +   ++Y LPD            G+V+   S
Sbjct: 208 DFETVRQIKEKLCYVSYDLDLDTRLAQETTTLVEQYELPD------------GRVIKVGS 255

Query: 283 QTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFN 342
                  E F  PE  F P +  +   GI E +  +I      I   +   IV++GG+  
Sbjct: 256 -------ERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAIVLSGGSSM 308

Query: 343 IPNFASRLATELQRQCPTDWSCRV 366
            P   SRL  EL++     W  RV
Sbjct: 309 YPGLPSRLEKELKQL----WFTRV 328

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 85/365 (23%), Positives = 150/365 (41%), Gaps = 66/365 (18%)

Query: 5   PLIIDNGSYEIKFG-SGSEKEPHRALNSIAKDKY---------GNYHLSNQVRSIKDISS 54
           P+++DNGS  IK G SG EK      + I   KY         G+  + NQ + ++ +  
Sbjct: 37  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGLLK 96

Query: 55  VVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKN 114
           + +  P + G + +W    Q+W Y +FN        +   +    + +E+ +   +  + 
Sbjct: 97  LRY--PLQHGIVTNWADMEQVWGY-VFN----KSLQLQNVEDHPNLVTEAPLNPHKNREK 149

Query: 115 MDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLV 174
           M +++FE +    ++ +   V   + +G+ +                            V
Sbjct: 150 MCELLFESFNVPALYVSVQAVLSLYASGRTTG--------------------------CV 183

Query: 175 IDSGFNCSWIVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYNVMDETILVN 230
           +D G  C   VPV  G     +++++DI GR    FL   LR+       +  +  I V 
Sbjct: 184 VDCGDGCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREI-VR 242

Query: 231 SIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDE 290
           +IKE   F++ +   E          E   P  N SF  +       LP + +TI L  E
Sbjct: 243 TIKEKACFVTKDPKLE----------EQNFP-MNPSFSKF------KLP-DGKTIELGQE 284

Query: 291 LFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRL 350
            +  PE  F PE+       + +   +SI  +   +R L+  NI+++GG   +P F  RL
Sbjct: 285 RYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILLSGGTSMLPGFGDRL 344

Query: 351 ATELQ 355
             EL+
Sbjct: 345 LKELK 349

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 93/424 (21%), Positives = 166/424 (39%), Gaps = 71/424 (16%)

Query: 5   PLIIDNGSYEIKFG-SGSEKEPHRALNSIAKDKY---------GNYHLSNQVRSIKDISS 54
           P+++DNGS  IK G SG EK      + I   KY         G+  + NQ + ++ +  
Sbjct: 9   PIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGL-- 66

Query: 55  VVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKN 114
           +    P E G + +W     IW Y +FN        +   +   ++ +E+ +      + 
Sbjct: 67  LKLRHPVEHGIVKNWSDMEHIWSY-VFN----KSLQLQNVEDHPILITEAPLNPRNNRER 121

Query: 115 MDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLV 174
           M +++FE +    ++ +   V   + +G+ +                            V
Sbjct: 122 MCELLFESFNVPALYVSIQAVLSLYASGRTTG--------------------------CV 155

Query: 175 IDSGFNCSWIVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYNVMDETILVN 230
           +D G  C   VPV  G     +++++DI GR    FL   LR+       +  +  + V 
Sbjct: 156 VDCGDGCCHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREV-VR 214

Query: 231 SIKENCLFMSPNAYFESFQ-SRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQD 289
            IKE   +++ + + E    S +    ++ LPD                    +TI L  
Sbjct: 215 IIKEKACYVAKDPHIEEQNFSINPNYTKFKLPD-------------------GKTIDLGQ 255

Query: 290 ELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASR 349
           E F  PE  F PE+       + +   +SI  +   +R L+  N++++GG   +P F  R
Sbjct: 256 EKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSNVLLSGGTSILPGFGDR 315

Query: 350 LATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCT 409
           L +EL+    +    ++  P  +     W      S    + +  VTR E +E   D C 
Sbjct: 316 LLSELKSLSDSQTKIKIFAPP-ERKYSTWIGGSILSGLSTFKKLWVTRAE-WEEAAD-CI 372

Query: 410 AKRF 413
             RF
Sbjct: 373 HSRF 376

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 83.6 bits (205), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 87/328 (26%), Positives = 135/328 (41%), Gaps = 63/328 (19%)

Query: 43  SNQVRSIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITS 102
           +++VRS   IS      P E G + +W     +WDY  +          DT+ GK L+T 
Sbjct: 6   ASEVRSYLQISY-----PMENGIIKNWTDMELLWDYAFYEQMKLP----DTSNGKILLT- 55

Query: 103 ESCMTIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEV 162
           E  M   +  + M +V+FE+Y F  ++ A   V   +  G  S                 
Sbjct: 56  EPPMNPIKNREKMCEVMFEKYNFGGVYVAIQAVLALYAQGLSSG---------------- 99

Query: 163 APAKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY-- 220
                     +V+DSG   + IVPV + V      ++LD+ GR +   L + LS R Y  
Sbjct: 100 ----------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGYAF 149

Query: 221 NVMDETILVNSIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVL 278
           N   +   V  IKE   ++S +   ++  +R  T   + Y LPD            G+V+
Sbjct: 150 NRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD------------GRVI 197

Query: 279 PAESQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITG 338
              S       E F  PE  F P +  +  +G+ E +  +I      IR  +   IV++G
Sbjct: 198 KVGS-------ERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAIVLSG 250

Query: 339 GNFNIPNFASRLATELQRQCPTDWSCRV 366
           G+   P   SRL  EL++     W  RV
Sbjct: 251 GSSMYPGLPSRLEKELKQL----WFTRV 274

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 82/328 (25%), Positives = 134/328 (40%), Gaps = 63/328 (19%)

Query: 43  SNQVRSIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITS 102
           ++ VRS   IS      P E G + +W     +WDY  ++        + +T G  ++ +
Sbjct: 6   ASAVRSYLQISY-----PMENGVIKNWSDMELLWDYAFYDQ-----MQLPSTSGGKVMLT 55

Query: 103 ESCMTIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEV 162
           E  M   +  + M +V+FE+Y+F  ++ A   V   +  G  S                 
Sbjct: 56  EPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG---------------- 99

Query: 163 APAKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY-- 220
                     +V+DSG   + IVPV + V      ++LD+ GR +   L + LS R Y  
Sbjct: 100 ----------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 149

Query: 221 NVMDETILVNSIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVL 278
           N   +   V  IKE   ++S +   ++  +R  T   + Y LPD            G+V+
Sbjct: 150 NRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPD------------GRVI 197

Query: 279 PAESQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITG 338
              S       E F  PE  F P +  +   G+ E +  +I      +R  +   IV++G
Sbjct: 198 KVGS-------ERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSG 250

Query: 339 GNFNIPNFASRLATELQRQCPTDWSCRV 366
           G+   P   SRL  EL++     W  RV
Sbjct: 251 GSSMYPGLPSRLEKELKQL----WFTRV 274

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 92/372 (24%), Positives = 149/372 (40%), Gaps = 77/372 (20%)

Query: 5   PLIIDNGSYEIKFGSGSEKEP------------HRALNSIAKDKYGNYHLSNQVRSIKDI 52
           P+++DNGS  +K G   E  P            H  +N  +KD     +L+ + RSI   
Sbjct: 12  PVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERRSI--- 68

Query: 53  SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELS 112
             +    P + G + +W     IWDY   +         D  +   LIT E+ +      
Sbjct: 69  --LQLRHPVDHGVVKNWNDMELIWDYMFKDKLKLK----DVDEHPVLIT-EAPLNPVSNR 121

Query: 113 KNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQ 172
             M  ++FE +  + ++ A   V   + +GK S  +L   +                   
Sbjct: 122 DEMCDLLFESFGVQALYVANPAVLSLYASGKISGCVLDCGD------------------- 162

Query: 173 LVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETI----- 227
                G++CS  VPV +G     A+K++D+GGR L   L+  L  R    +  T      
Sbjct: 163 -----GYSCS--VPVYQGYTLKSAIKRIDLGGRDLTEQLQ--LQLRKSTGLSLTTSGEME 213

Query: 228 LVNSIKENCLFMSPNAYFESFQSR---SKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQT 284
           LV  IKE   +++ +   E  +      +   ++ LPD                    + 
Sbjct: 214 LVRMIKEKSCYVAVDLDIEEEKCNYEGDQVGLKFKLPD-------------------GKF 254

Query: 285 IVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIP 344
           I L  + F VPE  F P + S   S I E I +S+S L   +RP M  +I+++GG   + 
Sbjct: 255 ITLSKDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDLRPQMWSDILLSGGTTMLK 314

Query: 345 NFASRLATELQR 356
            F +RL  EL +
Sbjct: 315 GFGNRLVQELDK 326

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 83/365 (22%), Positives = 150/365 (41%), Gaps = 66/365 (18%)

Query: 5   PLIIDNGSYEIKFG-SGSEKEPHRALNSIAKDKY---------GNYHLSNQVRSIKDISS 54
           P+++DNGS  IK G SG E+      + I   KY         G   + NQ + ++ +  
Sbjct: 11  PIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGLLK 70

Query: 55  VVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKN 114
           + +  P E G + +W     IW++        N       +   ++ +E+ +   +  + 
Sbjct: 71  LRY--PLEHGIVKNWSDMELIWNHVFHKSLQLN-----NIEEHPVLATEAPLNPLKNREA 123

Query: 115 MDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLV 174
           M +++FE +    ++ +   V   + +G+ +                            V
Sbjct: 124 MCEMLFETFNVPAVYVSIQAVLSLYASGRTTG--------------------------CV 157

Query: 175 IDSGFNCSWIVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYNVMDETILVN 230
           +D G  C   VPV  G     +++++D+ GR    FL   LR+       +  +  I V 
Sbjct: 158 LDCGDGCCHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKTTGVSLLSSSEREI-VR 216

Query: 231 SIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDE 290
            IKE   +++ +   E         + Y L   +T F+         LP + + + L++E
Sbjct: 217 IIKEKACYVARDPLTEE--------QTYHLTPTSTIFK---------LP-DGKVLDLKNE 258

Query: 291 LFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRL 350
            F  PE  F P++       I E   +SIS +   +RP ++ NIV++GG    P F  RL
Sbjct: 259 KFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVLSGGTTMFPGFGDRL 318

Query: 351 ATELQ 355
            TEL+
Sbjct: 319 LTELR 323

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 80.1 bits (196), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 88/373 (23%), Positives = 158/373 (42%), Gaps = 78/373 (20%)

Query: 5   PLIIDNGSYEIKFGSGSEKEPHR-ALNSIAKDKYG-----------NYHLSNQVRSIKDI 52
           P++IDNGS  IK G   + +P     N     KY            + ++ N+ +SI+ +
Sbjct: 11  PIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIRGL 70

Query: 53  SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCMTIPEL 111
             +    P   G + +W+    +W + +FN D  N  +I+    +H L+ +E+ +TI + 
Sbjct: 71  --LRLQHPMNRGVVDNWDDMELLW-WHIFN-DTLNVQNIE----EHPLLITEAPLTIEKQ 122

Query: 112 SKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDF 171
              M + +FE +   +++ A   V   + +G                          N  
Sbjct: 123 RHIMCERLFETFNIPSLYVANPSVLSLYASG--------------------------NTT 156

Query: 172 QLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFL----REALSFRHYNVMDETI 227
             V+D G       P+ +G     +++K+++GGR +   L    R++     Y+  +E  
Sbjct: 157 GCVVDCGDGYCSSTPIYEGFVLPASIRKMEVGGRDITEHLQFQIRKSSGISLYSS-NEKE 215

Query: 228 LVNSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQV-----LPAES 282
           +V +IKE   ++S                     DFN S + Y  +  ++     LP + 
Sbjct: 216 IVRTIKEKVCYISE--------------------DFNKSEESYYLRQDEMSCKFKLP-DG 254

Query: 283 QTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFN 342
           + + L  E F  PE  F+P++  L N  +     ESIS +   +RP +  NI++TGG+  
Sbjct: 255 KELTLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLFSNILLTGGSTL 314

Query: 343 IPNFASRLATELQ 355
              F SRL  +LQ
Sbjct: 315 FKGFGSRLLGDLQ 327

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 76/338 (22%), Positives = 139/338 (41%), Gaps = 79/338 (23%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIA--------------KDKYGNYHLSNQVR 47
           E + L+IDNGS   K G   +  P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCM 106
           S + I ++ +  P E G + +W+   +IW +  +N        +     +H ++ +E+ M
Sbjct: 60  SKRGILTLRY--PIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
                 + M Q++FE +     + +   V   +++G+ +                     
Sbjct: 111 NPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG-------------------- 150

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 224
                 +V+DSG   + +VP+  G      + ++D+ GR L  +L + LS R Y  +   
Sbjct: 151 ------IVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTA 204

Query: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTA---KEYVLPDFNTSFQGYLRKPGQVLPAE 281
           E  +V  IKE   +++ + + +  Q+ ++++   K Y LPD                   
Sbjct: 205 EREIVRDIKEKLCYVALD-FEQEMQTAAQSSSIEKSYELPD------------------- 244

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESI 319
            Q I + +E F  PE  FHP +  L +SGI +T   SI
Sbjct: 245 GQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSI 282

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 80/368 (21%), Positives = 144/368 (39%), Gaps = 67/368 (18%)

Query: 5   PLIIDNGSYEIKFG-SGSEKEPHRALNSIAKDKYGNYHLSNQV----------RSIKDIS 53
           P+++DNGS  IK G SG  K      N I   KY    L+N +          R+ K   
Sbjct: 10  PVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQKSRG 69

Query: 54  SVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSK 113
            +    P   G + +W+    +W +  FN    +   I+      L+ +E+ +   +   
Sbjct: 70  LLRLRHPMNRGIVENWDDMETLWSHT-FN----DILKINDFDEHPLLITEAPLNPEKNRD 124

Query: 114 NMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQL 173
            M +V FE+++F  ++ A       + +G+ +                            
Sbjct: 125 KMCEVFFEKFDFAAVYIANPSTLSLYASGRTTG--------------------------C 158

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFL----REALSFRHYNVMDETILV 229
           V+D G      VP+ +G     +++++D+GGR +   L    R+      Y+  +  I+ 
Sbjct: 159 VLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQFQIRKYTGISLYSSSEHEIVK 218

Query: 230 NSIKENCLFMSPNAYFESFQSRS--KTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVL 287
           N  ++ C   +  A+ E   + +  K   ++ LPD                    + ++L
Sbjct: 219 NVKEKACYVSTDFAHDEDMSNLNPEKIRCQFKLPD-------------------GKDLIL 259

Query: 288 QDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFA 347
               F  PE  F P+I  L    + +   ESIS +   +RP +  +I++ GG+     F 
Sbjct: 260 DKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFSSIILNGGSTMFRGFG 319

Query: 348 SRLATELQ 355
            RL  ELQ
Sbjct: 320 DRLLKELQ 327

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 74.3 bits (181), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 73/376 (19%), Positives = 161/376 (42%), Gaps = 64/376 (17%)

Query: 5   PLIIDNGSYEIKFGSGSEKEP----HRALNSIAKDKY------GNYHLSNQVRSIKDISS 54
           P++IDNG+  +K G   + +P    H  + +   DK        N ++ N+ +  + +  
Sbjct: 10  PVVIDNGTGVLKVGFVGDDKPKCFQHNIVGTPKFDKVMIGGLDDNMYIGNKAQENRGL-- 67

Query: 55  VVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKN 114
           +    P E G++  W+    +W + L +  D N   I   +   ++ +E+ +   +  ++
Sbjct: 68  LRLRHPMEHGEVKHWDEMEAVWKHTLLH--DLN---IQHIEEHPILITEAPLNSSKNREH 122

Query: 115 MDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLV 174
           M +++FE +    +     P  +   +G ++T                           V
Sbjct: 123 MCEILFESFNIPAI-HVENPAVLALYSGGRTT-------------------------GCV 156

Query: 175 IDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFL----REALSFRHYNVMDETILVN 230
           ID G      VP+ +G     +++++DIGGR +   L    R+++    ++  +E  +V 
Sbjct: 157 IDCGEGYCSAVPIYEGFALTPSIRRIDIGGREITEQLQFQIRKSVGMSLFS-SNEKEIVR 215

Query: 231 SIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDE 290
           +IKE   +++ +         SK   +Y+L   + S +  L         + +++ + + 
Sbjct: 216 TIKERACYVADDI--------SKEEHKYILDSESNSSKFKL--------PDGKSLSIGNV 259

Query: 291 LFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRL 350
            F   E  F+P +    +  + E + +++S +   +RP++  ++V+ GG   +P F +R+
Sbjct: 260 RFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTTVLPGFGNRI 319

Query: 351 ATELQRQCPTDWSCRV 366
             ELQ     D   R+
Sbjct: 320 LKELQILTKQDTKLRI 335

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 82/389 (21%), Positives = 152/389 (39%), Gaps = 84/389 (21%)

Query: 5   PLIIDNGSYEIKFGSGSEKEP--------------HRALNSIAKDKY-GNYHLSNQVRSI 49
           P+++DNGS  +K G G + +P                 +  + K K+ GN  L+ + R +
Sbjct: 13  PIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKFVGN--LAQEYRGL 70

Query: 50  KDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCMTI 108
                +    P + G + +WE    +WD+       F      +  G+H L+ +E+ +  
Sbjct: 71  -----LKLRYPMDHGIIENWEHMETVWDHI------FKDCLKVSNLGEHPLVVTEAPLNP 119

Query: 109 PELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNY 168
               + M + +FE +    ++ A   V   + +G+ +                       
Sbjct: 120 KPNREKMCETLFESFNIPALYIANPAVLSLYASGRTTG---------------------- 157

Query: 169 NDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVM----- 223
                V+++G      VP+ +G     +++++DIGGR +   L+  L  R    M     
Sbjct: 158 ----CVVEAGDGYCSSVPIYEGFALTPSIRRIDIGGRDITKHLQ--LQLRKSTGMWLYSS 211

Query: 224 DETILVNSIKENCLFMSPNAYFES---FQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPA 280
            E  +V  IKEN  ++  N   E       + K +  + LPD                  
Sbjct: 212 SEQEIVRLIKENGCYICSNHKKEEEKFLLDQEKKSISFKLPD------------------ 253

Query: 281 ESQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGN 340
             + +V+    F  PE  F+P +    +S + + I++SIS +   +R  ++ NI ++GG+
Sbjct: 254 -GKNLVIGPGRFRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNNITLSGGS 312

Query: 341 FNIPNFASRLATELQRQCPTDWSCRVSLP 369
                F  RL TEL          R+  P
Sbjct: 313 TMFQGFCDRLITELDFSVDKTTKVRILAP 341

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 75/170 (44%), Gaps = 18/170 (10%)

Query: 264 NTSFQGYLRKPGQVLPAESQTIVLQDEL------FAVPETFFHPEIASLLNSGIVE---- 313
           N++   +LR P    P +S+ +  Q +L        VPE  F P IA    +GI E    
Sbjct: 584 NSTLHLFLRGP---RPHDSEDVHQQHQLHLNTERIRVPEILFEPSIAGQDQAGIAELCET 640

Query: 314 TILESISMLP---EAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLPK 370
            +L+     P    A    MV N+ ITGGN  IP   +R+  E     P      V + +
Sbjct: 641 ILLKKFGSKPGNLSAASSRMVNNVWITGGNARIPGIKNRIVKEFTEFLPAGTPLSVHMSE 700

Query: 371 GDAGLYGWKCMQKFSETE-DYHESRVTRQEYYEHGVDWCTAKRFGYQAWL 419
            D  L  WK M K +  E DY  + VTR+EY E+G D+    + G   + 
Sbjct: 701 -DPSLDAWKGMAKLANNETDYKNTAVTRKEYEEYGPDYIKEHKLGNTGYF 749

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 95/424 (22%), Positives = 170/424 (40%), Gaps = 67/424 (15%)

Query: 5   PLIIDNGSYEIKFGSGSEKEP----HRALNSIAKDKYGNYHLSNQVRSI-----KDISSV 55
           P+++DNGS  IK G   E++P    +  + +   DK     LS++ + +     K    +
Sbjct: 11  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRGLL 70

Query: 56  VFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCMTIPELSKN 114
               P E G +  W    Q+W +  ++    N        G H ++ +E+ +   E    
Sbjct: 71  RLQYPVEHGIVQDWSGLEQLWTHVFYSSLKLN------NIGDHPMLVTEAPLNPLENRDK 124

Query: 115 MDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLV 174
           M ++++E +    ++ +   V   +  G+ +                            V
Sbjct: 125 MCEMLYETFNVPAVYVSIQAVLALYAGGRTTG--------------------------CV 158

Query: 175 IDSGFNCSWIVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYNVMDETILVN 230
           ID G  C   VPV  G     A++++D+ GR    FL   LR+++     +  +  I V 
Sbjct: 159 IDCGDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSIGVTLLSSSEREI-VR 217

Query: 231 SIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDE 290
            IKE   +++P    E  +  S    E +     T F+         LP + + + L  E
Sbjct: 218 MIKEKACYVAPEVAAEEQKYASSRGSEEL-----TKFK---------LP-DGKILSLGAE 262

Query: 291 LFAVPETFFHPE-IASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASR 349
            F  PE  F P+ I S  NS I +   +SIS +   +R  +  ++V++GG+     F  R
Sbjct: 263 KFRAPEILFQPQLIGSEFNS-IQDMCFQSISKVDLDLRSSLYSSLVLSGGSTLFAGFGDR 321

Query: 350 LATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCT 409
           L  EL+ +C  +   ++  P  +     W      +    + +  VTR E+ E+    C 
Sbjct: 322 LLNELRSRCEPNVKIKIFAPP-ERKYSVWIGGSILAGLSTFEKIWVTRSEWQEN--PQCV 378

Query: 410 AKRF 413
             RF
Sbjct: 379 HSRF 382

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 92/386 (23%), Positives = 146/386 (37%), Gaps = 77/386 (19%)

Query: 5   PLIIDNGSYEIKFGSGSEKEPHRALNSI-AKDKYGNYHLSNQVRSIKDISS--------V 55
           P++IDNG+  IK G   E +P     SI    KY     SN + S   I +        +
Sbjct: 14  PIVIDNGTNVIKGGFTGETKPRCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRGIL 73

Query: 56  VFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELS--- 112
               P   G + +W+    IW Y +F+         DT   ++L      +T P L+   
Sbjct: 74  KLRHPMLRGVVQNWDDMETIWQY-VFD---------DTLYLENLNEHPILITEPPLNNMA 123

Query: 113 --KNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYND 170
             + M + +FE + F  ++ +  PV   + +G+ +                         
Sbjct: 124 NRQKMCEALFEIFGFPAVYISVSPVLSLYASGQTT------------------------- 158

Query: 171 FQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVN 230
               +D G      +PV  G     +VKK+DIGG  +     E L F            +
Sbjct: 159 -GCAVDCGDGYCTSIPVYNGFSLASSVKKIDIGGCDIT----EQLQF------------S 201

Query: 231 SIKENCLFMSPNAYFESFQSRSKTAKE---YVLPDFNTSFQGYL----RKPGQVLPAESQ 283
            +K   LFM    Y  S +   +T KE   Y+  D+N   + YL    +   Q    + +
Sbjct: 202 ILKNTGLFM----YSSSEREIVRTIKEKVCYIATDYNLETEKYLFNEEKMASQFKLPDGK 257

Query: 284 TIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNI 343
            + +    +   E  F PE+       + E   +SI  +   +R  +  NIV++GG    
Sbjct: 258 MLNISQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIVLSGGTTMC 317

Query: 344 PNFASRLATELQRQCPTDWSCRVSLP 369
           P F SRL  ELQ     D   R+  P
Sbjct: 318 PGFGSRLLKELQTLTGYDTKIRIIAP 343

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 87/424 (20%), Positives = 162/424 (38%), Gaps = 67/424 (15%)

Query: 5   PLIIDNGSYEIKFGSGSEKEPHR-ALNSIAKDKYGNYH----------LSNQVRSIKDIS 53
           P+++DNGS  IK G   E++P     + I   KY              + N+ + ++ + 
Sbjct: 11  PVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASDSQLIGNEAQKMRGL- 69

Query: 54  SVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSK 113
            +  + P E G +  W    Q+W +  +N        +   +   ++ +E+ +   +   
Sbjct: 70  -LKLHYPLEHGVVQDWPGLEQLWTHVFYN-----SLKLANIEEHPMLITEAPLNPMKNRN 123

Query: 114 NMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQL 173
            M +++FE +    ++ +   V   +  G+ +                            
Sbjct: 124 KMCEMLFETFGSPAVYVSIQAVLALYAGGRTTG--------------------------C 157

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYNVMDETILV 229
           VID G  C   VPV  G     A++++D+ GR    FL   LR++      +  +  I V
Sbjct: 158 VIDCGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLLLRKSSGVTLSSSSEREI-V 216

Query: 230 NSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQD 289
             IKE   F++ +   E        + E       T F+         LP + + + L  
Sbjct: 217 RMIKEKACFVATDVGNEEQNYEGANSAE-----LETRFK---------LP-DGKILTLGA 261

Query: 290 ELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASR 349
           E F  PE  F P +       I E   +SIS +   +R  +  +IV++GG+     F  R
Sbjct: 262 EKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSIVLSGGSTMFSGFGDR 321

Query: 350 LATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCT 409
           L +E+++    +   ++  P  +     W      +    + +  VTR E+ E+    C 
Sbjct: 322 LLSEIRKTSEPNTKIKIFAPP-ERKYSTWIGGSILAGLSTFEKLWVTRAEWQEN--PQCI 378

Query: 410 AKRF 413
             RF
Sbjct: 379 HSRF 382

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 80/388 (20%), Positives = 151/388 (38%), Gaps = 81/388 (20%)

Query: 5   PLIIDNGSYEIKFGSGSEKEP-------------HRALNSIA-KDKY-GNYHLSNQVRSI 49
           P+I+DNGS  IK G    ++P              R++ +++ K+ Y GN     +    
Sbjct: 12  PVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERR---- 67

Query: 50  KDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIP 109
              +++    P+    ++SW+    +WDY L N        I+  +   ++ + S  T  
Sbjct: 68  ---ATLHLESPYSTNAIMSWDRLEDLWDYVLLNK-----LEIEQLQEHPVVLTNSMSTSK 119

Query: 110 ELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYN 169
           +  + M +V+FE++    ++ +  P+   +  G+ +                        
Sbjct: 120 KEEEKMCEVLFEKFSIPAIYCSRDPIMSLYGLGRTTG----------------------- 156

Query: 170 DFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH---YNVMDET 226
                +  G     I  VI G+    + +  + GG  +   + + L   H    N  +  
Sbjct: 157 ---CSVSCGHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRHNHPKLENGQNGI 213

Query: 227 ILVNSIKENCLFMSPNAY-----FESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAE 281
            L+ SIKE C  +S + Y     +E   S++   K Y LPD N                 
Sbjct: 214 ELIRSIKERCCVLSKDFYNEIRAYELITSKTSNNK-YRLPDGNI---------------- 256

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
              I +  E F  PE  F+P+        + + I+ SIS      R  ++ +IV++GG+ 
Sbjct: 257 ---IEIGSERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESIVLSGGSS 313

Query: 342 NIPNFASRLATELQRQCPTDWSCRVSLP 369
            I  F  RL  E++++   +    ++ P
Sbjct: 314 LIKGFGERLTKEIRKEIDGNQKIMLNAP 341

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 75/165 (45%), Gaps = 18/165 (10%)

Query: 264 NTSFQGYLRKPGQVLPAESQTIVLQDEL------FAVPETFFHPEIASLLNSGIV---ET 314
           N++   +LR P    P +S+ I  Q ++        VPE  F P I  L  +G+V   ET
Sbjct: 585 NSTLHLFLRGP---RPHDSENIHEQHQMHINVERIRVPEVIFQPSIGGLDQAGVVELCET 641

Query: 315 IL----ESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLPK 370
           +L    +S      A    M  N+ ITGGN  +P    R+  E     P     +V+L K
Sbjct: 642 VLLKKFDSSRRALSATCEKMAKNVFITGGNTKLPGIRERIVREFTGFLPVGTELKVTLAK 701

Query: 371 GDAGLYGWKCMQKF-SETEDYHESRVTRQEYYEHGVDWCTAKRFG 414
            D  L  WK M KF S+   Y  S +T++EY E+G ++      G
Sbjct: 702 -DPSLSAWKGMAKFASDPTSYKSSILTKREYEEYGPEYIKEHNLG 745

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 79/170 (46%), Gaps = 18/170 (10%)

Query: 264 NTSFQGYLRKP---GQVLPAESQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESIS 320
           N++   +LR P         E   + L  E   VPE  F P +  L  +GI+E + E+I 
Sbjct: 581 NSTLHLFLRGPRPHDSEDAHEQHQMHLNVERIRVPEVIFQPPMGGLDQAGIIE-LSETII 639

Query: 321 M--LPEAIRPL------MVGNIVITGGNFNIPNFASRLATELQRQCP--TDWSCRVSLPK 370
           M     + R L      M  N+ +TGGN  +P    R+  E     P  T ++ +V+   
Sbjct: 640 MNKFGSSRRQLSSVSQEMANNVFLTGGNVRVPGLRDRIVREFTEFLPVGTKYNIKVA--- 696

Query: 371 GDAGLYGWKCMQKFSETE-DYHESRVTRQEYYEHGVDWCTAKRFGYQAWL 419
            D  +  WK M KF+++  DY  S VT++EY E+G D+    + G  A+ 
Sbjct: 697 SDPAIDAWKGMAKFAQSSTDYKGSYVTKKEYEEYGPDYIKEHKLGNIAFF 746

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 86/417 (20%), Positives = 161/417 (38%), Gaps = 73/417 (17%)

Query: 5   PLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYH------------LSNQVRSIKDI 52
           P++IDNGS  +K G   E++P     S+  D   NY+            + N+ + ++ +
Sbjct: 11  PVVIDNGSAVVKAGFCGEEKPRCMEYSLIGD--ANYNKIMVGGLECDSFVGNKAQRLRGL 68

Query: 53  SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH--LITSESCMTIPE 110
             +    P E G +  W+    +W + LF+       S+  T G    L+ +E+ +    
Sbjct: 69  --LKLKHPMERGVVSDWDDMELLWSHILFD-------SLQLTSGMEHPLLITEAPLNPES 119

Query: 111 LSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYND 170
             + M +V FE +    +  +   V   + +G+ +                         
Sbjct: 120 NKEKMLEVFFETFNIPAICVSIPGVLSLYASGRTTG------------------------ 155

Query: 171 FQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGG----RFLNGFLREALSFRHYNVMDET 226
              V+D G      VPV +G     ++K++++GG    + L   LR+      ++   E 
Sbjct: 156 --CVVDCGEGYCSSVPVCEGYTLASSIKRINLGGIDVTKQLQFQLRKESGVWLFSS-GER 212

Query: 227 ILVNSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIV 286
            LV ++KE   ++S N      Q + +    +     NT+F+         LP +   + 
Sbjct: 213 ELVRTMKEKSCYVSLN------QLKDEEKFTFEPGKMNTNFK---------LP-DGNMLT 256

Query: 287 LQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNF 346
           L    F  PE  F P+I +     + E  L+SI  +   +RP ++  I ++GG      F
Sbjct: 257 LSKSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRITLSGGTTMFRGF 316

Query: 347 ASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEH 403
             R   ELQ       + R+  P  +     W      +    + +   T+ ++ EH
Sbjct: 317 GDRFLQELQISTCKKSNIRILAPP-ERKYTAWIGGSMLAGLTTFRKMLTTKSDWREH 372

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 76/370 (20%), Positives = 147/370 (39%), Gaps = 74/370 (20%)

Query: 5   PLIIDNGSYEIKFGSGSEKEPHRALNS--IAKDKY---------GNYHLSNQVRSIKDIS 53
           P++IDNGS  IK G   E+ P +AL    +   KY         G+  + N  + ++ + 
Sbjct: 14  PVVIDNGSGIIKAGFSGEERP-KALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGLL 72

Query: 54  SVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESCMTIPELS 112
            + +  P + G +  W+    IW Y L               G+H L+ +E+ M   +  
Sbjct: 73  KLRY--PIKHGVVEDWDSMELIWSYVLNEVLQLQ------NIGEHPLLITEAPMNPLKNR 124

Query: 113 KNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQ 172
           + M QV+FE ++   ++ +   V   + +G+ +                           
Sbjct: 125 EQMAQVLFETFDVSALYVSNPAVLSLYASGRTTG-------------------------- 158

Query: 173 LVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGG----RFLNGFLREALSFRHYNVMDETIL 228
            V+D G      VP+  G     ++ ++DIGG      L   LR++     ++  +  I 
Sbjct: 159 CVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFSSSEREI- 217

Query: 229 VNSIKENCLFMSPNAYFES---FQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTI 285
           V ++KE   +++ N   E     Q        + LPD                    + I
Sbjct: 218 VRTMKEKVCYLAKNIKKEEEKYLQGTQDLISTFKLPD-------------------GRCI 258

Query: 286 VLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPN 345
            + ++ +  PE  F P+I  L   G+ +  ++SI  +   +R  ++ +I+++GG   +  
Sbjct: 259 EVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKG 318

Query: 346 FASRLATELQ 355
           F  R+  +L+
Sbjct: 319 FGDRMLWDLE 328

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 75/381 (19%), Positives = 149/381 (39%), Gaps = 72/381 (18%)

Query: 5   PLIIDNGSYEIKFG-SGSEKEPHRALNSIAKDKY---------GNYHLSNQVRSIKDISS 54
           P++IDNGS  IK G SG E+      + +   KY         G+  + N+ + ++ +  
Sbjct: 14  PIVIDNGSGIIKVGFSGEERPKALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGLLR 73

Query: 55  VVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKN 114
           + +   H  G +  W+    IW Y L          +   +   L+ +E+ M   +  + 
Sbjct: 74  LRYPMTH--GVVEDWDSMELIWSYMLNEV-----LQLQNIEEHPLLITEAPMNPLKNREV 126

Query: 115 MDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLV 174
           M QV+FE +    ++ +   V   + +G+ +                            V
Sbjct: 127 MAQVLFETFNLPALYISNPAVLSLYASGRTTG--------------------------CV 160

Query: 175 IDSGFNCSWIVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYNVMDETILVN 230
           +D G      VP+  G     ++ ++DIGGR     L   LR++     ++   E  +V 
Sbjct: 161 VDCGEGYCSTVPIYDGFALPASIMRMDIGGRDITEQLQFQLRKSAGISLFSS-SELEVVR 219

Query: 231 SIKENCLFMSPNAYFES---FQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVL 287
            IKE   +++ N   E     Q        + LPD                    + I +
Sbjct: 220 MIKEKVCYLAKNIKKEEDRYLQGHHDLGSVFKLPD-------------------GKCIEI 260

Query: 288 QDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFA 347
            ++ +  PE  F P+I      G+ +  ++SI  +   +R  ++ +I+++GG   +  F 
Sbjct: 261 GNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSIILSGGTTTLRGFG 320

Query: 348 SRLATELQRQCPTDWSCRVSL 368
            R+  +L  +  +  +C++ +
Sbjct: 321 ERMLHDL--EALSKGTCKIKI 339

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 77/371 (20%), Positives = 147/371 (39%), Gaps = 76/371 (20%)

Query: 5   PLIIDNGSYEIKFG-SGSEKEPHRALNSIAKDKY---------GNYHLSNQVRSIKDISS 54
           P++IDNGS  IK G SG EK      + +   KY         G+  + N+ + ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGLLR 73

Query: 55  VVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKN 114
           + +  P E G +  W+    IW + L          +   +   L+ +E+ M   +  + 
Sbjct: 74  LQY--PIEHGVVEDWDSMELIWAHILNEV-----LQLQNIEEHPLLITEAPMNPLKNREV 126

Query: 115 MDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLV 174
           M QV+FE +    ++ +   V   + +G+ +                            V
Sbjct: 127 MAQVLFETFNLPALYVSNPAVLSLYASGRTTG--------------------------CV 160

Query: 175 IDSGFNCSWIVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYNVMDETILVN 230
           ID G      VP+  G     ++ ++DIGGR     L   LR++     ++  +  I V 
Sbjct: 161 IDCGEGYCSTVPIYDGFALPASMMRMDIGGRDITKQLQFQLRKSAGVSLFSSSEREI-VR 219

Query: 231 SIKENCLFMSP------NAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQT 284
           +IKE   +++       N Y +  Q  +   K   LPD                    + 
Sbjct: 220 TIKEKVCYLATDIKKEENTYMQESQDLTSVFK---LPD-------------------GKC 257

Query: 285 IVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIP 344
           I + ++ +  PE  F P+I      G+ +  ++SI  +   +R  ++ +I+++GG   + 
Sbjct: 258 IEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSIILSGGTTTLR 317

Query: 345 NFASRLATELQ 355
            F  R+  +L+
Sbjct: 318 GFGDRMLHDLE 328

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 73/162 (45%), Gaps = 12/162 (7%)

Query: 264 NTSFQGYLRKP---GQVLPAESQTIVLQDELFAVPETFFHPEIASLLNSGIVE----TIL 316
           N++   +LR P         E   + L  E   VPE FF P +     +G+ E     +L
Sbjct: 583 NSTLHLFLRGPRPHDSENSHEQHQMHLNVERIRVPEVFFQPTMCGEDQAGVSELCERVLL 642

Query: 317 ESISMLPEAIRPL---MVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLPKGDA 373
                 P  +  +   M  N+ +TGGN  IP    R+  E     P + S  V++   D 
Sbjct: 643 SKFGASPRQMSSITSEMAKNVWVTGGNAKIPGLRERIVKEFTGFLPVNTSFNVNI-SSDP 701

Query: 374 GLYGWKCMQKFSETE-DYHESRVTRQEYYEHGVDWCTAKRFG 414
            L  W+ M K+++ E DY +S ++++EY E+G D+    + G
Sbjct: 702 SLDAWRGMAKYAQNETDYKKSFISKKEYEEYGPDYIKEHKLG 743

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 68/146 (46%), Gaps = 8/146 (5%)

Query: 281 ESQTIVLQDELFAVPETFFHPEIASLLNSGIVE----TILESISMLPEAIRPL---MVGN 333
           E   + L  E   VPE  F P +     +G+ E     +L+     P  +      M  N
Sbjct: 604 EQHQMHLNIERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPNQLSKTAEDMANN 663

Query: 334 IVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHES 393
           I ++GGN  +P   +R+  E     P      V++   D  L  WK M K++++EDY++S
Sbjct: 664 IWLSGGNAKVPGLKNRIVKEFTSFLPVGTKLSVNM-SSDPLLDSWKGMAKWAKSEDYNKS 722

Query: 394 RVTRQEYYEHGVDWCTAKRFGYQAWL 419
            +T++EY E+G ++    + G  A+ 
Sbjct: 723 FITKKEYEEYGPEYIKEHKMGNVAYF 748

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 66.2 bits (160), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 74/166 (44%), Gaps = 20/166 (12%)

Query: 264 NTSFQGYLRKPGQVLPAESQTIVLQDEL------FAVPETFFHPEIASLLNSGIVETILE 317
           N++   +LR P    P +S+ I  Q ++        VPE  F P +  L  +GI+E I E
Sbjct: 580 NSTLHLFLRGP---RPHDSEDINQQHQMHLNVERIRVPEVIFQPSMGGLDQAGIIE-ICE 635

Query: 318 S--------ISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLP 369
           +              +I   +  N+ +TGGN  +P    R+  E +   P      V + 
Sbjct: 636 TNFLKKFGSSRSELSSISRSLASNVFLTGGNMRLPGMRERVVREFRGLLPIGTELNVRMA 695

Query: 370 KGDAGLYGWKCMQKFSETED-YHESRVTRQEYYEHGVDWCTAKRFG 414
             D  L  W+ M K S T+  + ++ VTRQEY+E+G D+      G
Sbjct: 696 -NDCALDAWRGMAKLSRTDSLFRDTYVTRQEYHEYGPDYIKEHNLG 740

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 105/251 (41%), Gaps = 43/251 (17%)

Query: 3   ESPLIIDNGSYEIKFGSGSEKEP-HRALNSIAK--DKYGNYHLSNQVRSIK-DISSVVFN 58
           E+ + ID GS E++ G G+++ P H   N IA+  D+  N +L+        D+S    +
Sbjct: 36  ETAIAIDFGSSEVRAGYGNQERPSHIFPNRIARWRDRKLNRNLTFIGNDTNLDLSVRSQS 95

Query: 59  R-PHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKG--KHLITSESCMTIPELSKNM 115
           R P++   + +W+    I +Y       F+   +  T G    +I +E    +     N 
Sbjct: 96  RSPYDGALVTNWDYTEDIMEYT------FHHLGVKGTDGIPNPIIMTEKLGALHSQRDNW 149

Query: 116 DQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVI 175
            Q++FE       F AP   F     G  S     A  D+                 LVI
Sbjct: 150 YQLLFE------CFGAPQVTF-----GLDSLFSFYANNDASAS-------------GLVI 185

Query: 176 DSGFNCSWIVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYNVMDETILVNS 231
            SG   + I+PV+ G       K+++ GGR    +L+  L  AL + ++ +   T    +
Sbjct: 186 SSGNEDTHIIPVVDGKGVLGEAKRINWGGRQSVDYLSNLL--ALKYPYFPIKPSTHQFKA 243

Query: 232 IKENCLFMSPN 242
           + +   ++SP+
Sbjct: 244 LYDEFCYVSPD 254

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 71/166 (42%), Gaps = 20/166 (12%)

Query: 264 NTSFQGYLRKPGQVLPAESQTIVLQDEL------FAVPETFFHPEIASLLNSGIVE---- 313
           N++   +LR P    P +S+ I  Q ++        VPE  F P +A L  +G+ E    
Sbjct: 580 NSTLHLFLRGP---RPHDSENINEQHQMHLNVERIRVPEVIFQPSMAGLDQAGVTEICET 636

Query: 314 ----TILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLP 369
                   + S L E  + L   N+ +TGGN  +P    R+  E     P   +  V + 
Sbjct: 637 NFLKKFGSTRSQLSEGSKKL-AANVFLTGGNMRLPGVRERIVREFTGMLPMGSNLNVRMA 695

Query: 370 KGDAGLYGWKCMQKFSET-EDYHESRVTRQEYYEHGVDWCTAKRFG 414
             D+ +  W+ M K S+    Y  S +TR+EY E G D+      G
Sbjct: 696 -SDSAVDAWRGMAKLSQAGSQYKGSYITRKEYQELGADYIKEHNLG 740

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 56/248 (22%), Positives = 104/248 (41%), Gaps = 45/248 (18%)

Query: 5   PLIIDNGSYEIKFGSGSEKEP-HRALNSIAK--DKYGNYHLS---NQVRSIKDISSVVFN 58
           P+ ID GS E++ G G++ +P H   N I++  D+  N +L+   N       + S    
Sbjct: 38  PIAIDFGSSEVRAGFGNQDQPSHIFTNRISRWRDRRKNRNLTFIGNDTNLDLSVRSQA-K 96

Query: 59  RPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKG--KHLITSESCMTIPELSKNMD 116
            P++   + +W+   +I +Y       F+   ++   G    ++ +E   T+    +N  
Sbjct: 97  SPYDGAIVSNWDYTEEIMEYT------FHHLGVNGNDGVSNPILMTEKLATLQSQRENWY 150

Query: 117 QVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVID 176
           Q++FE       F  P   F     G  S     A  D+                 LVI+
Sbjct: 151 QLLFE------CFGVPQVTF-----GIDSLFSFYANNDATAS-------------GLVIN 186

Query: 177 SGFNCSWIVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYNVMDETILVNSI 232
           SG   + ++PV+ G       K+++ GGR    +L+  L  AL + ++ +   T    S+
Sbjct: 187 SGNEDTHVIPVMNGKGVLSEAKRINWGGRQSVEYLSNLL--ALKYPYFPIKPSTHQFQSL 244

Query: 233 KENCLFMS 240
            E+  ++S
Sbjct: 245 YEDFCYVS 252

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 75/165 (45%), Gaps = 18/165 (10%)

Query: 264 NTSFQGYLRKPGQVLPAESQTIVLQDEL------FAVPETFFHPEIASLLNSGIVE---- 313
           N++   +LR P    P +S+ I  Q ++        VPE  F P +  L  +GI E    
Sbjct: 587 NSTLHLFLRGPR---PHDSEDIHQQHQIHLNVERIRVPEIVFQPSMGGLDQAGIAELSET 643

Query: 314 TILESISMLPEAIRPL---MVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLPK 370
            +L      P+ +  L   M  NI +TGGN  IP    R+  E +   P +    V++  
Sbjct: 644 ILLRKFGSEPKHLSELSLTMANNIWLTGGNSKIPGLRERIVKEFREFLPVNTQFNVNMT- 702

Query: 371 GDAGLYGWKCMQKFSETE-DYHESRVTRQEYYEHGVDWCTAKRFG 414
            D     W  M K ++ E DY ++ ++++EY E+G ++    + G
Sbjct: 703 SDPTFDAWNGMAKLAQNETDYKKTIISKKEYEEYGPEYIKEHKLG 747

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/371 (19%), Positives = 145/371 (39%), Gaps = 76/371 (20%)

Query: 5   PLIIDNGSYEIKFG-SGSEKEPHRALNSIAKDKY---------GNYHLSNQVRSIKDISS 54
           P++IDNGS  IK G SG E+      + +   KY         G+  + N+ + ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEERPKALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGLLR 73

Query: 55  VVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKN 114
           + +  P + G +  W+    IW Y L          +   +   L+ +E+ M   +  + 
Sbjct: 74  LRY--PMKHGVVEDWDSMELIWSYVLNEV-----LQLQNIEEHPLLITEAPMNPLKNREM 126

Query: 115 MDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLV 174
           + QV+FE +    ++ +   V   + +G+ +                            V
Sbjct: 127 IAQVMFETFNLSAIYVSDPAVLSLYASGRTTG--------------------------CV 160

Query: 175 IDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETI------- 227
           +D G      VP+  G     ++ ++DIGG    G + E L F+       ++       
Sbjct: 161 VDCGEGYCSSVPIYDGFALPASIMRMDIGG----GDITEQLQFQIRKSAGVSLFSSSERE 216

Query: 228 LVNSIKENCLFMSPNAYFES---FQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQT 284
           +V +IKE   +++ +A  E     Q        + LPD                    ++
Sbjct: 217 IVRTIKEKVCYLAKDAKKEEDKYLQGTQDLISAFKLPD-------------------GKS 257

Query: 285 IVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIP 344
           I + ++ +  PE  F P+I      G+    ++SI  +   +R  ++ +++++GG   + 
Sbjct: 258 IEVGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVILSGGTTTLK 317

Query: 345 NFASRLATELQ 355
            F  R+  +L+
Sbjct: 318 GFGDRMLHDLE 328

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 68/322 (21%), Positives = 138/322 (42%), Gaps = 46/322 (14%)

Query: 39  NYHLSNQVRSIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH 98
           ++++ N+  +    ++   N P   GQ+ +W+   + W+  +F         + T    H
Sbjct: 106 DFYIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDH 158

Query: 99  L-ITSESCMTIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEV 157
             + +E  +  PE  + + ++ FE +    ++ A           +    +  +   S+V
Sbjct: 159 FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAV----------QAVLALAASWTSSKV 208

Query: 158 EESEVAPAKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSF 217
            +  +           VIDSG   + ++PV +G     A+K + I GR +  F++  L  
Sbjct: 209 VDRSLTGT--------VIDSGDGVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLL-- 258

Query: 218 RHYNVMDETI-LVNSIKENCLFMSPNAY--FESFQSRSKTAKEYVLPDFNTSFQGYLRKP 274
           R    +D ++     IK+   ++ P+    F  F   ++   +YV+ + + + Q      
Sbjct: 259 RERGEVDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAEKFAQYVVENQDKTRQ------ 312

Query: 275 GQVLPAESQTIVLQDELFAVPETFFHPEIASLLNSGIVETIL-ESISMLPEAIRPLMVGN 333
                   + + +  E F  PE FF+PEIAS      + T+L ++I   P  +R  +  N
Sbjct: 313 --------KVVDIGYERFLAPEIFFNPEIASSDFLTPLPTVLDQTIQACPIDVRKGLYNN 364

Query: 334 IVITGGNFNIPNFASRLATELQ 355
           IV++GG+    +F  RL  +L+
Sbjct: 365 IVLSGGSTMFKDFGRRLQRDLK 386

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 82/428 (19%), Positives = 174/428 (40%), Gaps = 89/428 (20%)

Query: 5   PLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNR----- 59
           P+++DNGS  +K G   ++ P              Y ++ + R  K +++ + +R     
Sbjct: 13  PVVLDNGSAILKAGFSGDETPAIL----------EYTMAGKPRYKKVMTTGLEDRTFVGN 62

Query: 60  -------------PHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKH-LITSESC 105
                        P   G++ +W+    +W +  ++         ++  G H L+ +E+ 
Sbjct: 63  EAQRLRGLLALRRPISRGEVTNWDDMELLWSHIFYSKLQLGQG--NSQIGDHPLLITEAP 120

Query: 106 MTIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPA 165
           +   +  + M ++++E + F+ ++ A   V   + TG+ +  +L   E            
Sbjct: 121 LNSTKNRETMCEILYETFNFDALYVAHPAVLSLYATGQTTGCVLECGE------------ 168

Query: 166 KNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRF----LNGFLREALSFRHYN 221
                       G++ S   PV +G     +++++DIGGR     L  ++R++     ++
Sbjct: 169 ------------GYSAS--TPVYQGFALPSSIRRIDIGGRDITQELQFYIRKSTGLSLFS 214

Query: 222 VMDETILVNSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAE 281
             ++ I V +IKE   +++ +  FE         K ++    NTS          V   +
Sbjct: 215 NSEQEI-VRTIKEKANYVALDYKFEE-------EKFFIHERENTS---------TVKLPD 257

Query: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341
            Q +      +   E  F P++       + E +LESI+ +   +R  ++ NIV++GG  
Sbjct: 258 GQELTFGKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLRTQLLENIVLSGGTT 317

Query: 342 NIPNFASRLATELQRQCPTDWSCRV-SLPKGD----------AGLYGWKCMQKFSETEDY 390
            +  F  R  +E ++  P     ++ SL +            +GLYG++ +    E  + 
Sbjct: 318 MLKGFDQRTMSETKKMLPKHTKVKIRSLAERSYIAWIGGSILSGLYGFRNLWLTREMYEE 377

Query: 391 HESRVTRQ 398
             S V R+
Sbjct: 378 DPSMVHRK 385

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 74/165 (44%), Gaps = 18/165 (10%)

Query: 264 NTSFQGYLRKPGQVLPAESQTIVLQDELFA------VPETFFHPEIASLLNSGIVE---- 313
           N++   +LR P    P +S+    Q ++        VPE  F P +     +GI+E    
Sbjct: 589 NSTLHLFLRGPR---PFDSENSHEQHQMHMNIERPRVPEILFQPRMGGCDQAGIIELSET 645

Query: 314 TILESISMLPEAIRP---LMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLPK 370
            +L+     P  +      M  N+ ITGG+  +P   +R+  E     P D    V++ K
Sbjct: 646 MLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQLPGLKTRIVKEFTSFLPNDAKFSVNISK 705

Query: 371 GDAGLYGWKCMQKFSETE-DYHESRVTRQEYYEHGVDWCTAKRFG 414
               L  WK M KFS  + D+  S ++++EY E+G ++    R G
Sbjct: 706 H-PSLDAWKGMAKFSSDDADFKSSLISKKEYEEYGPEYIKEHRLG 749

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 74/165 (44%), Gaps = 18/165 (10%)

Query: 264 NTSFQGYLRKPGQVLPAESQTIVLQDEL------FAVPETFFHPEIASLLNSGIVE---- 313
           N+    +LR P    P +S+ I  Q ++        VPE  F P +     +GI E    
Sbjct: 588 NSILHLFLRGPR---PHDSENIHEQHQMHLNVERIRVPEVIFQPTMGGQDQAGICELSET 644

Query: 314 TILESISMLPEAIRPL---MVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLPK 370
            +L+     P  +      MV N++ITGGN  +P    R+  E     PT  +  V++  
Sbjct: 645 ILLKKFGSQPGKLSQTSIDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTGTNITVNM-S 703

Query: 371 GDAGLYGWKCMQKFSETED-YHESRVTRQEYYEHGVDWCTAKRFG 414
            D  L  WK M   +  E+ Y ++ ++++EY E+G ++    + G
Sbjct: 704 SDPSLDAWKGMAALARNEEQYRKTVISKKEYEEYGPEYIKEHKLG 748

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 63/143 (44%), Gaps = 11/143 (7%)

Query: 281 ESQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLP--------EAIRPLMVG 332
           E   + L  E   VPE  F P I  L  +GIVE + E++ +            I  +M  
Sbjct: 600 EQHQMHLNVERIRVPEVIFQPSIGGLDQAGIVE-LCETLLLKKFGSNRRELSEISKMMAK 658

Query: 333 NIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFS-ETEDYH 391
           NI ITGGN  +P    R+  E     P   +  V L + D  +  W+ M KF+  T  Y 
Sbjct: 659 NIFITGGNAKLPGIRERVVREFTGFLPVGTNLNVKLAE-DPSMSAWRGMAKFANNTSLYE 717

Query: 392 ESRVTRQEYYEHGVDWCTAKRFG 414
            S +T++EY E G ++      G
Sbjct: 718 TSIMTKKEYEELGPEYIKEHNLG 740

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 75/167 (44%), Gaps = 22/167 (13%)

Query: 264 NTSFQGYLRKPGQVLPAESQTIVLQDEL------FAVPETFFHPEIASLLNSGIVE---- 313
           N+    +LR P    P +S+ I  Q ++        VPE  F P +     +GI E    
Sbjct: 588 NSILHLFLRGPR---PHDSENIHEQHQMHLNVERIRVPEVVFQPTLGGQDQAGICELSET 644

Query: 314 TILESISMLPEAIRPL---MVGNIVITGGNFNIPNFASRLATELQRQCP--TDWSCRVSL 368
            +L+     P  +      MV N+ ITGGN  +P    R+  E     P  T++S  +S 
Sbjct: 645 ILLKKFGSQPGKLSSTSLDMVNNVFITGGNSKVPGLRERIVREFTEFLPVGTNFSVNMS- 703

Query: 369 PKGDAGLYGWKCMQKFSET-EDYHESRVTRQEYYEHGVDWCTAKRFG 414
              D  L  WK M   ++  E+Y ++ ++++EY E+G D+    + G
Sbjct: 704 --SDPSLDAWKGMAALAQNKEEYKKTVISKKEYEEYGPDYIKEHKLG 748

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 38/76 (50%), Gaps = 2/76 (2%)

Query: 169 NDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLRE--ALSFRHYNVMDET 226
           N   LVID G   + ++PV+ G       K+++ GGR    +L +  AL + ++      
Sbjct: 181 NKTGLVIDCGHEDTNVIPVVDGTGVLTDAKRINWGGRQAVDYLSDLMALKYPYFPTKLSY 240

Query: 227 ILVNSIKENCLFMSPN 242
           +   ++ ++  ++SPN
Sbjct: 241 LQYETMYQDYCYVSPN 256

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 72/164 (43%), Gaps = 17/164 (10%)

Query: 264 NTSFQGYLRKP----GQVLPAESQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESI 319
           N+    +LR P    G+ +  + Q + L  E    PE  F P +  L  +GI E + + I
Sbjct: 582 NSVLHLFLRGPRPHNGEDVHQQHQ-LHLNIERIRAPEVIFQPSMGGLDQAGIAE-LADGI 639

Query: 320 ---------SMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLPK 370
                    S L +     M  NI ITGGN  IPN   R+  E     P +    V+  +
Sbjct: 640 LTKKFGSGSSKLSQQCLD-MASNIFITGGNTKIPNLRERIVNEFTGFLPVNTPLNVNYAQ 698

Query: 371 GDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFG 414
            +  L  WK M KF+ ++ Y  + VT+ EY E G ++    + G
Sbjct: 699 -NVSLDAWKGMAKFARSDTYSSTCVTKVEYEEFGPNYIKEHKLG 741

 Score = 37.4 bits (85), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 85/235 (36%), Gaps = 61/235 (25%)

Query: 4   SPLIIDNGSYEIKFGSGSEKEP----------------HRALNSIAKDKYGNYHLSNQVR 47
           +P+ +D GSYE++ G  S+  P                 +AL  I  D      L N VR
Sbjct: 40  TPIALDFGSYEVRAGFTSQDTPSHVFPTKIVRYKERKIQKALTFIGND----CSLDNAVR 95

Query: 48  SIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKG--KHLITSESC 105
           S           P++   + +WE    +  Y       F+   +    G    +I +E  
Sbjct: 96  SHS-------RSPYDGSLITNWEYMEDMLSYT------FHHLGVQPNDGISNPMILTEKM 142

Query: 106 MTIPELSKNMDQVVFEEYEFETMFKAPVPVFVPF-NTGKKSTHMLVAKEDSEVEESEVAP 164
            T+     N  Q++FE Y    +      +F  + N    ST                  
Sbjct: 143 ATVQAQRSNWYQLLFECYGIPQVTFGIDGLFSFYANNSPDSTG----------------- 185

Query: 165 AKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 219
                   L+I+SG   + I+PVIKG       K++D GG     +L+  LS ++
Sbjct: 186 --------LIINSGHEDTNIIPVIKGKGILSEAKRIDWGGNQSIDYLKSLLSLKY 232

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 108/253 (42%), Gaps = 39/253 (15%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETI-LVNSI 232
           VIDSG   + ++PV +G     A+K + I GR +  F++  L  R     D ++     I
Sbjct: 212 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEQDASLRTAERI 269

Query: 233 KENCLFMSPNAY--FESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDE 290
           K+   ++ P+    F  F   S+   ++++ +   + +              + + +  E
Sbjct: 270 KQEYCYVCPDIVKEFNKFDRDSEKFAQFIVENKERTTK--------------KVVDVGYE 315

Query: 291 LFAVPETFFHPEIASL-LNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASR 349
            F  PE FF+PEIAS    + +   + E+I   P  +R  +  NIV++GG+    +F  R
Sbjct: 316 RFLAPEIFFNPEIASSDFLTPLPVVVDETIQACPIDVRKGLYNNIVLSGGSTMFKDFGRR 375

Query: 350 LATELQ----------------RQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHES 393
           L  +L+                R    D S      + +A  +G   + +  E + Y   
Sbjct: 376 LQRDLKGIVNDRISQSEKLSGTRSTGVDVSVISHKRQRNAVWFGGSLLAQTGEFKSYCH- 434

Query: 394 RVTRQEYYEHGVD 406
             T+Q+Y E+G D
Sbjct: 435 --TKQDYEEYGPD 445

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 87/203 (42%), Gaps = 34/203 (16%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIK 233
           VIDSG   + ++PV +G     A+K + I GR +  F++  L  R     D ++      
Sbjct: 214 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITEFIQSLL--RERGEADTSLRT---- 267

Query: 234 ENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQV--LPAESQTIVLQD-- 289
                            R K    YV PD    F  + R+P +      ESQ    Q   
Sbjct: 268 ---------------AERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIVESQEKTKQKVV 312

Query: 290 ----ELFAVPETFFHPEIASLLNSGIVETIL-ESISMLPEAIRPLMVGNIVITGGNFNIP 344
               E F  PE FF+PEIAS      + T++ ++I   P  +R  +  NIV++GG+    
Sbjct: 313 DVGYERFLAPEIFFNPEIASSDYLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFK 372

Query: 345 NFASRLATELQRQCPTDWSCRVS 367
           +F+ R    LQR   +  + R+S
Sbjct: 373 DFSRR----LQRDMKSIVNARIS 391

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 73/166 (43%), Gaps = 20/166 (12%)

Query: 264 NTSFQGYLRKPGQVLPAESQTIVLQDELF------AVPETFFHPEIASLLNSGIVETILE 317
           N+    +LR P    P +S+ I  Q ++        VPE  F P +     +GI E + E
Sbjct: 588 NSILHLFLRGPR---PHDSENIHEQHQMHLNVERTRVPEIVFQPTMGGQDQAGICE-LAE 643

Query: 318 SISMLPEAIRP--------LMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLP 369
           +I +     +P         M  N+ ITGGN  +P    R+  E     P   +  +++ 
Sbjct: 644 TILLKKFGSQPGKLSQTSIDMANNVFITGGNAKVPGLKERIVKEFTGFLPVGTNININM- 702

Query: 370 KGDAGLYGWKCMQKFSETED-YHESRVTRQEYYEHGVDWCTAKRFG 414
             D  L  WK M   ++ E+ Y  + ++R+EY E+G D+    + G
Sbjct: 703 SSDPSLDAWKGMAALAQNEEEYKRTIISRKEYEEYGPDYIKEHKLG 748

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 63/257 (24%), Positives = 106/257 (41%), Gaps = 51/257 (19%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIK 233
           VIDSG   + ++PV +G     A+K + I GR +  F++  L  R     D ++      
Sbjct: 214 VIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRDITLFIQSLL--RERGEADSSLKT---- 267

Query: 234 ENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQ----VLPAESQT----I 285
                            R K    YV PD    F  + R+P +    ++  + +T    I
Sbjct: 268 ---------------AERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIIENQDKTTKKVI 312

Query: 286 VLQDELFAVPETFFHPEIASLLNSGIVETIL-ESISMLPEAIRPLMVGNIVITGGNFNIP 344
            +  E F  PE FF+PEIAS      + T++ ++I   P  +R  +  NIV++GG+    
Sbjct: 313 DIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFK 372

Query: 345 NFASRLATELQRQCPTDWSCRVSLPKGDAGLYG-----------------WKCMQKFSET 387
           +F+ R    LQR   +  S R++  +   G                    W      ++T
Sbjct: 373 DFSRR----LQRDVKSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAVWFGGSLLAQT 428

Query: 388 EDYHESRVTRQEYYEHG 404
            ++     T+++Y EHG
Sbjct: 429 AEFKGYCHTKKDYEEHG 445

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 84/191 (43%), Gaps = 30/191 (15%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIK 233
           VIDSG   + ++PV +G     A+K + I GR +  F++  L  R    +D ++      
Sbjct: 212 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLRT---- 265

Query: 234 ENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQ-----VLPAESQTIVLQ 288
                            R K    YV PD    F  + R  G+     V  +ES    + 
Sbjct: 266 ---------------AERIKQEYCYVCPDIVKEFNKFDRDAGKFAQFIVENSESTKKKIV 310

Query: 289 D---ELFAVPETFFHPEIASLLNSGIVETIL-ESISMLPEAIRPLMVGNIVITGGNFNIP 344
           D   E F  PE FF+PEIAS      + T++ ++I   P  +R  +  NIV++GG+    
Sbjct: 311 DVGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFK 370

Query: 345 NFASRLATELQ 355
           +F  RL  +L+
Sbjct: 371 DFGRRLQRDLK 381

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 81/191 (42%), Gaps = 30/191 (15%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIK 233
           VIDSG   + ++PV +G     A+K + I GR +  F++  L  R     D ++      
Sbjct: 209 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFIQTLL--RERGEADTSLRT---- 262

Query: 234 ENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVL--------PAESQTI 285
                            R K    YV PD    F  + R P +            + + +
Sbjct: 263 ---------------AERIKQEYCYVCPDIVKEFNKFDRDPEKFAQYVVENQEKTQKKVV 307

Query: 286 VLQDELFAVPETFFHPEIASLLNSGIVETIL-ESISMLPEAIRPLMVGNIVITGGNFNIP 344
            +  E F  PE FF+PEIAS      + TI+ ++I   P  +R  +  NIV++GG+    
Sbjct: 308 DVGYERFLAPEIFFNPEIASSDFLTPLPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFK 367

Query: 345 NFASRLATELQ 355
           +F  RL  +L+
Sbjct: 368 DFGRRLQRDLK 378

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 87/184 (47%), Gaps = 16/184 (8%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETI-LVNSI 232
           VIDSG   + ++PV +G     A+K + I GR +  F+++ L  R     D ++     I
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEQDTSLKTAERI 267

Query: 233 KENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELF 292
           K+   ++ P+   E F    + A ++    F    Q   RK         + + +  E F
Sbjct: 268 KQEYCYVCPDIVKE-FNKFDRDASKFA--QFVVESQEKTRK---------KIVDVGYERF 315

Query: 293 AVPETFFHPEIASLLNSGIVETIL-ESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLA 351
             PE FF+PEIAS      + T++ E+I   P  +R  +  NIV++GG+    +F  RL 
Sbjct: 316 LAPEIFFNPEIASSDFLTPLPTVVDETIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQ 375

Query: 352 TELQ 355
            +++
Sbjct: 376 RDMK 379

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 71/165 (43%), Gaps = 20/165 (12%)

Query: 264 NTSFQGYLRKPGQVLPAESQTIVLQDEL------FAVPETFFHPEIASLLNSGIVETILE 317
           N+ F  +LR P    P +S+ I  Q ++        VPE  F P +     +GI E I E
Sbjct: 588 NSVFHLFLRGP---RPHDSENIHEQHQMHINVERIRVPEVMFQPILGGQDQAGITE-ICE 643

Query: 318 SISMLPEAIRPL--------MVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLP 369
           +I        P         M  N+ + GGN  +P   SR+  E     P+D    V++ 
Sbjct: 644 TIITKKFGSTPRNLSQQSLDMAKNVWLVGGNAQVPGLKSRVVKEFTEFLPSDTKINVNIS 703

Query: 370 KGDAGLYGWKCMQKFSET-EDYHESRVTRQEYYEHGVDWCTAKRF 413
           +    L  W  M + + T EDY  + VT +EY E GVD+    + 
Sbjct: 704 EA-PTLDVWNGMYRLANTEEDYQRTIVTSEEYDECGVDYLKEHKL 747

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 88/186 (47%), Gaps = 20/186 (10%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETI-LVNSI 232
           VIDSG   + ++PV +G     A+K + I GR +  F+++ L  R     D ++     I
Sbjct: 217 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEEDTSLRTAERI 274

Query: 233 KENCLFMSPNAY--FESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDE 290
           K+   ++ P+    F  F   S+   ++V+       Q   R+         + + +  E
Sbjct: 275 KQEYCYVCPDIVKEFNKFDRDSEKFAQFVVES-----QEKTRR---------KVVDVGCE 320

Query: 291 LFAVPETFFHPEIASLLNSGIVETILE-SISMLPEAIRPLMVGNIVITGGNFNIPNFASR 349
            F  PE FF+PEIAS      + TI++ +I   P  +R  +  NIV++GG+    +F  R
Sbjct: 321 RFMAPEIFFNPEIASSDFLTPLPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRR 380

Query: 350 LATELQ 355
           L  +L+
Sbjct: 381 LQRDLK 386

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 81/191 (42%), Gaps = 30/191 (15%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIK 233
           VIDSG   + ++PV +G     A+K + I GR +  F++  L  R     D ++      
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGETDTSLRT---- 258

Query: 234 ENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVL--------PAESQTI 285
                            R K    YV PD    F  + R P +            + + +
Sbjct: 259 ---------------AERIKQEYCYVCPDIVKEFNKFDRNPDKFAQFIVENQEKTQKKIV 303

Query: 286 VLQDELFAVPETFFHPEIASLLNSGIVETILE-SISMLPEAIRPLMVGNIVITGGNFNIP 344
            +  E F  PE FF+PEIAS      + TI++ +I   P  +R  +  NIV++GG+    
Sbjct: 304 DVGYERFLAPEIFFNPEIASSDFLTPLPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFK 363

Query: 345 NFASRLATELQ 355
           +F  RL  +++
Sbjct: 364 DFGRRLQRDIK 374

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 88/186 (47%), Gaps = 20/186 (10%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETI-LVNSI 232
           VIDSG   + ++PV +G     A+K + I GR +  F++  L  R    +D ++     I
Sbjct: 214 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLKTAERI 271

Query: 233 KENCLFMSPNAY--FESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDE 290
           K+   ++ P+    F  F        ++++ +     QG  +K         + + +  E
Sbjct: 272 KQEYCYVCPDIVKEFNKFDRDVGKFSQFIIEN-----QGKTQK---------KIVDVGYE 317

Query: 291 LFAVPETFFHPEIASLLNSGIVETILE-SISMLPEAIRPLMVGNIVITGGNFNIPNFASR 349
            F  PE FF+PEIAS      + TI++ +I   P  +R  +  NIV++GG+    +F  R
Sbjct: 318 RFLAPEIFFNPEIASSDFLTPLPTIVDHTIQACPIDVRKGLYSNIVLSGGSTMFKDFGRR 377

Query: 350 LATELQ 355
           L  +L+
Sbjct: 378 LQRDLR 383

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 86/193 (44%), Gaps = 34/193 (17%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIK 233
           VIDSG   + ++PV +G     A+K + I GR +  F++  L  R     D         
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEAD--------- 253

Query: 234 ENCLFMSPNAYFESFQSRSKTAKE--YVLPDFNTSFQGYLRKPGQ----VLPAESQT--- 284
                        S ++  K  +E  YV PD    F  + R P +    V+  + +T   
Sbjct: 254 ------------TSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRK 301

Query: 285 -IVLQDELFAVPETFFHPEIASLLNSGIVETIL-ESISMLPEAIRPLMVGNIVITGGNFN 342
            + +  E F  PE FF+PEIAS      + T++ ++I   P  +R  +  NIV++GG+  
Sbjct: 302 VVDIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTM 361

Query: 343 IPNFASRLATELQ 355
             +F  RL  +L+
Sbjct: 362 FKDFGRRLQRDLK 374

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 86/193 (44%), Gaps = 34/193 (17%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIK 233
           VIDSG   + ++PV +G     A+K + I GR +  F++  L  R     D         
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEAD--------- 253

Query: 234 ENCLFMSPNAYFESFQSRSKTAKE--YVLPDFNTSFQGYLRKPGQ----VLPAESQT--- 284
                        S ++  K  +E  YV PD    F  + R P +    V+  + +T   
Sbjct: 254 ------------TSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRK 301

Query: 285 -IVLQDELFAVPETFFHPEIASLLNSGIVETIL-ESISMLPEAIRPLMVGNIVITGGNFN 342
            + +  E F  PE FF+PEIAS      + T++ ++I   P  +R  +  NIV++GG+  
Sbjct: 302 AVDIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTM 361

Query: 343 IPNFASRLATELQ 355
             +F  RL  +L+
Sbjct: 362 FKDFGRRLQRDLK 374

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 83/191 (43%), Gaps = 30/191 (15%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIK 233
           VIDSG   + ++PV +G     A+K + I GR +  F++  L  R     D ++      
Sbjct: 216 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRT---- 269

Query: 234 ENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVL--------PAESQTI 285
                            R K    YV PD    F  + R+P +            + + +
Sbjct: 270 ---------------AERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIIENQDKTKQKVV 314

Query: 286 VLQDELFAVPETFFHPEIASLLNSGIVETILE-SISMLPEAIRPLMVGNIVITGGNFNIP 344
            +  E F  PE FF+PEIAS      + T+++ +I   P  +R  +  NIV++GG+    
Sbjct: 315 DIGYERFLAPEIFFNPEIASSDFLTPLPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFK 374

Query: 345 NFASRLATELQ 355
           +F+ RL  +++
Sbjct: 375 DFSRRLQRDIK 385

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 72/167 (43%), Gaps = 22/167 (13%)

Query: 264 NTSFQGYLRKPGQVLPAESQTIVLQDEL------FAVPETFFHPEIASLLNSGI---VET 314
           N+    +LR P    P + ++I  Q ++        VPE  F P +     +GI    ET
Sbjct: 582 NSVLHLFLRGP---RPHDGESIHHQHQMHMNIERIRVPEVLFQPNMGGEDQAGIPELCET 638

Query: 315 IL----ESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTD--WSCRVSL 368
           +L     S       +   M  N+ ITGGN  +P    R+  E     P+   +S R S 
Sbjct: 639 LLLRKFGSTQRQLSDVSTSMAQNVWITGGNAKLPGLRERIVKEFSEFLPSGSPFSIRKS- 697

Query: 369 PKGDAGLYGWKCMQKFSE-TEDYHESRVTRQEYYEHGVDWCTAKRFG 414
              D  L  W+ M K ++ TED+    +T+QEY E+G ++      G
Sbjct: 698 --QDPSLDAWRGMAKLAQNTEDFKHGYITKQEYLEYGPEYIKEHNLG 742

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 87/186 (46%), Gaps = 20/186 (10%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETI-LVNSI 232
           VIDSG   + ++PV +G     A+K + I GR +  F++  L  R    +D ++     I
Sbjct: 218 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLKTAERI 275

Query: 233 KENCLFMSPNAY--FESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDE 290
           K+   ++ P+    F  F        ++++ +     Q   RK         + + +  E
Sbjct: 276 KQEYCYVCPDIVKEFNKFDRDGSKFAQFIVEN-----QEQTRK---------KVVDVGYE 321

Query: 291 LFAVPETFFHPEIASLLNSGIVETILE-SISMLPEAIRPLMVGNIVITGGNFNIPNFASR 349
            F  PE FF+PEIAS      + T+++ +I   P  +R  +  NIV++GG+    +F  R
Sbjct: 322 RFLAPEIFFNPEIASSDFLTPLPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRR 381

Query: 350 LATELQ 355
           L  +L+
Sbjct: 382 LQRDLK 387

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 85/193 (44%), Gaps = 34/193 (17%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIK 233
           VIDSG   + ++PV +G     A+K + I GR +  F++  L  R     D         
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEAD--------- 253

Query: 234 ENCLFMSPNAYFESFQSRSKTAKE--YVLPDFNTSFQGYLRKPGQ----VLPAESQT--- 284
                        S ++  K  +E  YV PD    F  + R P +    V+  + +T   
Sbjct: 254 ------------TSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRK 301

Query: 285 -IVLQDELFAVPETFFHPEIASL-LNSGIVETILESISMLPEAIRPLMVGNIVITGGNFN 342
            + +  E F  PE FF+PEIAS    + +   + ++I   P  +R  +  NIV++GG+  
Sbjct: 302 VVDIGYERFLAPEIFFNPEIASSDFLTPLPMVVDQTIQACPIDVRKGLYNNIVLSGGSTM 361

Query: 343 IPNFASRLATELQ 355
             +F  RL  +L+
Sbjct: 362 FKDFGRRLQRDLK 374

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 87/186 (46%), Gaps = 20/186 (10%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETI-LVNSI 232
           VIDSG   + ++PV +G     A+K + I GR +  F++  L  R     D ++     I
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERI 267

Query: 233 KENCLFMSPNAY--FESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDE 290
           K+   ++ P+    F  F    +   ++V+ +     Q   RK         + + +  E
Sbjct: 268 KQEYCYVCPDIVKEFNKFDRDGEKFAQFVVEN-----QESTRK---------KIVDVGYE 313

Query: 291 LFAVPETFFHPEIASLLNSGIVETIL-ESISMLPEAIRPLMVGNIVITGGNFNIPNFASR 349
            F  PE FF+PEIAS      + T++ ++I   P  +R  +  NIV++GG+    +F  R
Sbjct: 314 RFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRR 373

Query: 350 LATELQ 355
           L  +L+
Sbjct: 374 LQRDLK 379

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 86/193 (44%), Gaps = 34/193 (17%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIK 233
           VIDSG   + ++PV +G     A+K + I GR +  F++  L  R     D         
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEAD--------- 253

Query: 234 ENCLFMSPNAYFESFQSRSKTAKE--YVLPDFNTSFQGYLRKPGQ----VLPAESQT--- 284
                        S ++  K  +E  YV PD    F  + + P +    V+  + +T   
Sbjct: 254 ------------TSLRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTRRK 301

Query: 285 -IVLQDELFAVPETFFHPEIASLLNSGIVETIL-ESISMLPEAIRPLMVGNIVITGGNFN 342
            + +  E F  PE FF+PEIAS      + T++ ++I   P  +R  +  NIV++GG+  
Sbjct: 302 VVDIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTM 361

Query: 343 IPNFASRLATELQ 355
             +F  RL  +L+
Sbjct: 362 FKDFGRRLQRDLK 374

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 87/186 (46%), Gaps = 20/186 (10%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETI-LVNSI 232
           VIDSG   + ++PV +G     A+K + I GR +  F++  L  R    +D ++     I
Sbjct: 211 VIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITLFIQSLL--RERGEVDTSLRTAERI 268

Query: 233 KENCLFMSPNAY--FESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDE 290
           K+   ++ P+    F  F   +    ++++ +   +              + + + +  E
Sbjct: 269 KQEYCYVCPDIVKEFNKFDRDATKFAQFIVENKEKT--------------QKKVVDVGYE 314

Query: 291 LFAVPETFFHPEIASLLNSGIVETIL-ESISMLPEAIRPLMVGNIVITGGNFNIPNFASR 349
            F  PE FF+PEIAS      + T++ ++I   P  +R  +  NIV++GG+    +F  R
Sbjct: 315 RFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRR 374

Query: 350 LATELQ 355
           L  +L+
Sbjct: 375 LQRDLR 380

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 85/186 (45%), Gaps = 20/186 (10%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETI-LVNSI 232
           VIDSG   + ++PV +G     A+K + I GR +  F++  L  R     D T+     I
Sbjct: 201 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEEDTTLRTAERI 258

Query: 233 KENCLFMSPNAY--FESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDE 290
           K+   ++  +    F  F   S+   ++++ +   +                + I +  E
Sbjct: 259 KQEYCYVCSDIVKEFNKFDRDSEKFAQFIVENSEKT--------------RRKVIDVGYE 304

Query: 291 LFAVPETFFHPEIASLLNSGIVETIL-ESISMLPEAIRPLMVGNIVITGGNFNIPNFASR 349
            F  PE FF+PEIAS      + TI+ ++I   P  +R  +  NIV++GG+    +F  R
Sbjct: 305 RFLAPEIFFNPEIASSDFLTPLPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRR 364

Query: 350 LATELQ 355
           L  +L+
Sbjct: 365 LQRDLK 370

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 74/166 (44%), Gaps = 20/166 (12%)

Query: 264 NTSFQGYLRKPGQVLPAESQTIVLQDEL------FAVPETFFHPEIASLLNSGIVETILE 317
           N+    +LR P    P +S+ I  Q ++        VPE  F P +     +GI E + E
Sbjct: 588 NSLLHLFLRGPR---PHDSENIHEQHQMHLNVERIRVPEVVFQPTMGGQDQAGICE-LSE 643

Query: 318 SISMLP--------EAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLP 369
           +I M           +    MV NI+ITGGN  +P    R+  E     P   +  V++ 
Sbjct: 644 TILMKKFGSQRGKLSSTSLDMVNNILITGGNAKVPGLRERIVKEFTEFLPVGTNVAVNI- 702

Query: 370 KGDAGLYGWKCMQKFSETE-DYHESRVTRQEYYEHGVDWCTAKRFG 414
             +  L  W+ M   +  + +Y ++ ++++EY E+G D+    + G
Sbjct: 703 SSNPSLDAWRGMAALARNKAEYKKTVISKEEYEEYGPDYIKEHKLG 748

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 67/162 (41%), Gaps = 12/162 (7%)

Query: 264 NTSFQGYLRKP---GQVLPAESQTIVLQDELFAVPETFFHPEIASLLNSGIVE----TIL 316
           N+    +LR P       P +   I +  E   VPE  F P I     +GI E      L
Sbjct: 593 NSVLHLFLRGPRPHDSEDPHQQHQIHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFL 652

Query: 317 ESISMLPE---AIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLPKGDA 373
              +  P    +I   M+ N+ +TGG+  +P    R+  E     P      +++   D 
Sbjct: 653 RKFNSSPRKLSSISERMLNNVWLTGGHAKLPGLKERIVKEYTEFLPVGTKMSINI-SNDP 711

Query: 374 GLYGWKCMQKFSETEDYHES-RVTRQEYYEHGVDWCTAKRFG 414
            L  WK M K +   DY +  +VT+++Y E+G ++      G
Sbjct: 712 SLDTWKGMAKLASNTDYLKKIQVTKKDYEEYGPEYMMEHNLG 753

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/250 (22%), Positives = 101/250 (40%), Gaps = 42/250 (16%)

Query: 5   PLIIDNGSYEIKFGSGSEKEP-HRALNSIAKDKYGNYHLSNQVRSIKDISS------VVF 57
           P+ ID GSY +K G  ++  P H   N + +  Y +  L+  +  I + ++      +  
Sbjct: 38  PIAIDFGSYNVKAGYTNQSLPTHVFTNKLTR--YRDRKLAKTMTFIGNDTNLDQPLRIQA 95

Query: 58  NRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKG---KHLITSESCMTIPELSKN 114
            RP++   + +WE   +I+DY L +        + TT G     +I +E    +     N
Sbjct: 96  KRPYDGLFIANWEYAEEIFDYTLHH------LGVQTTNGSISNPIILTEKMACLQSQRAN 149

Query: 115 MDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLV 174
             Q++FE       F  P   F     G  S +                 A  +    LV
Sbjct: 150 WYQLLFE------TFDVPSATF-----GLDSLYAFYNN-----------CANPFESDGLV 187

Query: 175 IDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFR--HYNVMDETILVNSI 232
           I+ G   + IVP+++G       K+++ GGR    +L   L+ +  ++          ++
Sbjct: 188 INCGHEDTNIVPIVQGKGILTEAKRINWGGRHSTEYLSSLLTLKYPYFPTKLSEFQYQTM 247

Query: 233 KENCLFMSPN 242
            E+  ++SPN
Sbjct: 248 YEDFCYVSPN 257

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 74/165 (44%), Gaps = 18/165 (10%)

Query: 264 NTSFQGYLRKPGQVLPAESQTIVLQDEL------FAVPETFFHPEIASLLNSGI---VET 314
           N+    +LR P    P +S+ I  Q +L        VPE  F P I     +GI    ET
Sbjct: 585 NSVLHLFLRGP---RPHDSENIHEQHQLHLNVERIRVPEILFQPIIGGQDQAGISELCET 641

Query: 315 ILES-ISMLPEAIRPLMVG---NIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLPK 370
           IL +     P  +    +G   NI +TGG+  +P    R+  E     P      V + K
Sbjct: 642 ILSNKFGSKPRELSETSLGMAKNIWLTGGHSKLPGLRERIVKEFTGFLPVGTKLGVKMSK 701

Query: 371 GDAGLYGWKCMQKFSETE-DYHESRVTRQEYYEHGVDWCTAKRFG 414
            +  L  W  M+K ++ E DY +S +++++Y E+G ++    + G
Sbjct: 702 -NPSLDAWYGMRKLAQNEADYKDSIISKKDYEEYGAEYIKEHKLG 745

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 80/191 (41%), Gaps = 30/191 (15%)

Query: 174 VIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIK 233
           VIDSG   + ++PV +G     A+K + I GR +  F++  L  R     D T+      
Sbjct: 207 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEEDTTLRT---- 260

Query: 234 ENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVL--------PAESQTI 285
                            R K    YV  D    F  + R P +            + + I
Sbjct: 261 ---------------AERIKQEYCYVCSDIVKEFNKFDRDPQKFAQFIVENSEKTKRKVI 305

Query: 286 VLQDELFAVPETFFHPEIASLLNSGIVETIL-ESISMLPEAIRPLMVGNIVITGGNFNIP 344
            +  E F  PE FF+PEIAS      + T++ ++I   P  +R  +  NIV++GG+    
Sbjct: 306 DVGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFK 365

Query: 345 NFASRLATELQ 355
           +F  RL  +L+
Sbjct: 366 DFGRRLQRDLK 376

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 83/221 (37%), Gaps = 42/221 (19%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRPH 61
           E S ++ID GSY    G      P   L S+    YG Y      + I    S+   R  
Sbjct: 13  EVSAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGNKKIFSEQSIGIPRKD 68

Query: 62  -------ELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKN 114
                  E G ++ W+   + W + L N    N     +  G   + +E      E  K 
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALQNELYLN-----SNSGIPALLTEPVWNSTENRKK 123

Query: 115 MDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLV 174
             +V+ E  +FE  + AP    V F  G+ +                           LV
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNC--------------------------LV 157

Query: 175 IDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREAL 215
           +D G +   + P++ G+   K+ ++  I G+F+N  +++AL
Sbjct: 158 VDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 49/107 (45%), Gaps = 5/107 (4%)

Query: 310 GIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLP 369
           G+ + +  SI      +R  +  N+V+TGG  +IP  + RL TEL +  P+    R+ L 
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPS-LKFRI-LT 441

Query: 370 KG---DAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
            G   +     W      +    +H+  V ++EY E GV+     RF
Sbjct: 442 TGHTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 86/221 (38%), Gaps = 42/221 (19%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP- 60
           E S ++ID GSY    G      P   L S+    YG Y      ++I    S+   R  
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGKKNIFSEQSIGIPRKD 68

Query: 61  HEL------GQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKN 114
           +EL      G ++ W+   + W + L N    N     +  G   + +E      E  K 
Sbjct: 69  YELKPIVKDGLVIDWDTAQEQWQWALKNELYLN-----SNSGTPALLTEPVWNSTENRKK 123

Query: 115 MDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLV 174
             +V+ E  +FE  + AP    V F  G+ +                           LV
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNC--------------------------LV 157

Query: 175 IDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREAL 215
           +D G +   + P++ G+   K+ ++  + G+F+N  +++AL
Sbjct: 158 VDIGHDTCSVSPIVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 1/105 (0%)

Query: 310 GIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT-DWSCRVSL 368
           G+   +  SI      +R  +  N+V+TGG   IP  + RL TEL +  P+  +    + 
Sbjct: 384 GLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 369 PKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
              +     W      +    +H+  V ++EY E GV+     RF
Sbjct: 444 HTMERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 90/236 (38%), Gaps = 52/236 (22%)

Query: 2   EESPLIIDNGSYEIKFG-SGSE----------KEPHRALNSIAKDKYGNYHLSNQVRSIK 50
           E + +IID GSY    G +G++           E H A  S ++D   N   + + R + 
Sbjct: 13  EITAVIIDPGSYTTNIGYAGTDCPQSILPSSFGEIHEAEESTSED---NTEKTRKTRKVF 69

Query: 51  DISSVVFNRPH-------ELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSE 103
              S+   RP        E GQ+  W+   + W + L N        I++ +G   + +E
Sbjct: 70  SEQSIPIPRPDYEVKRVVENGQVCDWDSAVEQWSWALRNE-----LHIESNRGIPAMLTE 124

Query: 104 SCMTIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVA 163
                 E      +++ E  EFE  +       V F TG+ ++                 
Sbjct: 125 PLWNSKENRSKSLEILLEGMEFEACYLTATSTAVSFATGRPNS----------------- 167

Query: 164 PAKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 219
                    L++D G + + + PVI G+   K+ +     GRFLN  L + L  R 
Sbjct: 168 ---------LIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPRE 214

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 47/107 (43%), Gaps = 5/107 (4%)

Query: 310 GIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLP 369
           GIV+ I  SIS     IR  +  N+VITGG+  IP  + R+  EL  + P     RV L 
Sbjct: 388 GIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPA-LKFRV-LA 445

Query: 370 KGDA---GLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
            G +       W      S    +H+  + ++EY E G +     R 
Sbjct: 446 TGQSIERQYQSWLGGSILSSLGTFHQLWIGKKEYEEVGSERLLHDRL 492

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 84/221 (38%), Gaps = 42/221 (19%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRPH 61
           E S ++ID GSY    G      P   L S+    YG        ++I    S+   R  
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKSTSDKDSKTIFSEQSIGIPRKD 68

Query: 62  -------ELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKN 114
                  E G ++ W+   + W + L N        +D+  G   + +E      E  K 
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALKNE-----LYLDSNSGIPALLTEPVWNSTENRKK 123

Query: 115 MDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLV 174
             +V+ E  +FE  + AP    V F  G+ +                           LV
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNC--------------------------LV 157

Query: 175 IDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREAL 215
           +D G +   + P++ G+   K+ ++  I G+F+N  +++A+
Sbjct: 158 VDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAI 198

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 48/106 (45%), Gaps = 1/106 (0%)

Query: 309 SGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT-DWSCRVS 367
           +G+ + +  SI      +R  +  N+V+TGG  +IP  + RL TEL +  P+  +    +
Sbjct: 383 TGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTT 442

Query: 368 LPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
               +     W      +    +H+  V +QEY E GVD     RF
Sbjct: 443 GHTRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGVDRLLNDRF 488

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/239 (21%), Positives = 87/239 (36%), Gaps = 57/239 (23%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISS--VVFNR 59
           E S ++ID GSY    G      PH    SI   +YG++  +N+    +D  S      R
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDCPH----SILPSRYGSFKKTNKDSGDEDTKSDESATKR 68

Query: 60  PH--------------------ELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHL 99
            H                    E G +  W+   + W++ L N        +++TKG   
Sbjct: 69  AHIFSEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKNE-----LFLESTKGIPA 123

Query: 100 ITSESCMTIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEE 159
           + +E      +  K   + + E   FE  + AP    V F TG+ +              
Sbjct: 124 LLTEPVWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSFATGRANC------------- 170

Query: 160 SEVAPAKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFR 218
                        LV+D G +   + PV+ G+   K+ ++    G+++N  +   L  R
Sbjct: 171 -------------LVVDIGHDTCSVSPVVDGMTLSKSTRRSFFAGKYINHLIENFLKPR 216

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 43/105 (40%), Gaps = 1/105 (0%)

Query: 310 GIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT-DWSCRVSL 368
           G+ + +  SI      +R  +  N+ +TGG   IP  + RL  EL  + P   +    + 
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTG 459

Query: 369 PKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
            K +     W      +    +H+  V RQEY E G D     RF
Sbjct: 460 HKKEREYQSWLGGSVLTSLGTFHQLWVGRQEYEEVGADRLLNDRF 504

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 85/206 (41%), Gaps = 37/206 (17%)

Query: 14  EIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRPHELGQLVSWELET 73
           E+      E E + A N+ +K  +G   + N  R+  +I  +V N     G+++ W+   
Sbjct: 51  EVASEGNEEIEENSASNNKSKKIFGEQSI-NYPRADYEIKPIVKN-----GEVIDWDGAQ 104

Query: 74  QIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVFEEYEFETMFKAPV 133
           + WD+ L N        +++  G     +E      E  K   +V+ E  +FE  + +P 
Sbjct: 105 EQWDWALKN-----ALYLESNSGIPAFLTEPIWNTVENRKKSLEVLLEGLQFEACYLSPT 159

Query: 134 PVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFNCSWIVPVIKGVPY 193
           P  + F +G+ +                           LV+D G + + + PVI G+  
Sbjct: 160 PTCISFASGRPNC--------------------------LVVDIGHDVASVSPVIDGMTL 193

Query: 194 YKAVKKLDIGGRFLNGFLREALSFRH 219
            K+  +  I GRF+N  ++E L  R 
Sbjct: 194 SKSSMRNFISGRFINEKIKEFLKPRE 219

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 46/105 (43%), Gaps = 1/105 (0%)

Query: 310 GIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT-DWSCRVSL 368
           GIV+ I  SI      +R  +  NIV+TGG   IP F+ RL  EL ++ P   +    + 
Sbjct: 396 GIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKFRVLTTG 455

Query: 369 PKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
              +     W      S    +H+  V +QEY E G D     RF
Sbjct: 456 QTRERQYQAWLGGSILSSLGTFHQLWVGKQEYEESGADRLLKDRF 500

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 83/221 (37%), Gaps = 42/221 (19%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRPH 61
           E S ++ID GSY    G      P   L S+    YG        + +    S+   R  
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKLTADENSKKMFSEQSIGIPRKD 68

Query: 62  -------ELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKN 114
                  E G ++ W+   + W + L N        +D+  G   + +E      E  K 
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALRNE-----LYLDSNSGIPALLTEPVWNSMENRKK 123

Query: 115 MDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLV 174
             +V+ E  +FE  + AP    V F  G+ +                           LV
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNC--------------------------LV 157

Query: 175 IDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREAL 215
           +D G +   + P++ G+   K+ ++  I G+F+N  +++AL
Sbjct: 158 VDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIQKAL 198

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 5/108 (4%)

Query: 309 SGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSL 368
           +G+   +  SI      +R  +  N+V+TGG  +IP  + RL TEL +  P+    R+ L
Sbjct: 382 AGLAGLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPS-LKFRI-L 439

Query: 369 PKG---DAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
             G   +     W      +    +H+  V +QEY E G++     RF
Sbjct: 440 TTGHIRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGIERLLNDRF 487

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 86/230 (37%), Gaps = 47/230 (20%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDIS-----SVV 56
           E + ++ID GSY    G      P     SI    YG Y  + +  + K        S+ 
Sbjct: 11  EITSIVIDPGSYTTNIGYSGSDCPE----SIIPSSYGQYKDTAKEENQKKTKVFSEQSIG 66

Query: 57  FNRPH-------ELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIP 109
             RP        E G++  W+   + WD+ L N        + +  G  ++ +E      
Sbjct: 67  LARPDYEIKRIVENGEIADWDTAQEQWDWVLKNE-----LFLKSNSGIPVLLTEPIWNSV 121

Query: 110 ELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYN 169
           E  K   +V+ E  +FE  + +PV   V F  G+ +                        
Sbjct: 122 ENRKKSLEVLLEGMDFEACYLSPVSTCVSFAAGRPNC----------------------- 158

Query: 170 DFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 219
              LV+D G + + + PVI G+   K+  +  I GR++N  +   L  R 
Sbjct: 159 ---LVVDIGHDTTSVSPVIDGMTLSKSSTRNFIAGRYINHLIETYLKPRE 205

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 45/107 (42%), Gaps = 5/107 (4%)

Query: 310 GIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLP 369
           GI + +  SI      +R  +  N+VITGG   IP    RL  EL ++ P     R+ L 
Sbjct: 410 GIADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSKRLPA-LKFRI-LT 467

Query: 370 KG---DAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
            G   +     W      +    +H+  V ++EY E G D     RF
Sbjct: 468 TGHLREKQYQAWLGGSILTSLGTFHQLWVGKEEYKEVGADRLLVDRF 514

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 82/221 (37%), Gaps = 42/221 (19%)

Query: 6   LIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRPH---- 61
           ++ID GS+    G      P     SI    YGN       + I +   ++F R      
Sbjct: 17  IVIDPGSFVTNIGYSGTDCPQ----SIMPSSYGNVETDGDTKRIFNEQPLLFPRAGMEIK 72

Query: 62  ---ELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQV 118
              E   +V W+   + W+Y L N D       ++ KG  ++ +E         K   ++
Sbjct: 73  PIVENSTIVDWDRAQEQWEYAL-NTD----LKFESNKGTPVLLTEPIWNSEASRKKSLEI 127

Query: 119 VFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSG 178
           + E  EFE  + A     V F  G+ +                           LV+D G
Sbjct: 128 LLESMEFEACYLAANSSAVSFAMGRPTC--------------------------LVVDIG 161

Query: 179 FNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 219
            + S + PVI G+   K+  +  + G++LN  + + L  R 
Sbjct: 162 HDVSTVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPRE 202

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 47/106 (44%), Gaps = 1/106 (0%)

Query: 309 SGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT-DWSCRVS 367
           +GIV+ I +S+      +R  +  N+V+TGG   IP  + R+  EL +  P   +    S
Sbjct: 414 AGIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKFRMLSS 473

Query: 368 LPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
               +    GW      +    +H+  V R+EY E G +     RF
Sbjct: 474 GHLRERQYQGWLGGSILASLGTFHQLWVGREEYEEVGPERLLKDRF 519

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 50/232 (21%), Positives = 89/232 (38%), Gaps = 50/232 (21%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDIS-------- 53
           E + ++ID GS+    G      P   L S     YG++  +       + S        
Sbjct: 13  EITAVVIDPGSFTTNIGYSGTDCPQAILPSC----YGHHKTNENADGDDEKSKPKVFAEQ 68

Query: 54  SVVFNRPH-------ELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCM 106
           S+ F RP        E G +V W+   + WD+ L N        +++ KG   + +ES  
Sbjct: 69  SLTFPRPDYEIKPIVENGLVVDWDAAQEQWDWALRNV-----LHLESNKGVPALMTESIW 123

Query: 107 TIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAK 166
              E      +V+ E  +FE  + +  P  V F TG+ +                     
Sbjct: 124 NTMENKTKSLEVLLETLDFEACYISSTPTCVSFATGRPNC-------------------- 163

Query: 167 NYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFR 218
                 LV+D G + +   PV+ G+   ++ ++  I G+F++  + + L  R
Sbjct: 164 ------LVVDVGHDTASSSPVVDGMTLSRSTRRNFISGKFVDQLIGKYLQPR 209

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 51/108 (47%), Gaps = 5/108 (4%)

Query: 309 SGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSL 368
           +GI + +  SI+     +R  +  NIV+TGG+ ++P F+ RL  EL ++ P     RV L
Sbjct: 377 AGISDLVHSSITSADVDLRATLAHNIVLTGGSSSVPGFSDRLMNELTKKLPA-LKFRV-L 434

Query: 369 PKG---DAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
             G   +     W      +    +H+  V ++EY E G +     RF
Sbjct: 435 TTGHLRERQYQSWLGGSILTSLGSFHQLWVGKREYEEVGAERLLNDRF 482

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 81/223 (36%), Gaps = 37/223 (16%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNS-----IAKDKYGNYHLSNQVRSIKDISSVV 56
           E S ++ID GSY    G      P   + S        +K G    ++Q   +       
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGGEKEGKKSFNDQFMGMAR-PDFE 71

Query: 57  FNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMD 116
             R  E G +V WE   + W + + +   F  +     KG     +E+     E  K   
Sbjct: 72  IKRILEDGCVVDWEAAQEQWTWAIRDELKFGSF-----KGTPAFLTEAIWNSEENRKKSL 126

Query: 117 QVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVID 176
           +V+ E  EFE  + AP    V F  G+ +                           LV+D
Sbjct: 127 EVLLEGMEFEACYIAPTATCVSFAMGRPTC--------------------------LVVD 160

Query: 177 SGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 219
            G + + + PV+ G+   K+  +  + G+ LN  + + L  R 
Sbjct: 161 IGHDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIEKHLEPRE 203

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 53/112 (47%), Gaps = 9/112 (8%)

Query: 303 IASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT-D 361
           +A+L+N+ I+ET ++        +R  +  N+V+TGG+ +I   A RL TEL ++ P   
Sbjct: 377 LANLVNTAIMETDVD--------LRATLAHNLVVTGGSSSILGLADRLMTELNKKLPALK 428

Query: 362 WSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
           +    S    +     W      S    +H+  V RQEY E G +     RF
Sbjct: 429 FRILTSGHLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/223 (21%), Positives = 83/223 (37%), Gaps = 41/223 (18%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRPH 61
           E + ++ID GS+    G      P   L S     YG Y    +     + S  +  + +
Sbjct: 13  EITAVVIDPGSFTTNIGYSGTDCPQAILPSC----YGKYTEGEKDELFSEQSIGLPRKDY 68

Query: 62  EL------GQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNM 115
           E+      G++V WE   + WD+ + +   F     +T  G   + +E      E  K  
Sbjct: 69  EIHNIVQNGEVVDWEKAEKQWDWAIRSELRF-----ETNSGMPALLTEPIWNSEENRKKS 123

Query: 116 DQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVI 175
            +V+ E  +F   +  P    V F  G+ +                           LV+
Sbjct: 124 LEVLLESMDFSACYLVPTATAVSFAMGRPTC--------------------------LVV 157

Query: 176 DSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFR 218
           D G + + + PV+ G+   K+  +  I G  LN  +R  L+ R
Sbjct: 158 DIGHDVTSVCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPR 200

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 46/106 (43%), Gaps = 1/106 (0%)

Query: 309 SGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT-DWSCRVS 367
           SG+ + I  SI      +R  +  N+VITGG  ++P    R++ EL R  P   +    S
Sbjct: 373 SGLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPALKFRMLTS 432

Query: 368 LPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
               +    GW      +    +H+  V +QEY E G D     RF
Sbjct: 433 GQLRERQYQGWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 478

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 83/227 (36%), Gaps = 45/227 (19%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQ--VRSIKDISSVVFNR 59
           E S ++ID GSY    G      P   + S     YG Y    +   +S  D   ++  R
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQLNIPSC----YGQYTAGGKEGQKSFND-QFMIMPR 67

Query: 60  PH-------ELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELS 112
           P        E G +V WE   + W + + +   F     ++ KG     +E+     E  
Sbjct: 68  PDFEIKRILENGCVVDWEAAQEQWAWAIRDELKF-----ESFKGTPAFLTEAIWNPEENR 122

Query: 113 KNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQ 172
           K   +V+ E  EFE  + AP      F  G+ +                           
Sbjct: 123 KKSLEVLLEGMEFEACYIAPTATCTSFAMGRPTC-------------------------- 156

Query: 173 LVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 219
           LV+D G + + + PV+ G+   K+  +  + G+ LN  +   L  R 
Sbjct: 157 LVLDIGHDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIENHLKPRE 203

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 50/112 (44%), Gaps = 9/112 (8%)

Query: 303 IASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT-D 361
           +A L+N+ I  T ++        +R  +  N+V+TGG+ +IP    RL TEL ++ P   
Sbjct: 377 LADLVNTAITATDVD--------LRATLAHNLVVTGGSSSIPGLTDRLMTELNKKLPALK 428

Query: 362 WSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
           +    S    +     W      S    +H+  V RQEY E G +     RF
Sbjct: 429 FRILTSGHLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/222 (21%), Positives = 79/222 (35%), Gaps = 38/222 (17%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRPH 61
           E S ++ID GSY    G      P   L S   D         + + +    S+   R  
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDCPQAILPSCYGDYTNTDDPEGKKKKVFSEQSICIPRKD 72

Query: 62  -------ELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKN 114
                  E G ++ W+   + W + L N        + +  G   + +E      E  K 
Sbjct: 73  YEIKPIVENGVVIDWDAAQEQWSWALENQ-----LYLRSNSGIPALLTEPIWNTVENRKK 127

Query: 115 MDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLV 174
             +++ E  +FE  + A  P  V F TG+ S                           LV
Sbjct: 128 SLELLLEGMDFEACYLASTPTCVSFGTGRSSC--------------------------LV 161

Query: 175 IDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALS 216
           +D G +   + PV+ G+   K+ K+    G +LN  ++  +S
Sbjct: 162 VDLGHDTCSVSPVVDGMTLSKSTKRNFFAGGYLNELIKNYIS 203

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 48/111 (43%), Gaps = 3/111 (2%)

Query: 304 ASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWS 363
            SLL  G+ + +  SI      +R  +  N+V+TGG   IP  + RL  EL  + P    
Sbjct: 376 GSLL--GVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELNSRLPALKF 433

Query: 364 CRVSLPKGDAGLY-GWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
             ++        Y  W      +    +H+  V ++EY + GVD   A RF
Sbjct: 434 RMITTGHTRERQYQSWLGGSVLTSLGTFHQLWVGKEEYQDVGVDRLLADRF 484

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 83/240 (34%), Gaps = 66/240 (27%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNY-----------------HLSN 44
           E S ++ID GSY    G      P   L S    +YG Y                  L  
Sbjct: 13  EISAVVIDPGSYTTNIGYSGTDCPQVTLPS----RYGQYISEEEEKDEQEQQEDDRKLKQ 68

Query: 45  QV---------RSIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTK 95
           +V         R+   I  +V N     G ++ W+   + W + + +   F     ++TK
Sbjct: 69  KVFSEQSIGLPRNNYQIKPIVRN-----GSVIDWDSAQEQWSWAIQHELHF-----ESTK 118

Query: 96  GKHLITSESCMTIPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDS 155
           G     +E      E  K   +V+ E  EFE  F +P P  V F  G+ +          
Sbjct: 119 GMPAFLTEPIWNTEENRKKSLEVLLENMEFEACFLSPTPTCVSFAMGRPTC--------- 169

Query: 156 EVEESEVAPAKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREAL 215
                            LV+D G +   + PV+ G+   K+     I G  LN  L + L
Sbjct: 170 -----------------LVVDIGHDVCSVSPVVDGMTLSKSSTSNFIAGSLLNALLSKQL 212

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 43/106 (40%), Gaps = 1/106 (0%)

Query: 309 SGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT-DWSCRVS 367
           +G+ + I  SI      +R  +  N+V+TGG  +IP    R+  EL +  P   +    S
Sbjct: 391 AGLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNKSLPALKFRMLTS 450

Query: 368 LPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
               +     W      S    +H+  V +QEY E G       RF
Sbjct: 451 GHLKERQYQSWLGGSILSSLGTFHQLWVGKQEYEEVGASRLLKDRF 496

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 45/106 (42%), Gaps = 1/106 (0%)

Query: 309 SGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT-DWSCRVS 367
           SG+ + I  SI      +R  +  N+VITGG+ +IP    R+  EL +  P   +    S
Sbjct: 374 SGLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPALKFRMLTS 433

Query: 368 LPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
               +     W      +    +H+  V +QEY E G D     RF
Sbjct: 434 GQAREKQYQSWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 479

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 71/336 (21%), Positives = 125/336 (37%), Gaps = 58/336 (17%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP- 60
           E + +IID GS+    G      P   L S     YG Y    +  S+ +  S+   R  
Sbjct: 13  EITAIIIDPGSFNTNIGYSGTDCPQAILPSC----YGQYINDEEKPSLFNEQSIGLPRKD 68

Query: 61  HEL------GQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKN 114
           +E+      G++V W+   + W++ + +   F     ++ KG   + +E      +  K 
Sbjct: 69  YEIKEIVRSGEVVDWDKAQEQWEWAIKSVLLF-----ESNKGLPALLTEPIWNSEDNRKK 123

Query: 115 MDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLV 174
             +V+ E  +FE  +  P    V F  G+ +                           LV
Sbjct: 124 SLEVLLEGMDFEACYLTPTATAVSFAMGRPTC--------------------------LV 157

Query: 175 IDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVN---- 230
           +D G + + + PVI G+   K+  +  I G  LN  +R +L  R    + +         
Sbjct: 158 VDIGHDITSVSPVIDGMTLSKSSMRSFIAGGLLNELIRTSLKPREILPLFQVAKKRPEFV 217

Query: 231 ------SIKENCL-FMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKP-----GQVL 278
                  I  + L F++   +F+ F+          L  F +  +   ++      G+ L
Sbjct: 218 KRSFDYEIHPSLLNFVNERQFFQEFKETMLQVAPTSLTKFKSELEQLSKRSIEAPWGEDL 277

Query: 279 PAESQTIVLQDELFAVPETFFHPEIASLLNSGIVET 314
             +S+T     E    PET   PE   +   G+VET
Sbjct: 278 VFDSETRFNIAEQLFRPETAKFPEDWPISKDGVVET 313

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 61/158 (38%), Gaps = 31/158 (19%)

Query: 62  ELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVFE 121
           E G +  W++  + W + L          +D+ KG   + +E      +  K   +V+ E
Sbjct: 166 ENGMVADWDIAEEQWSWALREK-----LYMDSFKGIPALLTEPVWNTVQNRKKSLEVLLE 220

Query: 122 EYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFNC 181
           + EFE  +   +P  V F  GK +                           LV+D G + 
Sbjct: 221 KMEFEACYLTTIPTNVSFAAGKPNC--------------------------LVVDVGHDT 254

Query: 182 SWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 219
             + PVI G+   K+V++    GR+LN  L   +  R 
Sbjct: 255 CSVSPVIDGMTLTKSVRRNFFAGRYLNRLLENYIKPRE 292

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 60/141 (42%), Gaps = 2/141 (1%)

Query: 274 PGQVLPAESQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGN 333
           P + +    +  +   E   VP+     +I +++  GI + +  +++     +R  +  N
Sbjct: 456 PSENINENGKRSIEDGENVDVPKKSDKKDIDNII-PGIADLVEATVNSSDVDLRATLAHN 514

Query: 334 IVITGGNFNIPNFASRLATELQRQCPT-DWSCRVSLPKGDAGLYGWKCMQKFSETEDYHE 392
           +++TGG   IP  A RL  EL ++ P   +    S  + +     W      +    +H+
Sbjct: 515 VILTGGTSLIPGLADRLMYELNKKLPALKFRILSSGHRRERKYQAWLGGSILTSLGTFHQ 574

Query: 393 SRVTRQEYYEHGVDWCTAKRF 413
             V ++EY E G D     RF
Sbjct: 575 LWVGKREYEEVGPDRLLKDRF 595

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 86/232 (37%), Gaps = 49/232 (21%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNY-------HLSNQVRSIKDISS 54
           E + +IID GS+    G      P     SI    YG Y         + + + I   SS
Sbjct: 13  EITAVIIDPGSFSTNIGYSGTDYPQ----SILPSSYGTYKETTEGQESTTKRKRIFSESS 68

Query: 55  VVFNRPH-------ELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMT 107
           +   RP        E G ++ W+   + W + L +        + +T G   + +E    
Sbjct: 69  IQIPRPDYEIKRIVENGSIMDWDAAQEQWSWALKSQ-----LHLQSTSGIPALLTEPIWN 123

Query: 108 IPELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKN 167
             E  K   +++ E   FE  + + VP  V F  G+ +                      
Sbjct: 124 SVENRKKSLEILLEGMNFEACYLSSVPTCVSFAAGRPNC--------------------- 162

Query: 168 YNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 219
                LV+D G + + + PV+ G+   K+  +  I G+++N  + + L  R 
Sbjct: 163 -----LVVDIGHDTTSVSPVVDGMTLSKSSMRNFIAGKYINTLIEKYLQPRE 209

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 1/106 (0%)

Query: 309 SGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSL 368
           +G+ + +  +I      +R  +  N+V+TGG+ +IP  + RL  EL R+ P      +S 
Sbjct: 391 AGLADLVYSAIIKSDVDLRASLAHNVVLTGGSSSIPGLSDRLILELNRRLPALKFRILST 450

Query: 369 PKGDAGLY-GWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
                  Y  W      +    +H+  V + EY E GV+     RF
Sbjct: 451 GHTKERQYQAWLGGSILTSLGTFHQLWVGKNEYNEVGVERLLMDRF 496

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 65/151 (43%), Gaps = 22/151 (14%)

Query: 264 NTSFQGYLRKPGQVLPAESQTIVLQDEL------FAVPETFFHPEIASLLNSGIV---ET 314
           N++   +LR P    P +S+ I  Q ++        VPE  F P +     +GI+   ET
Sbjct: 585 NSTLHLFLRGPR---PHDSEDIHQQHQMHLNVERIRVPEILFQPSMGGQDQAGIIELCET 641

Query: 315 IL------ESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSL 368
           IL      E   + P A+   M  N+ ITGGN  +P    R+  E     P   +  V  
Sbjct: 642 ILTKKFGSEQRKLSPTAL--AMANNLWITGGNSKLPGMKERIVKEFTGFLPVGTAFNVK- 698

Query: 369 PKGDAGLYGWKCMQKFS-ETEDYHESRVTRQ 398
              +  L  W  M K +  +EDY  + ++++
Sbjct: 699 QSYNPSLDAWNGMAKLTLNSEDYKNTIISKK 729

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 48/107 (44%), Gaps = 5/107 (4%)

Query: 310 GIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLP 369
           GIV+ I  SI+     +R  +  N+V+TGG   IP  + R+  EL ++ P     RV L 
Sbjct: 398 GIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPA-LKFRV-LA 455

Query: 370 KG---DAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
            G   +     W      S    +H+  V +QEY E G D     RF
Sbjct: 456 NGQTRERQYQSWLGGSILSSLGTFHQLWVGKQEYEEIGADRLLTDRF 502

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 61/156 (39%), Gaps = 31/156 (19%)

Query: 64  GQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVFEEY 123
           G++V W+   + W + L N        + + +G   + +E      E  K   +V+ E  
Sbjct: 101 GEVVDWDAAQEQWSWALENE-----LFLKSNEGVPALLTEPIWNTVENRKKSLEVLLEGM 155

Query: 124 EFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFNCSW 183
            FE  + +  P  V F  G+ +                           LV+D G +   
Sbjct: 156 GFEACYLSATPTCVSFAAGRSNC--------------------------LVVDIGHDIIS 189

Query: 184 IVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 219
           + PV+ G+ + K+ ++  I G++LN  + + L  R 
Sbjct: 190 VSPVVDGMTFSKSTRRNVISGKYLNVLINDFLKPRE 225

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 54/113 (47%), Gaps = 13/113 (11%)

Query: 304 ASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWS 363
           A L+N+ I+ + ++        +R  +  NIV+TGG  +IP F+ RL +EL ++ P    
Sbjct: 377 ADLVNASILASDVD--------LRATLAHNIVLTGGTSSIPGFSDRLMSELNKKLPA-LK 427

Query: 364 CRVSLPKG---DAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRF 413
            R+ L  G   +     W      +    +H+  V +QEY E G D   + RF
Sbjct: 428 FRI-LTTGHLRERQYQAWLGGSILTSLGSFHQLWVGKQEYEEVGPDRLLSDRF 479

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 43/224 (19%), Positives = 84/224 (37%), Gaps = 45/224 (20%)

Query: 2   EESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDI---SSVVFN 58
           E + ++ID GS+    G      P   L S     YG      +  + K I    S+   
Sbjct: 13  EITAVVIDPGSFSTNIGFSGTDCPQAILPSC----YGEQKAETEDNAPKKIFAEQSIGIP 68

Query: 59  RPH-------ELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPEL 111
           RP        +   +V W+   + W + L +    N      +    L+T     T+   
Sbjct: 69  RPDYEIKPIVQNSMVVDWDAAEEQWSWALKDILYLNS----NSGIPALLTEPIWNTLENK 124

Query: 112 SKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDF 171
           +K++ +++ E  +FE  + +  P  V F +G+ +                          
Sbjct: 125 TKSL-EILLESLQFEACYLSSTPTCVSFASGRPNC------------------------- 158

Query: 172 QLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREAL 215
            LV+D G + + + PV+ G+   K+  +  + G  +N  +++ L
Sbjct: 159 -LVVDLGHDTTSVSPVVDGMTLSKSTMRNFLAGNCINELIKKPL 201

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 73/339 (21%), Positives = 127/339 (37%), Gaps = 76/339 (22%)

Query: 132 PVPVFVP--FNTGKKSTHMLVAKEDSEV-------EESEVAPAKNYNDFQLVIDSGFNCS 182
           P+ + VP   + G +S ++ +A E  +V       E   ++ +   N   LV+D G +  
Sbjct: 92  PLVITVPPDLSAGTRSKYLELALEKLKVPVFQMVVEPLAISLSLGRNT-SLVVDIGASKI 150

Query: 183 WIVPVIKGVPYYKAVKKLDIGGRFLNGFLREAL-----------------SFRHYNVMDE 225
            + P+I G     AV +    G FL+  + E L                 SF+++     
Sbjct: 151 TVTPIIDGSVVKPAVLRSKFAGDFLDYQVAENLKNSLPIEPAGEDSKVPESFKYWE--SS 208

Query: 226 TILVNSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTI 285
              ++  K   L +SP+   +  +    T      P  N  +  +L K G      ++T+
Sbjct: 209 RTWIHDFKATMLQVSPSK-IQELEGMQDTMAFSHNPLDNKKY--FLYKKG------NKTL 259

Query: 286 VL-QDELFAVPETFFHPEIAS---LLNSGIVETILESI---------------------- 319
            L Q E + + E  F P++AS       G+ E +++++                      
Sbjct: 260 TLEQRECYKLAEMLFQPQLASDQFAAKEGLAELVVKAVKKAGAAVTTSNSGPAGGGGPSG 319

Query: 320 ----------SMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLP 369
                     +  PE I   ++ NIVITG    +P    R+  EL  Q P       + P
Sbjct: 320 SSSMGIGASSTTTPEQIHAALLTNIVITGSTSLVPGVEQRIVNELSYQFPQYKLSSFANP 379

Query: 370 KG-DAGLYGWKCMQKFSETEDYHESR-VTRQEYYEHGVD 406
              D  L  W+     S    +     +TRQEY  +G++
Sbjct: 380 MVLDRKLQSWQGGVTMSNLPSWELGNWITRQEYDANGIN 418

>Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {ON}
           YPR034W (ARP7) - actin related protein, subunit of the
           chromatin remodeling Snf/Swi complex [contig 35] PARTIAL
          Length = 351

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 83/208 (39%), Gaps = 23/208 (11%)

Query: 173 LVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSI 232
           L++D G   + + PVI G     A+ +    G FL+  + + LS +      E     + 
Sbjct: 94  LIVDLGAAKATVTPVIDGTVVQAAIGRSRFAGDFLDLQVGKLLSEKDDKQNGEESHEPTP 153

Query: 233 KENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGY--LRKPGQVLPAESQTI-VLQD 289
            E  L+ +   + + F+S         L D +++      L      L    +TI ++Q 
Sbjct: 154 LE--LWRNSRTWIQDFKSYMLQVAPSKLQDLDSAALDMMGLSYVKNFLYRRQKTISLMQK 211

Query: 290 ELFAVPETFFHPEIAS---LLNSGIVETILESI---------------SMLPEAIRPLMV 331
           E  A+ E  F P   S     + G+ E + +++               +  PE I   ++
Sbjct: 212 ECCALAEGLFQPSYVSQQFASSEGLSEIVAKAVKKAGASTATNSSATNATTPEQIHAALL 271

Query: 332 GNIVITGGNFNIPNFASRLATELQRQCP 359
            NIVITG +  IP    R+  +L  Q P
Sbjct: 272 TNIVITGSSSLIPGLEQRIVNDLSYQFP 299

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 80/202 (39%), Gaps = 36/202 (17%)

Query: 173 LVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSI 232
           LVID   + S + P++ GV     + K   GG FL+  +      + ++ +DE +     
Sbjct: 156 LVIDISGSGSSVTPIVDGVIIKNGIVKSKYGGDFLDYQI-----IKKFSTIDEDLEEEMT 210

Query: 233 KENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQD--- 289
             + +++S N++ ++F+       +  L D    ++  LR   ++    S T V  +   
Sbjct: 211 NSSNIWVSSNSWIKNFKKTMLQVTDKKLQDVEKYYEEQLRLQAELQNQGSITSVGTNPLS 270

Query: 290 ------------------ELFAVPETFFHPEIASL---LNSGIVETILESISMLPEAIRP 328
                             EL+   E  F P++AS     + G+ E I  SI+       P
Sbjct: 271 VKKEYLYRSRKTVTFESRELYQFGEYLFQPQLASEQYNRDDGLGELIYRSITSAAMGNMP 330

Query: 329 LMV-------GNIVITGGNFNI 343
             V       G+   TGG+ N+
Sbjct: 331 AAVAASNNIGGSSGATGGDSNV 352

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 80/210 (38%), Gaps = 23/210 (10%)

Query: 173 LVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSI 232
           LV+D G   S + P+I G     AV +    G FL+  + E L+       +E    N+ 
Sbjct: 138 LVVDVGAAKSTVTPIIDGTVVQTAVARSKFAGDFLDMQVNELLTKIAPIKDEEEGDPNNR 197

Query: 233 KENCLFMSPNA--YFESFQSRSKTAKEYVLPDFNTS---FQGYLRKPGQVLPAESQTIVL 287
           K+  L +  N+  + + F++         L D +++     G       +L  +    + 
Sbjct: 198 KDPSLTLWRNSRTWIQEFKTYMLQVAPSRLQDLDSAALDMMGLTYIKNFLLQKQKTISLT 257

Query: 288 QDELFAVPETFFHPEIAS---LLNSGIVETILESIS---------------MLPEAIRPL 329
           Q +   + E  F P   S   +   G+ E + +S+                  PE     
Sbjct: 258 QKQCCELAEGLFQPRSVSQQFVAAEGLSEIVAKSVKKAGASTATSSSATNVTTPEQTHAA 317

Query: 330 MVGNIVITGGNFNIPNFASRLATELQRQCP 359
           ++ NI+ITG +  I     R+  +L  Q P
Sbjct: 318 LLTNILITGSSSLISGLEQRIVNDLSYQFP 347

>NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 72/176 (40%), Gaps = 47/176 (26%)

Query: 105 CMTIPELSKNMDQVVFEEY---EFETMFKAPV------PVFVPFNTGKKSTHMLVAKEDS 155
            +TIP  +K++D+++ ++Y    FET F  PV      P+ V  + GK S+         
Sbjct: 109 VITIPSANKDVDEIILKKYFELAFET-FNVPVLQIIIEPLAVALSLGKSSS--------- 158

Query: 156 EVEESEVAPAKNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREAL 215
                            LV++ G +   + P++ G     AV K   GG FL+       
Sbjct: 159 -----------------LVVNLGASGCNVTPIVDGTVIKHAVMKSKYGGDFLD------- 194

Query: 216 SFRHYNVMDETILVNS--IKENC-LFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQ 268
            F+  N++ E   + S   K++  ++   N + + F+S      +  L D    +Q
Sbjct: 195 -FQIVNILQEKGKLESGNTKDSVDIWFDANTWIKEFKSTMLQVTDKPLQDVKRYYQ 249

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 35/85 (41%), Gaps = 2/85 (2%)

Query: 320 SMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT-DWSCRVSLPKGDAGLYGW 378
           S  PE I   ++ N+VI GG   +     RL  +L  Q P    S   +    D  L  W
Sbjct: 313 SATPEQIHAALLTNVVIIGGTSLLQGLEQRLVNDLSLQFPQYKLSTYATPAHVDRQLQSW 372

Query: 379 KCMQKFSETEDYH-ESRVTRQEYYE 402
           +         D+   S VT+QEY E
Sbjct: 373 QGGVNMCHLPDWKLGSWVTKQEYLE 397

>TBLA0F00450 Chr6 (119190..120638) [1449 bp, 482 aa] {ON} Anc_7.448
           YPR034W
          Length = 482

 Score = 33.9 bits (76), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 22/101 (21%), Positives = 39/101 (38%), Gaps = 26/101 (25%)

Query: 117 QVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVID 176
           ++ FE++    ++  P P+ + F+ GKKS                           LV+D
Sbjct: 142 KLAFEKFRIPILYLIPSPLAIAFSLGKKSA--------------------------LVVD 175

Query: 177 SGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSF 217
            G     + P++ G     AV K    G FL+  + + L+ 
Sbjct: 176 IGAKTCQVTPILDGTIIKDAVMKSKFAGDFLDYQIMKKLNL 216

>Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii AGR099C
          Length = 305

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 43/105 (40%), Gaps = 7/105 (6%)

Query: 311 IVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSCRVSLPK 370
           I+  +LESI  LP  ++  ++ N++I GG   I     RL   L+          +    
Sbjct: 205 IISLVLESIKQLPIDVKSKVLQNVIIIGGLSKIQGLKERLIENLRYAHTNARGINILKVW 264

Query: 371 GDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGV--DWCTAKRF 413
               +Y +  +       D  +  V R+E+   G+  DW   +RF
Sbjct: 265 QGGSIYTYHSLMH----NDLDQMEVNREEFKSSGIVPDW-QLQRF 304

>AGL029W Chr7 (654197..655231) [1035 bp, 344 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL018W (CTF19)
          Length = 344

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 40/101 (39%), Gaps = 12/101 (11%)

Query: 46  VRSIKDISSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESC 105
           VRS  D+  +     H LG L  + + T    Y LF  +++    I        +   +C
Sbjct: 200 VRSFSDVQLISDMPEHTLGLLKEYTIRTGNIAYLLFGCNEYTRLCIRRNAVLSSLQDSAC 259

Query: 106 MTIPEL---SKNMDQVVFE------EYEFETMF---KAPVP 134
            TIP L     +MD + F       E  F+ +F   + P P
Sbjct: 260 KTIPHLKVVQHSMDLIKFAKNSWQIEVRFDVLFIEERLPFP 300

>NDAI0A00200 Chr1 (19148..20140) [993 bp, 330 aa] {ON} Anc_1.11
          Length = 330

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 2/33 (6%)

Query: 94  TKGKHLITSESCMTIPELSKNMDQVVFEEYEFE 126
           T  KH  + E C+ +P LSK++DQV   E EF+
Sbjct: 166 TNSKH--SEEICLNLPNLSKDIDQVESNENEFD 196

>KAFR0D01030 Chr4 (212780..212792,212864..215043) [2193 bp, 730 aa]
           {ON} Anc_8.50 YLR054C
          Length = 730

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 20/25 (80%)

Query: 108 IPELSKNMDQVVFEEYEFETMFKAP 132
           IP++S N+  +++EE+++ET+ K P
Sbjct: 227 IPKISLNILSIIYEEFDYETLLKTP 251

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,855,887
Number of extensions: 2152982
Number of successful extensions: 6049
Number of sequences better than 10.0: 156
Number of HSP's gapped: 5903
Number of HSP's successfully gapped: 209
Length of query: 419
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 307
Effective length of database: 40,638,807
Effective search space: 12476113749
Effective search space used: 12476113749
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)