Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.238258.259ON1396139668990.0
KLTH0G13750g8.259ON1399140247010.0
SAKL0H17094g8.259ON1422142839490.0
Skud_12.1548.259ON1417140035530.0
AGR089C8.259ON1370137135520.0
YLR086W (SMC4)8.259ON1418144935440.0
Suva_10.1708.259ON1416139335360.0
TDEL0F038608.259ON1399139835230.0
Ecym_43118.259ON1376136634900.0
KAFR0B027108.259ON1416142934780.0
Smik_12.1458.259ON1418140534780.0
Kpol_392.88.259ON1427139034730.0
NCAS0B050008.259ON1409139534040.0
ZYRO0C01716g8.259ON1413137533620.0
NDAI0B019708.259ON1415137332300.0
KNAG0G020208.259ON1444139432180.0
TBLA0E044108.259ON1422139431710.0
TPHA0J007208.259ON1393138231680.0
KLLA0F19085g8.259ON1372138931590.0
CAGL0L12188g8.259ON1398142929660.0
YFL008W (SMC1)8.68ON12257634602e-45
Kwal_23.50438.68ON12258934271e-41
Suva_6.528.68ON12641633493e-32
KLTH0A02706g8.68ON12281613475e-32
KAFR0C032008.68ON12231633458e-32
Skud_6.648.68ON12301633459e-32
NDAI0G033208.68ON12311633441e-31
NCAS0C040008.68ON12231633422e-31
Kpol_1011.58.68ON12211723422e-31
Smik_6.718.68ON12281633403e-31
TPHA0P003408.68ON12191633403e-31
SAKL0B02288g8.68ON12281713403e-31
KNAG0G009108.68ON12261623351e-30
KLLA0D07502g8.68ON12432133323e-30
TDEL0C009608.68ON12221633314e-30
AGL023W8.68ON12221903305e-30
TBLA0G035308.68ON12321623271e-29
Ecym_73038.68ON12221663252e-29
ZYRO0F03828g8.68ON12171633172e-28
CAGL0F02079g8.68ON12231633172e-28
YFR031C (SMC2)7.186ON11702982697e-23
KAFR0G029307.186ON11702982633e-22
AGR236W7.186ON11702952617e-22
ZYRO0D15642g7.186ON11702972553e-21
NCAS0E019207.186ON11702982553e-21
Skud_6.1197.186ON11702972529e-21
Smik_7.3467.186ON11703012519e-21
KNAG0L011607.186ON11702972482e-20
Ecym_43907.186ON11702972483e-20
SAKL0F07282g7.186ON11703022473e-20
NDAI0G020707.186ON11712352464e-20
Kpol_1063.207.186ON11712982374e-19
KLTH0E04774g7.186ON11701822331e-18
KLLA0D16005g7.186ON11702972322e-18
Kwal_55.204217.186ON11701842303e-18
TBLA0D046107.186ON11741842269e-18
ZYRO0G21296g1.295ON12271072053e-15
KAFR0A016101.295ON12271042043e-15
TDEL0H026107.186ON1170862027e-15
Suva_6.1047.186ON1170732017e-15
Kwal_14.24351.295ON12471092001e-14
SAKL0D06116g1.295ON1229842001e-14
CAGL0D05258g7.186ON1170791991e-14
TPHA0C044407.186ON1170811982e-14
KLTH0H09966g1.295ON12241211982e-14
Kpol_1018.21.295ON12111861973e-14
NCAS0A093301.295ON12271111954e-14
KNAG0B052301.295ON12251061954e-14
TDEL0D016201.295ON12231001938e-14
NDAI0G056301.295ON12291061902e-13
Smik_10.1671.295ON1229841883e-13
TBLA0C027401.295ON11191491874e-13
TPHA0I010901.295ON1216841865e-13
YJL074C (SMC3)1.295ON1230841856e-13
Suva_6.1491.295ON1230841831e-12
Skud_10.1701.295ON12304311831e-12
CAGL0H02805g1.295ON12191041821e-12
AAL182W1.295ON1231971751e-11
KLLA0A00286g1.295ON1224831678e-11
KNAG0L006307.101ON11081591481e-08
Ecym_63221.295ON12321911392e-07
SAKL0B09526g7.101ON10993041321e-06
KLLA0F07997g7.101ON11193031257e-06
KLTH0D02816g7.101ON10941581193e-05
NCAS0I005707.101ON10952591194e-05
Kwal_26.72047.101ON11171961176e-05
TDEL0E013404.237ON1106851141e-04
TBLA0I028904.237ON10984191095e-04
KAFR0D013307.101ON10802111096e-04
Suva_15.1337.101ON10923061086e-04
ZYRO0B12122g4.237ON1109791050.001
TBLA0E021907.101ON10891921040.002
CAGL0H05071g4.237ON11101341020.004
CAGL0F01155g7.101ON11053761010.004
Skud_15.1217.101ON10931931010.005
TDEL0H034907.101ON1103851000.006
NDAI0A084507.101ON1119297990.007
NCAS0J013904.237ON109679990.008
KNAG0B060104.237ON1117101990.009
Skud_12.4684.237ON112068960.017
TPHA0B008404.237ON111968960.017
YLR383W (SMC6)4.237ON111468960.017
TPHA0L006007.101ON111783960.018
KLLA0E05303g4.237ON109892960.018
Ecym_26257.101ON1097131960.018
Smik_12.4704.237ON111468960.019
Suva_10.5004.237ON111568960.019
ZYRO0G01584g7.101ON108864960.019
NDAI0J021804.237ON110868950.020
Kpol_483.104.237ON111898950.021
Ecym_53444.237ON110258950.022
Kpol_1044.137.101ON110362950.023
Smik_15.1317.101ON109383950.024
YOL034W (SMC5)7.101ON109383950.024
Kwal_26.93804.237ON110287920.055
YNL225C (CNM67)2.16ON581129910.063
TBLA0A053001.67ON70763890.094
AEL337C7.101ON1097260890.12
AER044W4.237ON110356880.15
YLR440C (SEC39)4.323ON709111870.19
Suva_5.1087.167ON343118850.21
SAKL0H03322g4.237ON111147860.27
KAFR0A060404.237ON110268820.68
TDEL0G028102.351ON109471820.73
KLTH0D14080g4.237ON110258801.2
NDAI0K011008.704ON88884801.3
Ecym_10721.67ON68398791.4
KNAG0D043404.238ON2220160791.7
NCAS0B087001.67ON71572782.0
NCAS0B066602.207ON36881754.1
ZYRO0F17050g1.67ON71496754.7
Skud_2.1423.230ON45752744.9
TDEL0A044105.576ON3259109756.0
Ecym_81635.370ON133632738.3
SAKL0G06094g5.576ON3261122738.6
TBLA0H009708.384ON86982729.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23825
         (1396 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  2662   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1815   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1525   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  1373   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1372   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  1369   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  1366   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1361   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1348   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1344   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  1344   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1342   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1315   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1299   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1248   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1244   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1226   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1224   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1221   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1147   0.0  
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...   181   2e-45
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   169   1e-41
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...   139   3e-32
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   138   5e-32
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   137   8e-32
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   137   9e-32
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             137   1e-31
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   136   2e-31
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   136   2e-31
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   135   3e-31
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   135   3e-31
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...   135   3e-31
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....   133   1e-30
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   132   3e-30
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   132   4e-30
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   131   5e-30
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...   130   1e-29
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   129   2e-29
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   126   2e-28
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   126   2e-28
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...   108   7e-23
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...   105   3e-22
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...   105   7e-22
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...   102   3e-21
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....   102   3e-21
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...   101   9e-21
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...   101   9e-21
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...   100   2e-20
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...   100   3e-20
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...   100   3e-20
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    99   4e-20
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    96   4e-19
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    94   1e-18
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    94   2e-18
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...    93   3e-18
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    92   9e-18
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    84   3e-15
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    83   3e-15
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....    82   7e-15
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    82   7e-15
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    82   1e-14
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    82   1e-14
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    81   1e-14
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    81   2e-14
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    81   2e-14
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    80   3e-14
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    80   4e-14
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    80   4e-14
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    79   8e-14
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    78   2e-13
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    77   3e-13
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    77   4e-13
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    76   5e-13
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    76   6e-13
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    75   1e-12
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    75   1e-12
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    75   1e-12
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    72   1e-11
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    69   8e-11
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    62   1e-08
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    58   2e-07
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    55   1e-06
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    53   7e-06
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    50   3e-05
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    50   4e-05
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    50   6e-05
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    49   1e-04
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    47   5e-04
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    47   6e-04
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    46   6e-04
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    45   0.001
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    45   0.002
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    44   0.004
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    44   0.004
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    44   0.005
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    43   0.006
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    43   0.007
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    43   0.008
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    43   0.009
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    42   0.017
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    42   0.017
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    42   0.017
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    42   0.018
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    42   0.018
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    42   0.018
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    42   0.019
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    42   0.019
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    42   0.019
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    41   0.020
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    41   0.021
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    41   0.022
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    41   0.023
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    41   0.024
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    41   0.024
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    40   0.055
YNL225C Chr14 complement(222724..224469) [1746 bp, 581 aa] {ON} ...    40   0.063
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    39   0.094
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    39   0.12 
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    39   0.15 
YLR440C Chr12 complement(1015568..1017697) [2130 bp, 709 aa] {ON...    38   0.19 
Suva_5.108 Chr5 (163870..164901) [1032 bp, 343 aa] {ON} YER016W ...    37   0.21 
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    38   0.27 
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    36   0.68 
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    36   0.73 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    35   1.2  
NDAI0K01100 Chr11 complement(256280..258946) [2667 bp, 888 aa] {...    35   1.3  
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...    35   1.4  
KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {...    35   1.7  
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    35   2.0  
NCAS0B06660 Chr2 (1263611..1264717) [1107 bp, 368 aa] {ON} Anc_2...    33   4.1  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...    33   4.7  
Skud_2.142 Chr2 complement(266032..267405) [1374 bp, 457 aa] {ON...    33   4.9  
TDEL0A04410 Chr1 (780072..789851) [9780 bp, 3259 aa] {ON} Anc_5....    33   6.0  
Ecym_8163 Chr8 (337211..341221) [4011 bp, 1336 aa] {ON} similar ...    33   8.3  
SAKL0G06094g Chr7 (498322..508107) [9786 bp, 3261 aa] {ON} simil...    33   8.6  
TBLA0H00970 Chr8 (209566..212175) [2610 bp, 869 aa] {ON} Anc_8.3...    32   9.9  

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 2662 bits (6899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1319/1396 (94%), Positives = 1319/1396 (94%)

Query: 1    MDSPLAKKQKTHVXXXXXXXXXXXXPDVTRASRSRTPRKLVLGSPDKRFAFSQPVXXXXX 60
            MDSPLAKKQKTHV            PDVTRASRSRTPRKLVLGSPDKRFAFSQPV     
Sbjct: 1    MDSPLAKKQKTHVSNESENSSTEESPDVTRASRSRTPRKLVLGSPDKRFAFSQPVSSSSS 60

Query: 61   NVPHLQPLKNELSSSRGRVYXXXXXXXXXXXXXXKLELIQLSPMKKSRLESQKFQESRAM 120
            NVPHLQPLKNELSSSRGRVY              KLELIQLSPMKKSRLESQKFQESRAM
Sbjct: 61   NVPHLQPLKNELSSSRGRVYSQSPPRSPNRSPTRKLELIQLSPMKKSRLESQKFQESRAM 120

Query: 121  MGSIQRLCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRAN 180
            MGSIQRLCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRAN
Sbjct: 121  MGSIQRLCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRAN 180

Query: 181  KMRQGKLSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNT 240
            KMRQGKLSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNT
Sbjct: 181  KMRQGKLSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNT 240

Query: 241  SKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYL 300
            SKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYL
Sbjct: 241  SKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYL 300

Query: 301  EDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKT 360
            EDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKT
Sbjct: 301  EDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKT 360

Query: 361  LTILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKL 420
            LTILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKL
Sbjct: 361  LTILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKL 420

Query: 421  ILGDLGESEKKLTLEKRACDRDRVSLEEKLKNLTQKEVKXXXXXXXXXXXXXXXXAKMEE 480
            ILGDLGESEKKLTLEKRACDRDRVSLEEKLKNLTQKEVK                AKMEE
Sbjct: 421  ILGDLGESEKKLTLEKRACDRDRVSLEEKLKNLTQKEVKSSRSLQSITSSISTTQAKMEE 480

Query: 481  LANDQEQHEKDLLELNGTMKEEKEKLXXXXXXXXXXXXXXXXQIREIEKELEPWNVKLQE 540
            LANDQEQHEKDLLELNGTMKEEKEKL                QIREIEKELEPWNVKLQE
Sbjct: 481  LANDQEQHEKDLLELNGTMKEEKEKLDEIKSSLKDKISLISEQIREIEKELEPWNVKLQE 540

Query: 541  KKAQVKLEETTISVFKESHAKIEQDIILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQ 600
            KKAQVKLEETTISVFKESHAKIEQDIILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQ
Sbjct: 541  KKAQVKLEETTISVFKESHAKIEQDIILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQ 600

Query: 601  LTVGQSECDNAVKKIKEMKGILTAHRQRSIDARSSLSTFENKNKVLAALLRLQRSGRISG 660
            LTVGQSECDNAVKKIKEMKGILTAHRQRSIDARSSLSTFENKNKVLAALLRLQRSGRISG
Sbjct: 601  LTVGQSECDNAVKKIKEMKGILTAHRQRSIDARSSLSTFENKNKVLAALLRLQRSGRISG 660

Query: 661  FHGRLGDLGTIDDKYDVAISTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKL 720
            FHGRLGDLGTIDDKYDVAISTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKL
Sbjct: 661  FHGRLGDLGTIDDKYDVAISTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKL 720

Query: 721  RNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRV 780
            RNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRV
Sbjct: 721  RNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRV 780

Query: 781  VTLDGKLIDLSGTMSGGGNFKARGMMKSEQQSNSAFTAEEVQQIDKELSEREHNFQIAAD 840
            VTLDGKLIDLSGTMSGGGNFKARGMMKSEQQSNSAFTAEEVQQIDKELSEREHNFQIAAD
Sbjct: 781  VTLDGKLIDLSGTMSGGGNFKARGMMKSEQQSNSAFTAEEVQQIDKELSEREHNFQIAAD 840

Query: 841  TLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNEE 900
            TLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNEE
Sbjct: 841  TLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNEE 900

Query: 901  LSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITI 960
            LSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITI
Sbjct: 901  LSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITI 960

Query: 961  VXXXXXXXXXXXXXXQNDIKRYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSES 1020
            V              QNDIKRYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSES
Sbjct: 961  VLAKSKKTKTDLKKAQNDIKRYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSES 1020

Query: 1021 INKLKDELELTEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEF 1080
            INKLKDELELTEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEF
Sbjct: 1021 INKLKDELELTEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEF 1080

Query: 1081 LHSLNSLKIRDVTATLQALDESLENESKNEVAAETPGEEDGEHSSSLHDPMDVDENQGES 1140
            LHSLNSLKIRDVTATLQALDESLENESKNEVAAETPGEEDGEHSSSLHDPMDVDENQGES
Sbjct: 1081 LHSLNSLKIRDVTATLQALDESLENESKNEVAAETPGEEDGEHSSSLHDPMDVDENQGES 1140

Query: 1141 TSTTEAQLQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADI 1200
            TSTTEAQLQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADI
Sbjct: 1141 TSTTEAQLQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADI 1200

Query: 1201 EILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMY 1260
            EILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMY
Sbjct: 1201 EILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMY 1260

Query: 1261 QMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY 1320
            QMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY
Sbjct: 1261 QMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY 1320

Query: 1321 KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKN 1380
            KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKN
Sbjct: 1321 KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKN 1380

Query: 1381 MTKSVALQNTDLIDRS 1396
            MTKSVALQNTDLIDRS
Sbjct: 1381 MTKSVALQNTDLIDRS 1396

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1815 bits (4701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 928/1402 (66%), Positives = 1095/1402 (78%), Gaps = 9/1402 (0%)

Query: 1    MDSPLAKKQKTHVXXXXXXXXXXXXPDVTRASRSRTPRKLVLGSPDKRFAFSQPVXXXXX 60
            M+SPL+KKQKT V             DVTRASRSRTPRKLVLGSPDKRFAFSQPV     
Sbjct: 1    MESPLSKKQKTFVNRDEDFSQTEESVDVTRASRSRTPRKLVLGSPDKRFAFSQPVTSSSS 60

Query: 61   NVPHLQPLKNELSSSRGRVYXXXXXXXXXXXXXXKLELIQLSPMKKSRLESQKFQESRAM 120
            NVP+LQPLK+ELSSSRGRVY              KLELIQLSP KK+RLESQK ++ R +
Sbjct: 61   NVPYLQPLKSELSSSRGRVYSQSPPRSPTRSPTRKLELIQLSPTKKTRLESQKTEQVRGL 120

Query: 121  MGSIQRLCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRAN 180
               I+RLCI+RL LHNFKSYAGTQVVGPFH+SFSAVVGPNGSGKSNVIDSLLFVFGFRAN
Sbjct: 121  AQPIERLCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRAN 180

Query: 181  KMRQGKLSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNT 240
            KMRQGKLS+LIHKSE HP+LDSCHV++FFQYVQDE DG T++ Q +P +V+ RKAF+NNT
Sbjct: 181  KMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNT 240

Query: 241  SKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYL 300
            SKYY+NGKESSYT +T+LLR EGIDLDHKRFLILQGEVESIAQMKPKAEKE DDGLLEYL
Sbjct: 241  SKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYL 300

Query: 301  EDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKT 360
            EDIIGTA+YKPLIE TL +I +LND+C+EKENR+EIVEREKSSLE GK+EALE+LEKEK 
Sbjct: 301  EDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLESGKDEALEFLEKEKK 360

Query: 361  LTILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKL 420
            LT LRSKLLQ+ LWKN  K  +T+EKI   +EKLSAE+AK T+H  E+  ++++ +SL +
Sbjct: 361  LTFLRSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNV 420

Query: 421  ILGDLGESEKKLTLEKRACDRDRVSLEEKLKNLTQKEVKXXXXXXXXXXXXXXXXAKMEE 480
             +  + +SE  LT EKR CDRDRVSLEEKLKN++QK+VK                AK+EE
Sbjct: 421  TIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEE 480

Query: 481  LANDQEQHEKDLLELNGTMKEEKEKLXXXXXXXXXXXXXXXXQIREIEKELEPWNVKLQE 540
            L  DQ Q+EK+L ELN ++  EK KL                QI EIE+ELEPWNVKLQE
Sbjct: 481  LFKDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQE 540

Query: 541  KKAQVKLEETTISVFKESHAKIEQDIILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQ 600
            K++Q+KLEET ISV KES AKI ++I      I   R K+ EQ  ++  LEKE  DI RQ
Sbjct: 541  KRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQ 600

Query: 601  LTVGQSECDNAVKKIKEMKGILTAHRQRSIDARSSLSTFENKNKVLAALLRLQRSGRISG 660
            + +GQ+ECDNA  K+KEMK +LT HRQRS+DA+SSLSTFENKNKVL+AL RLQRSGRISG
Sbjct: 601  IIIGQTECDNASNKMKEMKAVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISG 660

Query: 661  FHGRLGDLGTIDDKYDVAISTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKL 720
            FHGRLGDLGTIDDKYDVAISTACPRLDD+VVETVECGQQCIE+LRKNKLGYARFILLDKL
Sbjct: 661  FHGRLGDLGTIDDKYDVAISTACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKL 720

Query: 721  RNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRV 780
            R+FN++ I+TP NV RL+DLV P + KFRNAFYSVLRDTLVAKDLKEAN+VAYGKQR+RV
Sbjct: 721  RSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRV 780

Query: 781  VTLDGKLIDLSGTMSGGGNFKARGMMKSEQ-QSNSAFTAEEVQQIDKELSEREHNFQIAA 839
            VTLDGKLIDLSGTMSGGGN +A GMMKSE+  + ++FTAEEV+QID+EL+ERE NF+IA 
Sbjct: 781  VTLDGKLIDLSGTMSGGGNHRASGMMKSERLNTGASFTAEEVRQIDEELTERERNFKIAT 840

Query: 840  DTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNE 899
            DTLHEME+ALQ LKDREPEIE DISKR+++IDSL SE+K  E R   L +E+   ESS++
Sbjct: 841  DTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESSDD 900

Query: 900  ELSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRIT 959
             L  A  +L SLK+E + LE EM+SKK ++K LQEQIMK+GGTKLQ+Q S+VDS+ QRI+
Sbjct: 901  TLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRIS 960

Query: 960  IVXXXXXXXXXXXXXXQNDIKRYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSE 1019
            I               +ND+KRY+KQA QL+ ++  C+ E   I+  + SS  K+ EL  
Sbjct: 961  ITLGKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCTNELESIKELISSSDNKILELEA 1020

Query: 1020 SINKLKDELELTEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAE 1079
            SI+KL+ E E  EE+VR+ E  I+EK+ EG+DF   E+    QL+KL +L   + K+  +
Sbjct: 1021 SIDKLQKEGEEIEEKVREIERLIEEKSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHD 1080

Query: 1080 FLHSLNSLKIRDVTATLQALDESLENESKNEVAAETPGEEDGEHSSSLHDPMDVDENQG- 1138
             L  L SLKIRDVTATLQ L++ L +ES++         E      S  D M+VD  +G 
Sbjct: 1081 LLKQLESLKIRDVTATLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGC 1140

Query: 1139 ----ESTSTTEAQLQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVE 1194
                 + S  E Q+   E E   T    P+ LPKL E +L+   VE VELEI QL D+VE
Sbjct: 1141 MGNEPTASQPEDQMDVDEPEEMETS---PSDLPKLTEAQLKELNVEEVELEIGQLNDFVE 1197

Query: 1195 NAYADIEILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICM 1254
            NAYADIE+LEEY +RL++++ARK++LN AV++RD VRQ+ +NL+KKRLDEFM GFN I M
Sbjct: 1198 NAYADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISM 1257

Query: 1255 ILKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALV 1314
             LKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNI+NLSGGEKTLSSLALV
Sbjct: 1258 TLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALV 1317

Query: 1315 FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVG 1374
            FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVG
Sbjct: 1318 FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG 1377

Query: 1375 VYKNKNMTKSVALQNTDLIDRS 1396
            +YKN+NMTKSVAL+N DLI+RS
Sbjct: 1378 IYKNRNMTKSVALENKDLINRS 1399

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1525 bits (3949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 811/1428 (56%), Positives = 1030/1428 (72%), Gaps = 45/1428 (3%)

Query: 2    DSPLAKKQKTHVX---XXXXXXXXXXXPDV------------TRASR--SRTPRKLVLGS 44
            DSPLAKKQKT                 P V            TR  R  S TPRKLVLGS
Sbjct: 3    DSPLAKKQKTRTDDRGQIQSNPTVSPIPPVSGSSLMAVKSSPTRQDRLPSPTPRKLVLGS 62

Query: 45   PDKRFAFSQPVXXXXXNVPHLQPLKNELSSSRGRVYXXXX-----XXXXXXXXXXKLELI 99
            P+K++A+SQP      +VP+LQP    +  SRGR +                   +LELI
Sbjct: 63   PEKKYAYSQPSTSSSLSVPNLQP--PNVDGSRGRRFYSQSPPRSPHRSPNRSPTRRLELI 120

Query: 100  QLSPMKKSRLESQKFQESRAMMGS--IQRLCIDRLVLHNFKSYAGTQVVGPFHNSFSAVV 157
            QLSP+K +R E QK  + +   G+  + RLCID+L LHNFKSYAGTQ++GPFH SFSAVV
Sbjct: 121  QLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPFHTSFSAVV 180

Query: 158  GPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQYVQDEPD 217
            GPNGSGKSNVIDS+LFVFGFRANKMRQGKLS+LIHKSE +P+L+SC VDI F+YV DE D
Sbjct: 181  GPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFRYVVDESD 240

Query: 218  GTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGE 277
            GTT    +KP MVI RKAFRNN+SKYY++GKES+YT +TQLLRD+GIDLDHKRFLILQGE
Sbjct: 241  GTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQGE 300

Query: 278  VESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIV 337
            VESI+QMKPKAE+ESDDGLLEYLEDIIGTA+YK  IE  L EI  LND+C EKENRFE+V
Sbjct: 301  VESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFELV 360

Query: 338  EREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAE 397
            E+EK+SLE GK+EALE+LEKEK+LT+L+SKL QYH+W++++KL+ T  KI++  E L  E
Sbjct: 361  EKEKNSLESGKDEALEFLEKEKSLTLLKSKLAQYHIWQDQRKLSETLGKISELNEHLGQE 420

Query: 398  KAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLEEKLKNLTQKE 457
            KAK  +   E+A ++      K  +  L +  K LT ++R  DR++ S+EEK +NL +K 
Sbjct: 421  KAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDKKR 480

Query: 458  VKXXXXXXXXXXXXXXXXAKMEELANDQEQHEKDLLELNGTMKEEKEKLXXXXXXXXXXX 517
            +K                 K+EEL N Q+Q+++ LL+LN ++ EE+ KL           
Sbjct: 481  LKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRDKT 540

Query: 518  XXXXXQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIILVNKGIDELR 577
                 +I   E++LEPWN +LQEKK+Q+KL E+ I++ KES  K  Q+II +   I+   
Sbjct: 541  SEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEAFA 600

Query: 578  NKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHRQRSIDARSSLS 637
             K N Q  ++  L+ EQ +I +++ +G+ EC +A  K+ EMK +L +HRQR+++ARS+LS
Sbjct: 601  EKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARSTLS 660

Query: 638  TFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDIVVETVECG 697
              ENKNKVL+AL+RLQRSGRI+GFHGRLGDLGTIDD YDVAISTACPRLDDIVV+ VECG
Sbjct: 661  NVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIVVDNVECG 720

Query: 698  QQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLR 757
            QQCIE+LRKNKLGYARFI+LDKLR FNLSPI+TPE VPRL+DLVR  N KF  AFYSVLR
Sbjct: 721  QQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAFYSVLR 780

Query: 758  DTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQSNSAFT 817
            DTLV  DLK+AN+VAYGK+R+RVVTLDGKLID SGT+SGGG    +G+MKS+QQ  + +T
Sbjct: 781  DTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMKSKQQPGAGYT 840

Query: 818  AEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEM 877
             EEVQ I+KEL+ERE NF IA +T H+MEEAL+K KDREPEIE++I+KR+LDI+S S+E+
Sbjct: 841  PEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRRLDIESSSTEL 900

Query: 878  KASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIM 937
            K  + +L+ L  ++      + EL+ AE KL+ L  EY E+ENE ++K++ +  L+E+IM
Sbjct: 901  KLKQEQLKELETDRDGGSVEDRELADAESKLQVLSEEYDEIENETKNKQQLINSLKEKIM 960

Query: 938  KVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXXXXXQNDIKRYQKQAEQLAEELKSCS 997
            K+GGTKLQ+Q+S V+S+N++I I+              +ND+KR + Q  + + +++SC+
Sbjct: 961  KIGGTKLQLQNSKVNSINEQINIISSKQKKDRTATKKAENDLKRLENQCREASNDIESCN 1020

Query: 998  QE---KSLIENNLDSSSKKVDELSESINKLKDELELTEERVRKAEESIDEKTVEGRDFEA 1054
             E    S++   L++   K+D        LK+E+E   ERV+    +++EKT    DF++
Sbjct: 1021 LEISKISVLNTELEAKIYKLDTSLNETESLKEEVEEEFERVKT---NLEEKTNNTSDFKS 1077

Query: 1055 LEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQALDESL---ENESKNEV 1111
            +EI+   +L+KL  L + + KE       LNSLKIRD+T TLQAL+E     ENE   EV
Sbjct: 1078 VEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLPEENEDDFEV 1137

Query: 1112 AAETPGEEDGEHSSSLHDP--MDVDENQGESTSTTEAQLQAGEAERRNTEE---SLPNGL 1166
              E    E  E SS   DP  MD+DE Q  +    + Q   GE +  + +E      NGL
Sbjct: 1138 QDEEVQREQREMSS---DPNAMDIDEEQ--AAEQFQVQQTDGEIDSMDIDEYENETSNGL 1192

Query: 1167 PKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDLNHAVQE 1226
            PK  E +L++ ++E VEL+I +L  YV+NA+ DI++LEEYARRL EYK RK+DLN AV +
Sbjct: 1193 PKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAVLK 1252

Query: 1227 RDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEGVLF 1286
            RD+VR++ E LKKKRLD+FMEGF+ I M LKEMYQMITMGGNAELELVDSLDPFSEGVLF
Sbjct: 1253 RDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLF 1312

Query: 1287 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1346
            SVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANY
Sbjct: 1313 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANY 1372

Query: 1347 IKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLID 1394
            IKERTKNAQFIVISLRNNMFELA+QLVG+YKN NMT+S  LQN D+++
Sbjct: 1373 IKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILN 1420

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 1373 bits (3553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 743/1400 (53%), Positives = 967/1400 (69%), Gaps = 75/1400 (5%)

Query: 32   SRSRTPRKLVLGSPDKRFAFSQPVXXXXX--NVPHLQPLKNELSSSRGR---VYXXXXXX 86
            +RS TPRKLVL S + R+AFSQP        +VP+LQP K    SSRGR    Y      
Sbjct: 56   ARSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPK---VSSRGRDYKAYSQSPPR 112

Query: 87   XXXXXXXXKLELIQLSPMKKSRLESQKFQESRAMMGSIQ-RLCIDRLVLHNFKSYAGTQV 145
                    +LEL+QLSP+K SR+E QK  +S    G  Q RL I++LVL NFKSYAG QV
Sbjct: 113  SPGRSPARRLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQV 172

Query: 146  VGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHV 205
            VGPFH SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIHKSE  PDL +C V
Sbjct: 173  VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSV 232

Query: 206  DIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGID 265
             + F+Y+ DEP GT+ I ++KP +VI R+AF+NN+SKYY+N KESSYT +T+LL+ EGID
Sbjct: 233  AVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGID 292

Query: 266  LDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLND 325
            LDHKRFLILQGEVE+IAQMKPKAEKESDDGLLEYLEDIIGTA YKPLIE  LS+I  LN+
Sbjct: 293  LDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNE 352

Query: 326  ICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKE 385
            IC EK NRFEIV+REK+SLE GK  ALE+L+KEK LT+L+SKLLQ+ + ++  KL ST E
Sbjct: 353  ICLEKANRFEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLASTLE 412

Query: 386  KIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVS 445
            KI+    +  +EK K  +   E+  +KA  + +K  +      EK L+LEKR  +  RVS
Sbjct: 413  KISSLNREFESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVS 472

Query: 446  LEEKLKNLTQKEVKXXXXXXXXXXXXXXXXAKMEELANDQEQHEKDLLELNGTMKEEKEK 505
            LEE+ KNL  K  K                   +EL   Q +HEK++ +LN +++EE+  
Sbjct: 473  LEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERII 532

Query: 506  LXXXXXXXXXXXXXXXXQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQD 565
            L                +I   EKE EPW+++LQEKK+Q++L E+ +S+ +E+ AK++++
Sbjct: 533  LDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEETRAKLKKN 592

Query: 566  IILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAH 625
               + + I   + +  E +G V  L +    +    + G+ +  +A  K+KEM+ IL AH
Sbjct: 593  AEALEEKIISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAH 652

Query: 626  RQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPR 685
            RQR+++ARSSLS  +NKN VL AL +LQ+SGRI+GFHGRLGDLG ID+ +DVAISTACPR
Sbjct: 653  RQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPR 712

Query: 686  LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNN 745
            LDD+VV+TVEC Q CI+YLRKNKLGYARFILLD+LR FNL PI TPENVPRL+D+V+P +
Sbjct: 713  LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKD 772

Query: 746  PKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGM 805
            PKF NAFYSVL+DTLVA+DLK+ANKVAYGK+R+RVVT+DGKLID+SGTMSGGGN   +G+
Sbjct: 773  PKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGL 832

Query: 806  MK-SEQQSNSA--FTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELD 862
            M+    QS+    +T EEV +I+ EL+ERE NF++A DT+HEMEE L+K++D+EP++E  
Sbjct: 833  MRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQ 892

Query: 863  ISKRKLDIDSLSSEM-----KASEGRLEYLLQEKAQKESSNEELSTAEV--KLKSLKSEY 915
            IS+ +++ DSL+SE+     +A E ++ Y        ++ NE+    EV   L+ L+ EY
Sbjct: 893  ISRAEMEADSLTSELMLAEQQAKEAKMAY-------DKAVNEKTQVNEVMKNLEHLRGEY 945

Query: 916  RELENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXXXXX 975
             +L++E ++KK+++K+LQ+QIMK+GGTKL  Q+S V S+ QRI I+              
Sbjct: 946  EDLQSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKS 1005

Query: 976  QNDIKRYQKQAEQLAEELKSCSQEKSLIENNLDSS-------SKKVDELSESINKLKDEL 1028
            + D+ +YQKQ +   ++ +  S E  +IE  L  +          + E+S   ++LKD+ 
Sbjct: 1006 EGDVLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQG 1065

Query: 1029 ELTEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLK 1088
            E  +ER+ + EE+IDE       F++LEI+   +L+KL  L   +  E  +    LN L 
Sbjct: 1066 EQLKERLTEMEENIDE-------FKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLS 1118

Query: 1089 IRDVTATLQALDES----LENESKNEVAAE------TPGEE---DGEHSSSLHDPMDVDE 1135
            IRDVT TLQ LD +    +E+  K+E  A+       P +E   + + + + H  M++DE
Sbjct: 1119 IRDVTHTLQMLDNNQMDVVEDGIKDEQDADQDKPSGIPDDEKIQEKDDADNNHHSMNIDE 1178

Query: 1136 NQGESTSTTEAQLQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVEN 1195
               E                      +  G+PKL E+EL++ ++E +E +I  L  Y+  
Sbjct: 1179 MSSE----------------------ISRGIPKLCEEELKDLDIELLESDISGLTCYINE 1216

Query: 1196 AYADIEILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMI 1255
               DI +LEEY RRLIE+K RK+DLN AVQ+RD+V++  E LKK R DEFM GFN I M 
Sbjct: 1217 TSVDIGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMT 1276

Query: 1256 LKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVF 1315
            LKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNITNLSGGEKTLSSLALVF
Sbjct: 1277 LKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVF 1336

Query: 1316 ALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGV 1375
            ALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QL+G+
Sbjct: 1337 ALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGI 1396

Query: 1376 YKNKNMTKSVALQNTDLIDR 1395
            YK  N TKS  ++N D++ R
Sbjct: 1397 YKRDNRTKSTTVKNIDILKR 1416

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1372 bits (3552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 738/1371 (53%), Positives = 953/1371 (69%), Gaps = 28/1371 (2%)

Query: 36   TPRKLVLGSPDKRFAFSQPVXXXXX---NVPHLQP-LKNELSSSRGRVYXXXXXXXXXXX 91
            TP KL+  SPD++   S+            P LQP + +++S  R + Y           
Sbjct: 14   TPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQISRGRSQ-YSQSPPRSPNRS 72

Query: 92   XXXKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVGPFHN 151
                +ELIQLSP+K SRLE Q+  +++     ++RLCI  LVL NFKSYAG QVVGPFH+
Sbjct: 73   PGRAVELIQLSPIKNSRLELQRLYDTK--QKKVERLCIRTLVLENFKSYAGRQVVGPFHS 130

Query: 152  SFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQY 211
            SFSAVVGPNGSGKSNVIDS+LF FGFRANKMRQGKLS LIHKSE +PDLD C V+I FQY
Sbjct: 131  SFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQY 190

Query: 212  VQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRF 271
            V DEPDGTT ++  KP + + RKAF+NNTSKYYLNGKES+YT +T+LLRDEGIDLDHKRF
Sbjct: 191  VVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRF 250

Query: 272  LILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKE 331
            LILQGEVESIAQMKPKAE E DDGLLEYLEDIIGT +YK  IE  L E+  LNDIC EKE
Sbjct: 251  LILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICMEKE 310

Query: 332  NRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQ 391
            NRF++VE+EK SLE GK+EAL +L+KEK LT+L SK  QYHL+ N  KL  T   ++   
Sbjct: 311  NRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTM 370

Query: 392  EKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLEEKLK 451
             KL  EKAK+ +  +E+  +    + L   L  +  + K+   + R  +R+ VS EEK K
Sbjct: 371  NKLEQEKAKKVEAQKEIVELTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEKQK 430

Query: 452  NLTQKEVKXXXXXXXXXXXXXXXXAKMEELANDQEQHEKDLLELNGTMKEEKEKLXXXXX 511
            +L QK  K                 K+EE  +  +++E  L  LN T+ + + +L     
Sbjct: 431  SLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKL 490

Query: 512  XXXXXXXXXXXQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIILVNK 571
                       ++  +EKELEPW  K++EKK+++KL E+ IS+ KE+  K+E +I  +++
Sbjct: 491  ALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQ 550

Query: 572  GIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHRQRSID 631
             I++LR  ++ +  S+ +L  E   I   + VG+ EC +A  K++EMK +L  HRQR  D
Sbjct: 551  EIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVND 610

Query: 632  ARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDIVV 691
            ARS++S+ ENKNKVL AL RLQ+SGRI G+HGRLGDLGTIDDKYD+AISTACPRLDDIVV
Sbjct: 611  ARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDDIVV 670

Query: 692  ETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNPKFRNA 751
            +TVECGQQCIE+LRKNKLGYARFILLDKLR FNL P  TPENVPRL+DLV+P  PKF  A
Sbjct: 671  DTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFAPA 730

Query: 752  FYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQ 811
            FYSVLRDTLV  DL +AN+VAYGK+RYRVVTLDGKLID+SGTM+GGG+  A G+MKS QQ
Sbjct: 731  FYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMKSTQQ 790

Query: 812  SNSAFTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDID 871
            S S +T EEVQ++++EL+ERE NF++A +T  EME ALQ   DR+PEIE+++SK+K+DI+
Sbjct: 791  S-SLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQKMDIE 849

Query: 872  SLSSEMKAS-EGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMK 930
            ++S+E+++  E +LE     K   E S+ EL TAE KL +L ++     +  +SK + +K
Sbjct: 850  TISAELESKIERKLELERSNKTSIEDSS-ELRTAEEKLAALNADLNSFMSASESKNQRIK 908

Query: 931  VLQEQIMKVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXXXXXQNDIKRYQKQAEQLA 990
             L+ +IM++GG +LQ  +S VDS+NQ+I IV              + ++KR +KQ     
Sbjct: 909  ELRAKIMEIGGLELQTLNSKVDSLNQQIKIVAAKQKKDKTAQKKAELELKRARKQQITAK 968

Query: 991  EELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDEL-ELTEERVRKAEESIDEKTVEG 1049
            ++++ C  E   ++++ D+ S  + EL + ++ L++E+  LT+E      E +D+K  + 
Sbjct: 969  DDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHE-LDQKNEKI 1027

Query: 1050 RDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQALDE--SLENES 1107
              + ++EI+   QL KL+ L   L KE  E+   L+ LK+RD+   +  L+E  SL++ S
Sbjct: 1028 DSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKSLQSFS 1087

Query: 1108 KNEVAAETPGEEDGEHSSSLHDPMDVDENQGESTSTTEAQLQAGE----AERRNTEESLP 1163
                 + TP  +     SS+       E    S S  E ++   E     E       L 
Sbjct: 1088 H----SPTPDTKRENIQSSML------ETHLASPSPNERKISIAENNLSMEVDEQASVLE 1137

Query: 1164 NGLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDLNHA 1223
            NGLPKL + EL   ++E +E +I QLQDY++N+  DIEIL+EYA+RL EY+ R++DLN A
Sbjct: 1138 NGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEA 1197

Query: 1224 VQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEG 1283
            + +RD+ R   E LKK+RLDEFMEGF  I + LKEMYQMITMGGNAELELVDSLDPFSEG
Sbjct: 1198 IMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEG 1257

Query: 1284 VLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1343
            VLFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV
Sbjct: 1258 VLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1317

Query: 1344 ANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLID 1394
            ANYIKERTKNAQFIVISLRNNMFELA++LVG+YKN NMT+S  LQN D+I+
Sbjct: 1318 ANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIIN 1368

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 1369 bits (3544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 755/1449 (52%), Positives = 984/1449 (67%), Gaps = 87/1449 (6%)

Query: 2    DSPLAKKQK-------------------THVXXXXXXXXXXXXPDV----TRASRSRTPR 38
            DSPL+K+QK                   + V            PD+       S+S TPR
Sbjct: 3    DSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYTPR 62

Query: 39   KLVLGSPDKRFAFSQPVXXXXX--NVPHLQPLKNELSSSRGR---VYXXXXXXXXXXXXX 93
            KLVL S + R+AFSQP        +VP+LQP K   +SSRGR    Y             
Sbjct: 63   KLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPK---TSSRGRDHKSYSQSPPRSPGRSPT 119

Query: 94   XKLELIQLSPMKKSRLESQKFQESRAMMGSIQ--RLCIDRLVLHNFKSYAGTQVVGPFHN 151
             +LEL+QLSP+K SR+E QK  + R    S Q  RL I+ LVL NFKSYAG QVVGPFH 
Sbjct: 120  RRLELLQLSPVKNSRVELQKIYD-RHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHT 178

Query: 152  SFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQY 211
            SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIHKSE  P L SC V + FQY
Sbjct: 179  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQY 238

Query: 212  VQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRF 271
            V DE  GT+ I ++KP ++I RKAF+NN+SKYY+N KESSYT +T+LL++EGIDLDHKRF
Sbjct: 239  VIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRF 298

Query: 272  LILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKE 331
            LILQGEVE+IAQMKPKAEKESDDGLLEYLEDIIGTA YKPLIE  + +I  LN++C EKE
Sbjct: 299  LILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKE 358

Query: 332  NRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQ 391
            NRFEIV+REK+SLE GK  ALE+LEKEK LT+LRSKL Q+ L ++  KL ST EKI+ + 
Sbjct: 359  NRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSN 418

Query: 392  EKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLEEKLK 451
            + L  EK K  +  +++  +KA  + +K  +      EK L LE+R  +  RVSLEE+ K
Sbjct: 419  KDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTK 478

Query: 452  NLTQKEVKXXXXXXXXXXXXXXXXAKMEELANDQEQHEKDLLELNGTMKEEKEKLXXXXX 511
            NL  K  K                  +EEL   Q +HE ++ +L   +++E+  L     
Sbjct: 479  NLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKL 538

Query: 512  XXXXXXXXXXXQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIILVNK 571
                       +I   EKELEPW+++LQEK++Q++L E+ +S+ +E+ AK+++++  + +
Sbjct: 539  SLKDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEE 598

Query: 572  GIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHRQRSID 631
             I   +    E +  +  L+K+   +  + + G+    +A  K+KEM+ +L AHRQR+++
Sbjct: 599  KILAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQRAME 658

Query: 632  ARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDIVV 691
            ARSSLS  +NK+KVL AL RLQ+SGRI+GFHGRLGDLG IDD +DVAISTACPRLDD+VV
Sbjct: 659  ARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVV 718

Query: 692  ETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNPKFRNA 751
            +TVEC Q CI+YLRKNKLGYARFILLD+LR FNL PI TPENVPRL+DLV+P NPKF NA
Sbjct: 719  DTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNA 778

Query: 752  FYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMMK-SEQ 810
            FYSVLRDTLVA++LK+AN VAYGK+R+RVVT+DGKLID+SGTMSGGGN  A+G+MK    
Sbjct: 779  FYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTN 838

Query: 811  QSNSA--FTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKL 868
            QS+    +T EEV +I++ELSERE+NF++A+DT+HEMEE L+KL+D EP++E  ISK ++
Sbjct: 839  QSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEM 898

Query: 869  DIDSLSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKE 928
            + DSL+SE+  +E +++       +  S   +L+     L+ L+ EY +L++E ++KK++
Sbjct: 899  EADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEK 958

Query: 929  MKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXXXXXQNDIKRYQKQAEQ 988
            +K LQ++IMK+GG KLQMQ+S V+SV Q++ I+                D+ ++QK  + 
Sbjct: 959  IKGLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVVKFQKLLQN 1018

Query: 989  LAEELKSCSQEKSLIENNLDSSSKKVDE----LSESIN---KLKDELELTEERVRKAEES 1041
               +++  S E  +IE  L  +   + E    ++E++N   +LK++ E  +E++   EES
Sbjct: 1019 SERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMEDMEES 1078

Query: 1042 IDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQALDE 1101
            I+E       F+++EI+   +L+KL  L   +  E  +    LN L IRDVT TL  LD+
Sbjct: 1079 INE-------FKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDD 1131

Query: 1102 SLENESKNEV-----------AAETPGE---EDGEHSSSLHDPMDVDENQGESTSTTEAQ 1147
            +  +  K +V           + ET  E   +D E S   + PM++DE            
Sbjct: 1132 NKMDSVKEDVKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDE------------ 1179

Query: 1148 LQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYA 1207
                      T + +  G+P+L EDEL   +VE +E +I++L  YVE    DI +LEEYA
Sbjct: 1180 ----------TSDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYA 1229

Query: 1208 RRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGG 1267
            RRL E+K RK+DLN+AVQ+RD+V++    LKKKR DEFM GFN I M LKEMYQMITMGG
Sbjct: 1230 RRLAEFKRRKLDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGG 1289

Query: 1268 NAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYV 1327
            NAELELVDSLDPFSEGV FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYV
Sbjct: 1290 NAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYV 1349

Query: 1328 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVAL 1387
            MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGVYK  N TKS  +
Sbjct: 1350 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTI 1409

Query: 1388 QNTDLIDRS 1396
            +N D+++R+
Sbjct: 1410 KNIDILNRT 1418

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 1366 bits (3536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 733/1393 (52%), Positives = 961/1393 (68%), Gaps = 60/1393 (4%)

Query: 32   SRSRTPRKLVLGSPDKRFAFSQPVXXXXX--NVPHLQPLKNELSSSRGR---VYXXXXXX 86
            ++S TPRKLVL S + R+AFSQP        +VP+LQP +   + SRGR    Y      
Sbjct: 56   AKSHTPRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPE---APSRGRDYKAYSQSPPR 112

Query: 87   XXXXXXXXKLELIQLSPMKKSRLESQKFQESRAMMGSIQ-RLCIDRLVLHNFKSYAGTQV 145
                    +LEL+QLSP+K SR+E QK  +S    G  Q RL ID+LVL NFKSYAG QV
Sbjct: 113  SPGRSPTRRLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQV 172

Query: 146  VGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHV 205
            VGPFH SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIHKSE  P+L SC V
Sbjct: 173  VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSV 232

Query: 206  DIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGID 265
             + F+YV DEP GT+ I ++KP +VI RKAFRNN+SKYY+NGKES+YT +T+LL++EGID
Sbjct: 233  AVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGID 292

Query: 266  LDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLND 325
            LDHKRFLILQGEVE+IAQMK KAEKESDDGLLEYLEDIIGTA YKPLIE+ LS+I  LN+
Sbjct: 293  LDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNE 352

Query: 326  ICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKE 385
            IC EKENRFEIV REK+SLE GK  ALE+LEKEK LT+L+SKL Q+ L ++  KL ST E
Sbjct: 353  ICLEKENRFEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLASTLE 412

Query: 386  KIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVS 445
            K +   +   +EK K  +  +E+  +++  + +K  +      EK L LEKR  +  RVS
Sbjct: 413  KTSSLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVS 472

Query: 446  LEEKLKNLTQKEVKXXXXXXXXXXXXXXXXAKMEELANDQEQHEKDLLELNGTMKEEKEK 505
            LEE+ KNL  K  K                  +EEL  +Q +HE ++ +LN +++EE+  
Sbjct: 473  LEERTKNLVNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEERRI 532

Query: 506  LXXXXXXXXXXXXXXXXQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQD 565
            L                +I + EK+LEPW+++LQEKK+Q++L E+ +S+ +E+  K++++
Sbjct: 533  LDDIKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKLKKN 592

Query: 566  IILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAH 625
               + + I   + +  E +G +  L+K    +    + G+ +   A  K+KEM+ IL AH
Sbjct: 593  AEALEENIAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAH 652

Query: 626  RQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPR 685
            RQR+++ARSSLS  ENK+KVL AL RLQ+SGRI+GFHGRLGDLG IDD +DVAISTACPR
Sbjct: 653  RQRAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPR 712

Query: 686  LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNN 745
            LDD+VV+TVEC Q CI+YLRKNKLGYARFILLD+LR FNL P+ TPENVPRL+DLV+P +
Sbjct: 713  LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKD 772

Query: 746  PKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGM 805
            PKF NAFYSVLRDTLVA+DLK+AN VAYGK+R+RVVT+DGKLID+SGTMSGGGN   +G+
Sbjct: 773  PKFSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGL 832

Query: 806  MK-SEQQSNSA--FTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELD 862
            M+  + QS+    +T EEV +I+ ELSERE NF++A DT+HEME+ L+K++D+EP++E  
Sbjct: 833  MRIGKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQ 892

Query: 863  ISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEM 922
            I + +++ DSL+SE+  +E +++       +  +   +L+     L+ L+ EY +L+ E 
Sbjct: 893  ILRAEMEADSLASELALAEEQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAET 952

Query: 923  QSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXXXXXQNDIKRY 982
            ++KK+ +K LQ+QIMK+GGT LQ+Q+S V+S++QRI I+                D+ ++
Sbjct: 953  KTKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGDVTKF 1012

Query: 983  QKQAEQLAEELKSCSQEKSLIEN-------NLDSSSKKVDELSESINKLKDELELTEERV 1035
            QKQ + +  +++  S E  +IE        +L  +   V  +    + L+++ E  +E+V
Sbjct: 1013 QKQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKV 1072

Query: 1036 RKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRDVTAT 1095
             + E  IDE       F++LE++   +L+KL  L   +  +  +    LN L IRDVT T
Sbjct: 1073 AEMEGKIDE-------FKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHT 1125

Query: 1096 LQALD-----------ESLENESKNEVAAETPGEEDGEHS-SSLHDPMDVDENQGESTST 1143
            L  LD           E  +  ++ +++ E  GE  GE   +     M++DE        
Sbjct: 1126 LLILDNNQMDILDKEGEDRQETNQEDISGEAKGETQGEEGDNDDRHCMNIDE-------- 1177

Query: 1144 TEAQLQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEIL 1203
                          T + +  G+P+L EDEL+   +E +E +I +L  Y++    DI +L
Sbjct: 1178 --------------TSDEVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVL 1223

Query: 1204 EEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMI 1263
            EEYARRL E+K RK+DLN AVQ+RD+V++  E LKKKR DEFM GFN I M LKEMYQMI
Sbjct: 1224 EEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMI 1283

Query: 1264 TMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPT 1323
            TMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPT
Sbjct: 1284 TMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPT 1343

Query: 1324 PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTK 1383
            PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGVYK  N TK
Sbjct: 1344 PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTK 1403

Query: 1384 SVALQNTDLIDRS 1396
            S  ++N D+++R+
Sbjct: 1404 STTVKNIDILNRN 1416

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1361 bits (3523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 727/1398 (52%), Positives = 971/1398 (69%), Gaps = 73/1398 (5%)

Query: 34   SRTPRKLVLGSPDKRFAFSQP-VXXXXXNVPHLQPLKNELSSSRGR---VYXXXXXXXXX 89
            S TP+KLV+G+ D   + SQP V       P LQ   +  SSSRGR    Y         
Sbjct: 40   SHTPKKLVIGTNDDTTSQSQPIVSSSSLQAPSLQ---HPNSSSRGREQRTYSQSPPRSPG 96

Query: 90   XXXXXKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVGPF 149
                 KLELI++SP+KK+RLE Q+  ++     +  RLCI++LVL +FKSYAG QVVGPF
Sbjct: 97   RSPTRKLELIKISPVKKNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPF 156

Query: 150  HNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFF 209
            H+SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIH SE+HP+L SC V++ F
Sbjct: 157  HSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHF 216

Query: 210  QYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHK 269
            QYV DEPDGTT I ++KP++V+ RKAF+NN+SKYY+N KES+YT +TQLL+ EGIDLDHK
Sbjct: 217  QYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHK 276

Query: 270  RFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEE 329
            RFLILQGEVE+IAQM+PKAEKE +DGLLEYLEDI GTA+YKP IE  L EI  LN+ C E
Sbjct: 277  RFLILQGEVENIAQMRPKAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIE 336

Query: 330  KENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAK 389
            KENRF IV++EKSSLE GK+EALE+LEKEKTLT+LRSK++QY +W+N+ KL ST +K +K
Sbjct: 337  KENRFHIVDQEKSSLETGKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSK 396

Query: 390  AQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLEEK 449
             + +L  E  K ++  +E+ ++K + + +   +  L   EK L  +KR  D+ RV++EEK
Sbjct: 397  LKGQLDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEK 456

Query: 450  LKNLTQKEVKXXXXXXXXXXXXXXXXAKMEELANDQEQHEKDLLELNGTMKEEKEKLXXX 509
            +K++ QK  K                A + EL   Q  +EK+L +LN  +  E+ KL   
Sbjct: 457  IKSVNQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDV 516

Query: 510  XXXXXXXXXXXXXQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIILV 569
                          I + EK+LEPW+ +LQ+K+A+++L E+ +S+ K+++A+I       
Sbjct: 517  KISLKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARI------- 569

Query: 570  NKGIDELRNKMNEQRGSVFSLEKEQV---------DIGRQLTVGQSECDNAVKKIKEMKG 620
            NK I++L+N++   RG    L KE+V         D+  ++    +EC +A  ++K+M  
Sbjct: 570  NKDIEQLKNEI--ARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHE 627

Query: 621  ILTAHRQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAIS 680
            IL A RQR++DAR++ S+ +NK+ VL AL +LQ+SGRISGFHGRLGDLG ID+KYDVAIS
Sbjct: 628  ILIAQRQRTLDARAAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAIS 687

Query: 681  TACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDL 740
            TACPRL+DIVVE+VECGQQCIEYLRKNKLGYARFILLDKLR F+   I+TPENVPRL+DL
Sbjct: 688  TACPRLEDIVVESVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDL 747

Query: 741  VRPNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNF 800
            V+P + KF  AFYSVLRDTL A+ L +AN+VAYGK+R+RVV+LDGKLID+SGTMSGGG+ 
Sbjct: 748  VKPKDDKFIPAFYSVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSH 807

Query: 801  KARGMMKSEQQSNSA---FTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREP 857
              RG+M+  Q ++ +   F+ EEV Q++ EL+E+E +FQIA+DT  EME+ L+KLKDR P
Sbjct: 808  VVRGLMRLSQNNSYSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVP 867

Query: 858  EIELDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRE 917
            EI+L +SK  ++ +S  SE+K  E  L   L+ + +    NEE   AE ++K+LK E R 
Sbjct: 868  EIQLKVSKLVMETESWMSELKLKEKLLLERLEAQKKATGKNEEYQLAEARVKTLKDEQRA 927

Query: 918  LENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXXXXXQN 977
            L ++  + ++++ VL+++IM++GG++LQ+Q+S V S  QR+ I+              +N
Sbjct: 928  LSDQTTTTRQKIAVLKDKIMEIGGSELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAEN 987

Query: 978  DIKR-------YQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDELEL 1030
            ++K+        QK  +  ++E+ S  +    ++  L+S  K VDE  +  +++ ++L+ 
Sbjct: 988  ELKKSAKIVGNTQKDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQ 1047

Query: 1031 TEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIR 1090
             ++R+ + E    E       F++L+I+   +L+KL  L   + KE  +    LN+LKIR
Sbjct: 1048 LKQRLAQMEAGFTE-------FKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIR 1100

Query: 1091 DVTATLQALDESLENESKNEVAAETPGEEDGEHSSSLHDPMDVDENQGESTSTTEAQLQ- 1149
            DVT TLQ LDE                   GE +++   P ++ E + E    T  + + 
Sbjct: 1101 DVTRTLQLLDE-------------------GESTNNSKMPNELQEKRTEGADATRQEGEE 1141

Query: 1150 ---AGEAERRNTE--------ESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYA 1198
               + E E+ N E          L NGLP++ E EL++ +VE +  +I  LQ+YV++   
Sbjct: 1142 SDVSMEEEKSNDEVMEVDEKPHELENGLPRVSEAELKSLDVEDLGAQIEDLQNYVDSVNV 1201

Query: 1199 DIEILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKE 1258
            D+EILEEYA+RL E+K RKVDLN AV ERD +R+    LKK+R DEFM+GF  I M LKE
Sbjct: 1202 DVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKRRFDEFMQGFGIISMTLKE 1261

Query: 1259 MYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALH 1318
            MYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNITNLSGGEKTLSSLALVFALH
Sbjct: 1262 MYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALH 1321

Query: 1319 KYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKN 1378
            KYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVG+YK 
Sbjct: 1322 KYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKT 1381

Query: 1379 KNMTKSVALQNTDLIDRS 1396
            +NMTKS +L+N D+++R+
Sbjct: 1382 QNMTKSASLKNNDILNRT 1399

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1348 bits (3490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 724/1366 (53%), Positives = 930/1366 (68%), Gaps = 13/1366 (0%)

Query: 36   TPRKLVLGSPDKRFAFSQPVXXXXXNV--PHLQPLKNELSSSRGR-VYXXXXXXXXXXXX 92
            TP KL+ GSP ++   SQ        +  P LQP       SRGR VY            
Sbjct: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQP-PTYSQLSRGRSVYSQSPPRSPNRSP 73

Query: 93   XXKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVGPFHNS 152
              ++ELIQLSP+K SRLE QK  + +    + +RL I  L+L+NFKSYAG QVVGPFH+S
Sbjct: 74   ARRIELIQLSPIKNSRLELQKIYDGKQT--TTKRLSIKNLILNNFKSYAGVQVVGPFHSS 131

Query: 153  FSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQYV 212
            FSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQGKLS LIHKSE H +L  C V+I FQYV
Sbjct: 132  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQYV 191

Query: 213  QDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFL 272
             D+ DG T ++     + + RK F+NNTSKYY+NGKESSYT +TQ LR+EGIDLDHKRFL
Sbjct: 192  MDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFL 251

Query: 273  ILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKEN 332
            ILQGEVESIAQMKPKA+ E DDGLLEYLEDIIGTA+YK  I + L E+  LNDIC EKE 
Sbjct: 252  ILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKEI 311

Query: 333  RFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQE 392
            RFE+VE+EK SLE GK +ALE++ KEK LT+L+SK LQ+ + K  +KL  T +KI+   E
Sbjct: 312  RFELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAVTLDKISAFTE 371

Query: 393  KLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLEEKLKN 452
            KL  E+ K  +  +E+  ++    +L+  +  +   + +L  +K    R+ VS EEKLK+
Sbjct: 372  KLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKS 431

Query: 453  LTQKEVKXXXXXXXXXXXXXXXXAKMEELANDQEQHEKDLLELNGTMKEEKEKLXXXXXX 512
            L QK  K                  +  L   Q + E  LLELN ++  E+ +L      
Sbjct: 432  LNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHSERSELDAIKMS 491

Query: 513  XXXXXXXXXXQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIILVNKG 572
                      ++  +EKELEPW  KL+ K +Q+KL E+ I + KES  K+EQ+I  + K 
Sbjct: 492  LRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKD 551

Query: 573  IDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHRQRSIDA 632
            I+  ++++   +  +  LEKE   I   ++  Q ECD+A KK+ +MK +LT HRQR  DA
Sbjct: 552  IESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTDA 611

Query: 633  RSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDIVVE 692
            R +LS  ENKNKVL AL RLQ+SGRI GFHGRLGDLGTIDDKYD+AIS ACPRLDDIVVE
Sbjct: 612  RVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDIVVE 671

Query: 693  TVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNPKFRNAF 752
            TVEC QQCIE+LRKNKLGYARFILLDKL+ FN++ + TPENVPRL+DL  P N  F  A 
Sbjct: 672  TVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFAPAL 731

Query: 753  YSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQS 812
            YSVLRDTLVAKDL +AN+VAYG +R+RVVTLDGKLID+SGTMSGGG+   +G+MKS+Q+S
Sbjct: 732  YSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQRS 791

Query: 813  NSAFTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDS 872
            N  +T+EEVQ+++ EL++RE NF+IA DT  EME ALQK KDR+P I+++ISK K+DID+
Sbjct: 792  NDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKIDIDT 851

Query: 873  LSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKVL 932
            LSSE+++ +  L  L       +  N  L   E +L +L SE   L++E + K +++  L
Sbjct: 852  LSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQISEL 911

Query: 933  QEQIMKVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXXXXXQNDIKRYQKQAEQLAEE 992
            + QIMK+GG KLQ Q+S VDS+ Q++ I+              + ++ R  KQ      +
Sbjct: 912  RAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKLGAEND 971

Query: 993  LKSCSQEKSLIENNLDSSSKKVDELSESINKLKDELELTEERVRKAEESIDEKTVEGRDF 1052
            +  C  E S   N+ ++  + + E    I  ++D+ E   +    A++++D+K      F
Sbjct: 972  INHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAAYVEKF 1031

Query: 1053 EALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQALDE-SLENESKNEV 1111
            ++ EI+    L+KLK L   +  E +     LN+LK+RDV   LQ LDE +L  ES  + 
Sbjct: 1032 KSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPLESLTDR 1091

Query: 1112 AAETPGEEDGEHSSSLHDPMDVDENQGESTSTTEAQLQAGEAERRNTEES---LPNGLPK 1168
            A     +   E +   H   D D N GE+   +E      + E  + ++    +  GLPK
Sbjct: 1092 AVTPSNQCIPEMTVEDH---DADMNDGEAKLISEDPNSFNDQESMDVDQDASYIGPGLPK 1148

Query: 1169 LLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDLNHAVQERD 1228
            L E EL+N ++E + LEI QL++Y++ AYADI+ILEEYA RL EYK RK+DLN +V++R+
Sbjct: 1149 LTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVEKRE 1208

Query: 1229 KVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEGVLFSV 1288
            ++R   E LKK RL+EFM+GF  I M +KE+YQMITMGGNAELELVDSLDPFSEGVLFSV
Sbjct: 1209 EIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVLFSV 1268

Query: 1289 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1348
            MPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK
Sbjct: 1269 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1328

Query: 1349 ERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLID 1394
            ERTKNAQFIVISLRNNMFELA+QL+G+YK+ NMTKS  LQN D+++
Sbjct: 1329 ERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1344 bits (3478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 727/1429 (50%), Positives = 985/1429 (68%), Gaps = 54/1429 (3%)

Query: 3    SPLAKKQKTH------VXXXXXXXXXXXXPDVTRAS--RSRTPRKLVLGSPDKRFAFSQP 54
            +PL+KKQK                     P+VT +S  +S TPRKL+LGS D ++  SQP
Sbjct: 4    TPLSKKQKVVSDEERITPNQNEQDNDKTHPEVTASSFLKSHTPRKLLLGSADNKYVLSQP 63

Query: 55   VXXXXX------NVPHLQPLKNELSSSRGR---VYXXXXXXXXXXXXXXKLELIQLSPMK 105
            +            VP+LQP  ++   SRGR    Y              KLELIQLSP+K
Sbjct: 64   IISSSSHGSSSLQVPNLQPPLSQ--PSRGRDKKAYSQSPPRSPGRSPVRKLELIQLSPIK 121

Query: 106  KSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKS 165
             +R+E QK   S+       RL ID+LVL +FKSYAGTQ+VGPF+ SFSA+VGPNGSGKS
Sbjct: 122  NNRIELQKLYNSKNQNKV--RLYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKS 179

Query: 166  NVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQ 225
            NVIDS+LFVFGFRANKMRQ +L +LIHKSE  P++ SC V++ FQYV DE DGT+ II+ 
Sbjct: 180  NVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIED 239

Query: 226  KPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMK 285
            +  +V+ RKAF+NN+SKYY+NGKES+YT +T+LL++EGIDLDHKRFLILQGEVE+IAQMK
Sbjct: 240  RKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMK 299

Query: 286  PKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLE 345
             KAEKE DDGLLEYLEDIIGT++YK LIE+ + EI  LN+IC EKE RFEIVE EK+SLE
Sbjct: 300  AKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLE 359

Query: 346  QGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHS 405
              K+ ALE++ KEK LT+LRSKL QY L++   KL +T +KI+  +  L  E++K  K  
Sbjct: 360  SDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQ 419

Query: 406  EEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLEEKLKNLTQKEVKXXXXXX 465
             E+     +L+     +      E++L  +KR  D   VS+EE++KNLTQK+ K      
Sbjct: 420  SEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAEKTLH 479

Query: 466  XXXXXXXXXXAKMEELANDQEQHEKDLLELNGTMKEEKEKLXXXXXXXXXXXXXXXXQIR 525
                      + +++L + Q  ++ +   L   + +E+ KL                QI 
Sbjct: 480  DKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSKLDDIKLSLKDKTKDISSQIS 539

Query: 526  EIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIILVNKGIDELRNKMNEQRG 585
              EK++EPW  K+QEK+ Q++L E+ IS+ KES AK+++ +  +   ID++R +++ +  
Sbjct: 540  LYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNKNS 599

Query: 586  SVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHRQRSIDARSSLSTFENKNKV 645
             + +L+KEQV + +++++G+SEC  A +K KEM+ IL +HRQR+IDARS+L   ENK+ V
Sbjct: 600  IIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMAENKSTV 659

Query: 646  LAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDIVVETVECGQQCIEYLR 705
            L+AL RLQ+SGRI+GFHGRLGDLG I DKYD+AISTAC RLDDIVV++VECGQQCIEYLR
Sbjct: 660  LSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIVVDSVECGQQCIEYLR 719

Query: 706  KNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDL 765
            KNKLGYARFILLDKLRNF L  ++TPENV RL+DLV+P + KF NAFYSVLRDTLVA D+
Sbjct: 720  KNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVATDI 779

Query: 766  KEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMMK---SEQQSNSAFTAEEVQ 822
            ++AN+VAYGK+RYRVVTLDGKLID+SGTM+GGG+  ++G+MK   S  +    + A +V+
Sbjct: 780  RQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKNSNMEHLEVYEAGDVE 839

Query: 823  QIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEG 882
            +I+++L+ERE+NF+IA DTL EM   L++L+D+EPEIEL+I+K  +D+DSL+ ++   E 
Sbjct: 840  KIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDSLNDQLNLKEQ 899

Query: 883  RLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIMKVGGT 942
            +L+ L +      +  + L  AE  L++L++E+R LE++ QSKK+++  L+E+IMK+GG 
Sbjct: 900  QLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEEIMKIGGK 959

Query: 943  KLQMQSSMVDSVNQRITIVXXXXXXXXXXXXXXQNDIKRYQKQAEQLAEELKSCSQEKSL 1002
            +LQ+Q+S V S+ +RI IV              + ++++ Q+  +Q   +  +C  +   
Sbjct: 960  ELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAELDNTACVNDLET 1019

Query: 1003 IENNLDSSSKKVDELSESINKL---KDEL----ELTEERVRKAEESIDEKTVEGRDFEAL 1055
            ++ N+ +   ++ E     + +   KD+L    E  +E+++  EES++E       +++ 
Sbjct: 1020 LQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNE-------YKSF 1072

Query: 1056 EIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQALDESLENESKNEVAAET 1115
            EI+   +L+KL  L     K+       L S  +RDVT +L    E ++NE+ N      
Sbjct: 1073 EIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSL----EKIQNENANNSVGVK 1128

Query: 1116 PGEEDGEHSSSLHDPMDVDENQGEST---STTEAQLQAGEAER-------RNTEESLPNG 1165
                + + SSS H P +VD++  E +   +  ++Q +  E E+        N  E +  G
Sbjct: 1129 QSSNNLDVSSS-HTP-NVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVTEEVSKG 1186

Query: 1166 LPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDLNHAVQ 1225
            +PKL +D+L++ +++++E EI+QLQDYVEN+ ADIE+LEEY RRL E+K RK+DLN  V 
Sbjct: 1187 IPKLTDDDLKSIDLDSLESEINQLQDYVENSNADIELLEEYIRRLEEFKKRKLDLNTTVA 1246

Query: 1226 ERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEGVL 1285
             RD+VR   E LKK R DEFMEGF+ I + LKEMYQMITMGGNAELELVDSLDPFSEGV 
Sbjct: 1247 RRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVT 1306

Query: 1286 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1345
            FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN
Sbjct: 1307 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1366

Query: 1346 YIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLID 1394
            YIKERTKNAQFIVISLRNNMFELA+QLVG+YK  NMT+S  L+N D+++
Sbjct: 1367 YIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILN 1415

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 1344 bits (3478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 735/1405 (52%), Positives = 967/1405 (68%), Gaps = 76/1405 (5%)

Query: 29   TRASRSRTPRKLVLGSPDKRFAFSQPVXXXXX--NVPHLQPLKNELSSSRGR---VYXXX 83
            T  ++S TPRKLVL S + R+AFSQP        +VP+LQP     +SSRGR    Y   
Sbjct: 53   TSYAKSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPG---TSSRGRDYKAYSQS 109

Query: 84   XXXXXXXXXXXKLELIQLSPMKKSRLESQKFQESRAMMGSIQ-RLCIDRLVLHNFKSYAG 142
                       +LEL+QLSP+K SR+E QK   S       Q RL I+ LVL NFKSYAG
Sbjct: 110  PPRSPGRSPTRRLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAG 169

Query: 143  TQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDS 202
             QVVGPFH SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIHKSE  P+L S
Sbjct: 170  RQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQS 229

Query: 203  CHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDE 262
            C V + F+YV DE  GT+ I ++KP +VI RKAF+NN+SKYY+NGKESSYT +T+LL++E
Sbjct: 230  CSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNE 289

Query: 263  GIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAK 322
            GIDLDHKRFLILQGEVE+IAQMKPKAEKESDDGLLEYLEDIIGTA YKPLIE  +++I  
Sbjct: 290  GIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEA 349

Query: 323  LNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNS 382
            LN++C EKENRFEIV+REK+SLE GK  ALE+L KEK LT+L+SKL Q+ + ++  KL S
Sbjct: 350  LNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLAS 409

Query: 383  TKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRD 442
            T EKI+   +    EK K  +  +++  +K   + +K  +      EK L LE+R  +  
Sbjct: 410  TLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGT 469

Query: 443  RVSLEEKLKNLTQKEVKXXXXXXXXXXXXXXXXAKMEELANDQEQHEKDLLELNGTMKEE 502
            RVSLEE+ KNL  K  K                  ++EL   Q +HE ++ +LN  ++EE
Sbjct: 470  RVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEE 529

Query: 503  KEKLXXXXXXXXXXXXXXXXQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKI 562
            +  L                +I + EKELEPW+++LQEK++Q++L E+ +S+ +E+ +K+
Sbjct: 530  RSVLDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLEETQSKL 589

Query: 563  EQDIILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGIL 622
            ++++  + + I   +    E +  + +L+K+   +  + + G+    +A  K++EM+ +L
Sbjct: 590  KKNVETMEEKILARKAHKQELQDLILNLKKKLSSLRDERSQGEENFSSAHLKLEEMQKVL 649

Query: 623  TAHRQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTA 682
              HRQR+++ARSSLS  +NK+KVL AL +LQ+SGRI+GFHGRLGDLG ID+ +DVAISTA
Sbjct: 650  NTHRQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTA 709

Query: 683  CPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVR 742
            CPRLDD+VV+TVEC QQCI+YLRKNKLGYARFILLD+LR FNL PI TPENVPRL+DLV+
Sbjct: 710  CPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVK 769

Query: 743  PNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKA 802
            P +PKF NAFYSVLRDTLVA+ LK+AN VAYG++R+RVVT+DGKLID+SGT+SGGGN  +
Sbjct: 770  PKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVS 829

Query: 803  RGMMK-SEQQSNSA--FTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEI 859
            +G+M+    QSN    +T EEV +I+ ELSERE+NF++A DT+HEME  L+ L+D+EP I
Sbjct: 830  KGLMRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAI 889

Query: 860  ELDISKRKLDIDSLSSEM-----KASEGRLEY--LLQEKAQKESSNEELSTAEVKLKSLK 912
            E  ISK +++ DS++SE+     +  E R+ Y   L +KAQ       ++     L+ LK
Sbjct: 890  ESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQ-------VNMIMKNLERLK 942

Query: 913  SEYRELENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXX 972
             E+ +L++E ++KK+++KVLQ +IMK+GGTKLQMQ+S V S+ QR+ I+           
Sbjct: 943  GEHDDLQSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLKKVKSGI 1002

Query: 973  XXXQNDIKRYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDE----LSESIN---KLK 1025
               + D+ ++QKQ +    +++  S E   IE  L  +   + E    ++E+ N   +LK
Sbjct: 1003 KKSEGDVLKFQKQLKNSERDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRSELK 1062

Query: 1026 DELELTEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLN 1085
            +E E  +E V + EE+IDE       F++LEI+   +L+KL  L   + KE  +    L+
Sbjct: 1063 EESEQLKEMVAETEENIDE-------FKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLS 1115

Query: 1086 SLKIRDVTATLQALDES----LENESKNEVA-------AETPGE---EDGEHSSSLHDPM 1131
             L IRDVT TL+ LD +    ++ ++K E A       +ET  E   ++ E +   H  M
Sbjct: 1116 ELSIRDVTHTLEILDNNTMDIVKTDNKIEQAVVKEKRSSETQDEKNIQEEERTCDDHHSM 1175

Query: 1132 DVDENQGESTSTTEAQLQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQD 1191
            D+DE   E                      +  G+P+  E+EL+  ++E +E EI +L  
Sbjct: 1176 DIDETSNE----------------------VIRGIPRFSEEELKELDIELLEKEISELSY 1213

Query: 1192 YVENAYADIEILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNA 1251
            Y++    DI +LEEYARRL E+K RK+DLN AVQ+RD+V+   E LKKKR DEFM GFN 
Sbjct: 1214 YIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNI 1273

Query: 1252 ICMILKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSL 1311
            I M LKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNITNLSGGEKTLSSL
Sbjct: 1274 ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSL 1333

Query: 1312 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQ 1371
            ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+Q
Sbjct: 1334 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQ 1393

Query: 1372 LVGVYKNKNMTKSVALQNTDLIDRS 1396
            LVG+YK  N T+S  ++N D+++R+
Sbjct: 1394 LVGIYKRDNRTRSTTVKNIDILNRT 1418

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1342 bits (3473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 732/1390 (52%), Positives = 973/1390 (70%), Gaps = 44/1390 (3%)

Query: 33   RSRTPRKLVLGSPDKRFAFSQPVX---XXXXNVPHLQPLKNELSSSRGRVYXXXXXX--- 86
            +S+TP+KL+L   D   A +             P L P     SSSRGR           
Sbjct: 54   KSQTPKKLILRDYDS-IAITPTAAMPPSSSLQAPSLHPPTE--SSSRGRTARTYSQSPPR 110

Query: 87   ----XXXXXXXXKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAG 142
                        KLELIQLSP+K SR+  QK  ES+     I+RLCID+LVLH+FKSYAG
Sbjct: 111  SPARSPARSPTRKLELIQLSPVKNSRIALQKIYESKNE-KQIERLCIDKLVLHDFKSYAG 169

Query: 143  TQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDS 202
            TQVVGPFH+SFSAVVGPNGSGKSNVIDS+LFVFGFRA+KMRQ +LS+LIHKSE  PDL S
Sbjct: 170  TQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKS 229

Query: 203  CHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDE 262
            C V++ F+YV D+PDGTT I   K  +VI RKAF+NNTSKYY+NGKES+YT +T+LL+DE
Sbjct: 230  CSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDE 289

Query: 263  GIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAK 322
            GIDLDH RFLILQGEVE+IAQMKPKAE + DDGLLEYLEDIIGTA+YKPLIE    EI  
Sbjct: 290  GIDLDHNRFLILQGEVENIAQMKPKAENDGDDGLLEYLEDIIGTAKYKPLIEKKFEEIEA 349

Query: 323  LNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNS 382
            LN+IC EKENRFEIV+REK+SLE GK+EALE+LEKEK LT+++SKL QY LW++ +KL++
Sbjct: 350  LNEICIEKENRFEIVDREKASLESGKDEALEFLEKEKELTLVKSKLYQYKLWQDNKKLST 409

Query: 383  TKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRD 442
            T EK++  +E+    K K +    +M  +      +   +    E EKKL ++KR  D +
Sbjct: 410  TLEKLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTE 469

Query: 443  RVSLEEKLKNLTQKEVKXXXXXXXXXXXXXXXXAKMEELANDQEQHEKDLLELNGTMKEE 502
            RVSLEE+ KN+ +K+ K                 K+E+L  ++ ++E  L ELN  ++ E
Sbjct: 470  RVSLEEQRKNIMKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIE 529

Query: 503  KEKLXXXXXXXXXXXXXXXXQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKI 562
            +  L                +I + EKELEPWN++LQ KK+Q++++E+ IS+ KE   K+
Sbjct: 530  RGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKL 589

Query: 563  EQDIILVNKGID-ELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGI 621
            E DI  +N  I  ++  K++ ++  + SL  E   I +++++G +E  NA +K++EMK +
Sbjct: 590  ENDIENLNSLISVKIEEKISREK-EIGSLRNELNRITKEVSIGDTEYTNAKEKLREMKAV 648

Query: 622  LTAHRQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAIST 681
            L  HRQ++IDAR+SLS  ENKN+VLA+L RLQ+SGRISGF+GRLGDLG IDD+YD+AIST
Sbjct: 649  LNQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAIST 708

Query: 682  ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLV 741
            ACPRL+D+VVETVECGQQCIEYLRKNKLGYARFILL+KLRNF+++ I TP NVPRL+DLV
Sbjct: 709  ACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLV 768

Query: 742  RPNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFK 801
              ++PKF  AFYSVLRDTLV  +LK+AN+VAYG +R+RVVTL G+LID+SGTMSGGG   
Sbjct: 769  ISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVSGTMSGGGTQT 828

Query: 802  ARGMMKSEQQSNSAF---TAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPE 858
            +RG+MK  +  NS F   T E+V++I+KEL+ RE NF+IA +T  EME  L++LKDR+P+
Sbjct: 829  SRGLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPD 888

Query: 859  IELDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYREL 918
            +EL+ISK +L+I S  +E +  + +L    Q   +  S+NEELST E +L +L+++Y+ L
Sbjct: 889  VELEISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSL 948

Query: 919  ENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXXXXXQND 978
            + E +SKK  +K L+++IMKVGG KLQ+QSS VDS+ Q+  I+              +ND
Sbjct: 949  QLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIL-------NGKHKKDKND 1001

Query: 979  IKRYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINK---LKDELELTEERV 1035
            +K+ + + ++L+++   CS +     + L+++  ++ ++S+S+++   L  ELE + E  
Sbjct: 1002 LKKAETELKRLSKKQSECSTDLLTSTDKLENTDGQLSKISKSLSETETLLHELEFSREES 1061

Query: 1036 RKAEESIDEKTVEGRD----FEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRD 1091
             +  E++ ++  E  +    F+  +++   + +KL  L   + K+       L SLKIRD
Sbjct: 1062 LQNSENLKDQLKEFEENLNSFKVFQLEHQNKEEKLNNLLNFIKKDIRSTDSELQSLKIRD 1121

Query: 1092 VTATLQALDESLENESKNEVAAETPGEEDGEHSSSLHDPMDVDEN-QGESTSTTEAQLQA 1150
            +T TLQ LD    ++ + +V+      +D   S S ++ +   EN +G    T E+ +  
Sbjct: 1122 ITHTLQELDNGNIDQDEEDVSM-----KDNAVSVSANNSLGNSENMEGVEIETNESDVSP 1176

Query: 1151 G-----EAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEE 1205
                  E E       +  G+P++ EDE +N +VE +E +  QLQDY++    +I++LEE
Sbjct: 1177 DANNDLEMEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEE 1236

Query: 1206 YARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITM 1265
            YARR+ EYK RK+DLN+AV ER+KVR+  + LKK R +EFM+GF  I + LKEMYQMITM
Sbjct: 1237 YARRVAEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITM 1296

Query: 1266 GGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPL 1325
            GGNAELELVDSLDPFSEGV FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPL
Sbjct: 1297 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPL 1356

Query: 1326 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSV 1385
            YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVG+YK+ N TKS 
Sbjct: 1357 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSA 1416

Query: 1386 ALQNTDLIDR 1395
             LQN D+I+R
Sbjct: 1417 TLQNNDIINR 1426

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1315 bits (3404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 721/1395 (51%), Positives = 954/1395 (68%), Gaps = 74/1395 (5%)

Query: 32   SRSRTPRKLVLGSPDKRFAFSQPVXXXXXNVPH-LQPLKNELSSSRGR----VYXXXXXX 86
            S+S TPRKL+LG  D R+AFSQP           LQP  +  SSSRGR     Y      
Sbjct: 51   SKSHTPRKLILGQNDNRYAFSQPSVSSSSFQVPTLQPPDS--SSSRGRKDIKSYSQSPPR 108

Query: 87   XXXXXXXXKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVV 146
                    +LELIQLSP+K +R++ ++  ++       +RL I++L L+NFKSYAG QVV
Sbjct: 109  SPGRSPKRRLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVV 168

Query: 147  GPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVD 206
            GPFH SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIHKSE  PDL SC VD
Sbjct: 169  GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVD 228

Query: 207  IFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDL 266
            + F Y  DE DG T I + KP +VI RKAF+NN+SKYY+NGKES+YT +T+LL++EGIDL
Sbjct: 229  VEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDL 288

Query: 267  DHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDI 326
            DHKRFLILQGEVE+IAQMKPKAEKESDDGLLEYLEDIIGT++YK LIE  L EI  LN+I
Sbjct: 289  DHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEI 348

Query: 327  CEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEK 386
            C EKENRFEIV+REK+SLE GKN ALE+LEKEK LT+ +SKLLQY+LW+N  KL +T +K
Sbjct: 349  CIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQK 408

Query: 387  IAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSL 446
            I+   E+ + EK+K      E+   K  L   +  +  L   EK+    KR  + + VSL
Sbjct: 409  ISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSL 468

Query: 447  EEKLKNLTQKEVKXXXXXXXXXXXXXXXXAKMEELANDQEQHEKDLLELNGTMKEEKEKL 506
            +EKLKNLTQK+ K                ++++EL   Q+++  +L  LN  ++ E+E L
Sbjct: 469  DEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESL 528

Query: 507  XXXXXXXXXXXXXXXXQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDI 566
                            +I   E +LEPWN+K+QEKK +++L E+ IS+ +E   K++ DI
Sbjct: 529  EAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDI 588

Query: 567  ILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHR 626
             ++++ +        ++   + +L+K+Q  I ++++ G++EC++   K+KEMK +L   R
Sbjct: 589  KVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQR 648

Query: 627  QRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRL 686
            QR+ +AR +L+  +N+ KVL AL +LQ+SGRI GFHGRLGDLGTID+ YDVA+STACPRL
Sbjct: 649  QRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRL 708

Query: 687  DDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNP 746
            DDIVVETVECGQQCIEYLRKNKLGYARFILLDKLR+FN + I+TP+NVPRL+DL++P + 
Sbjct: 709  DDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDS 768

Query: 747  KFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMM 806
            KF  AFYSVLRDTLVAKDLK+AN+VAYG++RYRVVTLDGKLID+SGTMSGGGN  ++G+M
Sbjct: 769  KFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLM 828

Query: 807  KSEQQSNSAF---TAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDI 863
              +++  + F     E+V+QI+K+LS++E NF++A +  +EME  LQKL +R+PEIEL+I
Sbjct: 829  MLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEI 888

Query: 864  SKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESS----NEELSTAEVKLKSLKSEYRELE 919
            SK  ++ID+ S+E+K+ E +    LQEK   ++S    NEEL  A   L+ LK E+  L+
Sbjct: 889  SKIIMEIDTYSAEIKSKERQ----LQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQ 944

Query: 920  NEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXXXXXQNDI 979
            ++ ++KKK++  L+E+IMK+GG +LQ+Q+S V S+ QRI I+                  
Sbjct: 945  DKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSK------- 997

Query: 980  KRYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINK--------------LK 1025
            K+   + E+  + L +   + +LI +++   S+++D++S S+N               LK
Sbjct: 998  KKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLK 1057

Query: 1026 DELELTEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLN 1085
            DE +  +++V   EE+I+E       F++ EI+   +L+KL  L   +  +      SL+
Sbjct: 1058 DECDELKDKVVDLEENINE-------FKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLS 1110

Query: 1086 SLKIRDVTATLQALDESLENESKN------EVAAETPGEEDGEHSSSLHDPMDVDENQGE 1139
             L +R +   L ALDE  E ++ N      E   +  G E    +    D MD+D     
Sbjct: 1111 KLTLRKMHQVLMALDEESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDID----- 1165

Query: 1140 STSTTEAQLQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYAD 1199
                             N  E + NGLP L +DEL   ++  VE E+  L+ Y+E+  A+
Sbjct: 1166 -----------------NGAEVISNGLPILSDDELSALDITLVETEVSDLEKYIESTDAN 1208

Query: 1200 IEILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEM 1259
            IE+LEEY +RL E+K RK+DLN AV +R+ VR+  E LKK R +EFM GF  I M LKEM
Sbjct: 1209 IEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEM 1268

Query: 1260 YQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHK 1319
            YQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHK
Sbjct: 1269 YQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHK 1328

Query: 1320 YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNK 1379
            YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVG+YK +
Sbjct: 1329 YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCE 1388

Query: 1380 NMTKSVALQNTDLID 1394
            N T S  ++N ++++
Sbjct: 1389 NRTHSATIKNREILN 1403

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1299 bits (3362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 713/1375 (51%), Positives = 949/1375 (69%), Gaps = 18/1375 (1%)

Query: 32   SRSRTPRKLVLGSPDKRFAFSQPVXXXXX-NVPHLQPLKNELSSSRGR---VYXXXXXXX 87
            + ++TPRKLV+G+ D R+A S          VP LQP     +SSRGR    Y       
Sbjct: 47   AHAKTPRKLVVGNGDNRYAHSSQSISSSSLQVPPLQP---PATSSRGRGSKTYSQSPPRS 103

Query: 88   XXXXXXXKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVG 147
                   KLELIQ+SP+K SRLE QK  +++       RLCID+L+L +FKSYAG QVVG
Sbjct: 104  PGRSPTRKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVG 163

Query: 148  PFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDI 207
            PF+ SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIHKSE +P L SC V++
Sbjct: 164  PFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEV 223

Query: 208  FFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLD 267
             F+YV DEP G T I ++KP++V+ RKAFRNNTSKYY+N +E++Y  +T+LL+ EG+DLD
Sbjct: 224  HFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLD 283

Query: 268  HKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDIC 327
            HKRFLILQGEVE+IAQMK KAE+E +DGLLEYLEDIIGTA+YKPLIE  L+++  LNDIC
Sbjct: 284  HKRFLILQGEVENIAQMKSKAEREGEDGLLEYLEDIIGTAKYKPLIEKNLADMESLNDIC 343

Query: 328  EEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKI 387
             EKENRF+IV+REK+SLE GK EAL +LE E+ LT+ +SKL QYH+  +  KL +T +KI
Sbjct: 344  IEKENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKI 403

Query: 388  AKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLE 447
                +KL  E  K     +E+  ++A    L+  L +    EK+L  +KR  D   V  E
Sbjct: 404  TNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNE 463

Query: 448  EKLKNLTQKEVKXXXXXXXXXXXXXXXXAKMEELANDQEQHEKDLLELNGTMKEEKEKLX 507
            EK+KN  +K  K                A++ EL   Q  +E  L ELN   + EK KL 
Sbjct: 464  EKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLE 523

Query: 508  XXXXXXXXXXXXXXXQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDII 567
                           +I ++EKELEPWN +LQEKK Q++L E+ IS+ KE+ AK+ Q+I 
Sbjct: 524  KIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEID 583

Query: 568  LVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHRQ 627
               + I+  + ++ +    + SL  +   +  +++ G+ EC NA  ++KEM+ IL   RQ
Sbjct: 584  QFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQ 643

Query: 628  RSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLD 687
            +++DARS+LS  ENK+KVL AL RLQ+SGRISGFHGRLGDLG ID+KYDVAISTACPRL+
Sbjct: 644  KALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLE 703

Query: 688  DIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNPK 747
            DIVVETVECGQQCIEYLRKNKLGYARFILLDKLR FNL  I TPE+VPRL+DL+ P +PK
Sbjct: 704  DIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPK 763

Query: 748  FRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMM- 806
            F +AF+SVL +TLVA DLK+AN+VAYGK+R+RVVTLDG LID+SGTMSGGG+  +RG+M 
Sbjct: 764  FSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQ 823

Query: 807  --KSEQQSNSAFTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDIS 864
              +++ +    +++EEV Q++  L ERE NFQ+A+DT+++MEE L+ LK++EP IE +IS
Sbjct: 824  INRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNIS 883

Query: 865  KRKLDIDSLSSEMKASEGRLEYLLQEKA--QKESSNEELSTAEVKLKSLKSEYRELENEM 922
            +  ++I+S +SE+K  E  ++ L  E+A    + +N EL      ++SLK E++ ++N+ 
Sbjct: 884  QLTMEIESWNSEIKIKE--IQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQT 941

Query: 923  QSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXXXXXQNDIKRY 982
            +SKK  ++ L+ +IM++GG +L++QSS VDSV QRI IV              +N+I + 
Sbjct: 942  KSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKS 1001

Query: 983  QKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDELELTEERVRKAEESI 1042
             K   + + +L++ +QE   ++  ++     ++++ ES+  ++   E   E  R  E+ +
Sbjct: 1002 HKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKL 1061

Query: 1043 DEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQALDES 1102
            ++   +   F++ E++   +L+KL  L   L KE   +   L  LKIRDVT  L  L + 
Sbjct: 1062 NDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDE 1121

Query: 1103 LENESKNEVAAETPGEEDGEHSSSLHDPMDVDENQGESTSTTEAQLQA-GEAERRNTEES 1161
              N S     +E P  +  E  SS+ +  D +++        +A+ Q   + +  +  E 
Sbjct: 1122 SNNASD---PSENPVSDVEESESSVGEGKDENKDLDAQDQVQDAEKQGDNQMDVEDGGEY 1178

Query: 1162 LPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDLN 1221
               GL +  EDEL   E+E +E EI  LQ++++ + ADI++LEEYARRLIE+K+R++DLN
Sbjct: 1179 SDRGLTQFSEDELHEIEIEELEKEIEDLQNFLDASNADIDVLEEYARRLIEFKSRRLDLN 1238

Query: 1222 HAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFS 1281
             AV+ER+KV++  + LKKKR DEFM+GF  I M LKEMYQMITMGGNAELELVD+LDPFS
Sbjct: 1239 QAVEERNKVKEKLDELKKKRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFS 1298

Query: 1282 EGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1341
            EGV FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS
Sbjct: 1299 EGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1358

Query: 1342 IVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLIDRS 1396
            IVANYIKERTKNAQFIVISLRNNMFELA+QLVG+YK  N TKS  ++N D +  S
Sbjct: 1359 IVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVSVS 1413

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1248 bits (3230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 692/1373 (50%), Positives = 934/1373 (68%), Gaps = 27/1373 (1%)

Query: 32   SRSRTPRKLVLGSPDKRFAFSQP-VXXXXXNVPHLQPLKNELSSSRGR----VYXXXXXX 86
            S+S TPRKL+L   D R+AFSQP V      VP LQP +   SSSRGR    VY      
Sbjct: 53   SKSHTPRKLILHQSDNRYAFSQPTVSASSLQVPSLQPPETSSSSSRGRRDIKVYSQSPPR 112

Query: 87   XXXXXXXXKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVV 146
                    KLELIQLSP+K +R+  +K QE        +RL I++LVL+NFKSYAG QV+
Sbjct: 113  SPGRSPTRKLELIQLSPVKNNRI--RKLQELYNSQIKKERLFINKLVLNNFKSYAGEQVI 170

Query: 147  GPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVD 206
            GPF+ +FSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIHKSE  P+L SC VD
Sbjct: 171  GPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVD 230

Query: 207  IFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDL 266
            + FQYV D+ +G++ I   KP ++I RKAF+NN+SKY++NGKESSYT +T+LL++EGIDL
Sbjct: 231  VEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDL 290

Query: 267  DHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDI 326
            DHKRFLILQGEVE+IAQMKPKAE+E DDGLLEYLEDIIGTA YK  IE    E+  LN+I
Sbjct: 291  DHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEI 350

Query: 327  CEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEK 386
            C EKENRFEIVEREK+SLE  KN ALE+++KE+ LT+ +SKLLQY++ K  +KL ST +K
Sbjct: 351  CIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQK 410

Query: 387  IAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSL 446
            ++  QE+   E  K      E   ++ + + +   +  + E  K  T +KR     + SL
Sbjct: 411  LSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASL 470

Query: 447  EEKLKNLTQKEVKXXXXXXXXXXXXXXXXAKMEELANDQEQHEKDLLELNGTMKEEKEKL 506
            EEK+K+ T+K+ K                 ++E L  DQ++ E +L  L   +K+EK  L
Sbjct: 471  EEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLLSELKKEKNVL 530

Query: 507  XXXXXXXXXXXXXXXXQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDI 566
                            +I + E+ELEPW  +LQEKK ++++ E+ IS+ +E+ +K++ +I
Sbjct: 531  EEIKLSLKDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQSKLKDEI 590

Query: 567  -ILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAH 625
              L N    +  NK N Q   +  L+ +   I  +   G+SEC NA  KIK+M+ +L   
Sbjct: 591  EKLKNDLKCQFENKKN-QEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQ 649

Query: 626  RQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPR 685
            RQ+ +DARS L+T ENK+KVL+AL +LQ+SGRISGF+GRLGDLG ID++YD+AISTA  R
Sbjct: 650  RQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASAR 709

Query: 686  LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNN 745
            LDDIVV++VECGQ CIEYLRKNKLGYARFILL+KLRN  L  I+TPENV RL+DLV+P+ 
Sbjct: 710  LDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDK 769

Query: 746  PKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGM 805
              F  AFYSVLR+TLVAKDLK+AN+VAYG  R+RVVT+DGKLID+SGT++GGG   A+G+
Sbjct: 770  DIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGL 829

Query: 806  M---KSEQQSNSAFTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELD 862
            M   K  Q++   ++ +++++I+KEL ERE+NF+ A DT  EME+ALQ+LKDR+PE+EL+
Sbjct: 830  MKLRKKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELE 889

Query: 863  ISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEM 922
            ISK  +D D  S E+++++ +L+  +    +   + +E+   E +L  L+ EY+ L +  
Sbjct: 890  ISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHQLNLLQKEYQLLLDST 949

Query: 923  QSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXXXXXQNDIKRY 982
            ++  +++  L+++IM++GG  LQMQ+S V+S+ Q I I+              +N+I+R 
Sbjct: 950  KNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRS 1009

Query: 983  QKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDELELTEERVRKAEESI 1042
            +K       + K+CS+E       ++S  + +  + E+  KL++E    E      +E I
Sbjct: 1010 EKALSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKI 1069

Query: 1043 DEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQALDES 1102
            +E  +EG  F++ EI    +L+KL  L   + +   E+   L +L++R+ T      DE 
Sbjct: 1070 NEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFG--DEG 1127

Query: 1103 LENESKNEVAAETPGEEDGEHSSSLHDPMDV--DENQGESTSTTEAQLQAGEAERRNTEE 1160
             +N S N V   + G         L D   V  + N     ++TEA+++  +      +E
Sbjct: 1128 -DNNSINGVDRTSHG-----GGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDV----ADE 1177

Query: 1161 SLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDL 1220
              P G+P++ + +L   +V+ +E EI QL++YV     +I++LEEYARRL +Y +RK+DL
Sbjct: 1178 FSP-GIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDL 1236

Query: 1221 NHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPF 1280
            N AV+ R+ +++  + LKKKR DEFM+GF  I M LKEMYQMITMGGNAELEL+DSLDPF
Sbjct: 1237 NQAVERREALKKLLDELKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPF 1296

Query: 1281 SEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1340
            SEGV FSVMPPKKSWRNI NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV
Sbjct: 1297 SEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1356

Query: 1341 SIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLI 1393
            SIVANYIKERTKNAQFIVISLRNNMFELA+QL+G+YK  N TKS A++N D +
Sbjct: 1357 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1244 bits (3218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/1394 (47%), Positives = 945/1394 (67%), Gaps = 47/1394 (3%)

Query: 33   RSRTPRKLVLGSPDKRFAFSQPVXXXXXN--VPHLQ----PLKNELSSSRGRVYXXXXXX 86
            ++ TPRKL++G  + ++A SQP      +  VP LQ    PL  +    R ++Y      
Sbjct: 64   KTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYSQSPPR 123

Query: 87   XX----XXXXXXKLELIQLSPMKKSRLESQKFQESR-AMMGSIQRLCIDRLVLHNFKSYA 141
                        KLELIQLSP+K SRLE QK  ++  A +G + RL I +LVLHNFKSYA
Sbjct: 124  SPGRSPNRSPVRKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSYA 183

Query: 142  GTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLD 201
            G Q +GPF  SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIHKSE   +L+
Sbjct: 184  GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNLN 243

Query: 202  SCHVDIFFQYVQDE----PDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQ 257
             C V++ F+YV+DE     DG T  ++ + ++VI RKAF+NN+SKY++NGKES++T +T+
Sbjct: 244  FCSVEVHFRYVKDEYTAPTDGDT--MEAENTLVITRKAFKNNSSKYFINGKESNFTEVTK 301

Query: 258  LLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTL 317
            LL+++GIDLDHKRFLILQGEVE+IAQMK KAEK+++DGLLEYLEDIIGT  YKPLIE   
Sbjct: 302  LLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQKT 361

Query: 318  SEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNE 377
             EI  +N++C EKENRF IV+ EK+SLE+ K+ ALE+LEKEK LT+L+SKL QYHL+ N 
Sbjct: 362  VEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTLLKSKLTQYHLYVNN 421

Query: 378  QKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKR 437
             K+ +T  +I   +     EK + ++  +E+  ++  +   K  L  L   EK L   KR
Sbjct: 422  DKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRKR 481

Query: 438  ACDRDRVSLEEKLKNLTQKEVKXXXXXXXXXXXXXXXXAKMEELANDQEQHEKDLLELNG 497
              +   VSLEE  KNL QK  K                 +++E +  QE++E ++ +L+ 
Sbjct: 482  EINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQEQSQLQEEYEAEVNDLSK 541

Query: 498  TMKEEKEKLXXXXXXXXXXXXXXXXQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKE 557
              + E++ L                +I  IEKELEP N ++QEKK+Q+KL E  I + ++
Sbjct: 542  QREVEEKILLDIKLQLKDKTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIRD 601

Query: 558  SHAKIEQDIILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKE 617
            S  K+  +I  + + + +L+  + +    V  L K + ++ ++   G  EC +A  K+ E
Sbjct: 602  SKRKVGAEIESLKEELLKLQKDLEDNEKDVTDLNKSKRNLVKEKQEGDKECKDAGVKLNE 661

Query: 618  MKGILTAHRQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDV 677
            MK IL +HRQ++++ARS++ST +NKNKVL +L+R+Q+SGRI+GFHGRLGDLG I D+YDV
Sbjct: 662  MKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQYDV 721

Query: 678  AISTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRL 737
            AISTACPRLDD+VVE+VECGQ CIE+LRKNKLGYARF++LDKL+ F++SPI+TPENVPRL
Sbjct: 722  AISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENVPRL 781

Query: 738  YDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGG 797
            +DLV+P   +F  A YSVLRDTLVAKDLK+AN+VAYGK+R+RVVTLDG+LID+SGTMSGG
Sbjct: 782  FDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSGG 841

Query: 798  GNFKARGMMKSEQQ---SNSAFTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKD 854
            G+   +G+M    +   ++  F+ E++++++ EL+ RE  F +A++T H ME+ L+KL D
Sbjct: 842  GSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRKLCD 901

Query: 855  REPEIELDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSE 914
            REP++EL+ISK+ +DID+L+ +++ +  +L     +  +     ++L      L++L  E
Sbjct: 902  REPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKDTDDLDLLLGNLEALNQE 961

Query: 915  YRELENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXXXX 974
             + L+++ ++  + +  L+++IM++GG++LQ+Q+S V S+NQRI I+             
Sbjct: 962  LKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAKLKKSKTVVKK 1021

Query: 975  XQNDIKRYQK-------QAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDE 1027
               ++K+ +K       ++    EE+        + +N+L   +K ++ + +    L+ E
Sbjct: 1022 LNTELKKARKSLIASTEESTNSTEEIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQE 1081

Query: 1028 LELTEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSL 1087
            LE   +++ ++ E+++E       F+ ++++   ++++   + + L KE  + L  LN+ 
Sbjct: 1082 LENFSDKLHESNENVNE-------FKTIQLELENKIERANSILSYLKKENGQLLEELNNF 1134

Query: 1088 KIRDVTATLQALDESLENESKNEVAAETPGEEDGEHSSSLHDPM----DVD-ENQGESTS 1142
            ++RDVT TL  L E    E     A + P     E +S++ + M    D   EN   S+ 
Sbjct: 1135 RLRDVTHTLDLLREEEGTE-----ANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSL 1189

Query: 1143 TTEAQLQAGE--AERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADI 1200
            +   ++ + E   +  +  + +  G+P+L + EL   + + +  EI+QLQ ++ N   +I
Sbjct: 1190 SNSVKVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINI 1249

Query: 1201 EILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMY 1260
            EILEEYA+RL+E+K RK+DLN++V ER+++    E LKKKR +EFMEGF+ I M LKEMY
Sbjct: 1250 EILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMY 1309

Query: 1261 QMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY 1320
            QMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY
Sbjct: 1310 QMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY 1369

Query: 1321 KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKN 1380
            KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVG+YK++N
Sbjct: 1370 KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHEN 1429

Query: 1381 MTKSVALQNT-DLI 1393
            MTK+  ++N  DLI
Sbjct: 1430 MTKNATIRNREDLI 1443

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1226 bits (3171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/1394 (49%), Positives = 928/1394 (66%), Gaps = 65/1394 (4%)

Query: 30   RASRSRTPRKLVLGSPDKRFAFSQP-VXXXXXNVPHLQPLKNELSSSRGRVYXXXXXX-- 86
            R  RSRTPRKL++ S D RF  SQP +       P LQ      S S GR +        
Sbjct: 64   RHGRSRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQ----HPSVSTGREHKFYSQSPP 119

Query: 87   -----XXXXXXXXKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYA 141
                          LELIQLSP+K +R E QK  E +       RL I+RLVL NFKSYA
Sbjct: 120  RSPHRSPVRSPKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSYA 179

Query: 142  GTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLD 201
            G QVVGPFH +FSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQGKL +LIHKSE +P+L 
Sbjct: 180  GRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELS 239

Query: 202  SCHVDIFFQYVQDEPDGTTSII-QQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLR 260
            SC V+I FQYV D+P+G  S I + K  +V+ RKAF+NN+SKYY+N KESS+T +T LL+
Sbjct: 240  SCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLK 299

Query: 261  DEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEI 320
            +EGIDLDHKRFLILQGEVE+IAQMKPK+EKE DDGLLEYLEDIIGT+ YK  IE+ LS++
Sbjct: 300  NEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKV 359

Query: 321  AKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKL 380
              LN+IC EKENRF IVE+EK SL  GKNEAL+YL  EK L + +SK  Q+ L+ + +KL
Sbjct: 360  EALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKL 419

Query: 381  NSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACD 440
             ST  KI  AQE    E  K +  S+E+  ++ +  +L   L +  + E+KL   +R  +
Sbjct: 420  TSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNN 479

Query: 441  RDRVSLEEKLKNLTQKEVKXXXXXXXXXXXXXXXXAKMEELANDQEQHEKDLLELNGTMK 500
             + +S +E +KN+ +K+                   K+E L N QE + K + ELN  +K
Sbjct: 480  SELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQIEELNEKLK 539

Query: 501  EEKEKLXXXXXXXXXXXXXXXXQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHA 560
             EK KL                +I + EKELEP+ ++LQEK +Q++L ++ IS+  E+  
Sbjct: 540  IEKSKLEEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMSQIQLLQSEISLLNENKD 599

Query: 561  KIEQDIILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKG 620
             +  +II + K I+E +  +      +   +++ ++  +++  G  E +   KKI+EM+ 
Sbjct: 600  NLSNEIISIKKLIEEKKLSVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRD 659

Query: 621  ILTAHRQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAIS 680
             L +HRQ++ D+R+SLS  +NKN VL AL +LQ+SGRISGF+GRLGDLG ID+KYDVAIS
Sbjct: 660  KLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAIS 719

Query: 681  TACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDL 740
            TACPRL+D+VV++V+CGQQCI+YLRKN+LGYARFILLDKLR FNL+ I+TP+N PRL+DL
Sbjct: 720  TACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLFDL 779

Query: 741  VRPNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNF 800
            ++    KF  AFYSVLRDTLVA +L  ANKVAYGK+R+RVVTLDGKLID+SGTMSGGGN+
Sbjct: 780  IQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGGNY 839

Query: 801  KARGMMKSEQQ-SNSAF---TAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDRE 856
              RG+MK  Q    + F   + EEVQ++++EL   E NF++A ++L EM + +  +K++ 
Sbjct: 840  VLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQI 899

Query: 857  PEIELDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYR 916
            P  EL+ISK  ++I+   +E+K    +L+   +   Q+ ++N+E+  A+ KL++LK EY 
Sbjct: 900  PATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYY 959

Query: 917  ELENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXXXXXQ 976
             L ++ +  K+E++ L++QIM  GG +L+MQ+S V S+  ++ IV               
Sbjct: 960  SLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIKKNN 1019

Query: 977  NDIKRYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDELELTEERVR 1036
            N +K+ Q        EL +        + NL++S KKV  LSE + KL+ ++  T+    
Sbjct: 1020 NILKKLQN-------ELNTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAKE 1072

Query: 1037 KAEESID---EKTVE----GRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKI 1089
            +   +ID   EK  E     R+F++ E++   +LDKLK+L   L K+  +    LN+L I
Sbjct: 1073 EILLNIDGNKEKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHLEKQIGKLDTELNALTI 1132

Query: 1090 RDVTATLQALDESLENESKNEVAAETPGEEDGEHSSSL--------HDPMDVDENQGEST 1141
            R+++  L++ DE LE   K +++ +    ED +H+SS          D MD+D       
Sbjct: 1133 REISQNLESFDERLE---KYDIS-KNGATEDTQHTSSALNSVSNINTDTMDID------- 1181

Query: 1142 STTEAQLQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADIE 1201
                           +T+  +  G+ +L E E+   ++E+++ EI  L++ +E++ A+IE
Sbjct: 1182 ---------------STDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIE 1226

Query: 1202 ILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQ 1261
            ILEEY RRL EYK RK DL+ ++ E++  ++  E LKKKRL+EF  GF+ I + LKEMYQ
Sbjct: 1227 ILEEYVRRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQ 1286

Query: 1262 MITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYK 1321
            MITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYK
Sbjct: 1287 MITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYK 1346

Query: 1322 PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNM 1381
            PTPLYVMDEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL+KQLVG+YK++NM
Sbjct: 1347 PTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENM 1406

Query: 1382 TKSVALQNTDLIDR 1395
            T+S  L N D+++R
Sbjct: 1407 TQSATLVNNDMLNR 1420

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1224 bits (3168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 685/1382 (49%), Positives = 931/1382 (67%), Gaps = 53/1382 (3%)

Query: 33   RSRTPRKLVLGSPDKRFAFSQPVXXXXXNVPHLQP--LKNELSSSRGRVYXXXXXX---- 86
            +S TP K+++ +         P      +    QP  L++  SSSRGR            
Sbjct: 45   KSYTPMKVIISNNHSNSISPLPSQLMSSST---QPPSLQHPSSSSRGRAVKAYSQSPPRS 101

Query: 87   ---XXXXXXXXKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGT 143
                       KLELIQLSP+K SR E QK   S+     I+R+C+++LVLHNFKSYAGT
Sbjct: 102  PDRSPVRSPTRKLELIQLSPIKNSRSELQKIYSSK-QEEKIERICLNKLVLHNFKSYAGT 160

Query: 144  QVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSC 203
            Q +GPFH+SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQGKL++LIHKSE +PDL SC
Sbjct: 161  QTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSC 220

Query: 204  HVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEG 263
             VD+ F+Y+ D PD TT I   K  ++I R+AF+N+TSKYYLNGKES+Y  IT LL++EG
Sbjct: 221  AVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEG 280

Query: 264  IDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKL 323
            IDLDH RFLILQGEVE+IAQMKPKAEKE DDGLLEYLEDIIGT +YK LI+    EI  L
Sbjct: 281  IDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEAL 340

Query: 324  NDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNST 383
            NDIC E+ENRF+I++REK SLE  K  ALEYL KEK   I++SKL+QY +W+N  KL++T
Sbjct: 341  NDICIERENRFDIIDREKESLESEKESALEYLSKEKEQVIVKSKLIQYKIWQNNIKLSNT 400

Query: 384  KEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDR 443
             EKI K +++ + EK K T+   ++  ++      +  L  L + EK+L   KR+ D D 
Sbjct: 401  LEKITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDN 460

Query: 444  VSLEEKLKNLTQKEVKXXXXXXXXXXXXXXXXAKMEELANDQEQHEKDLLELNGTMKEEK 503
            VS  E+LKN+ +K  K                 +++   ++++  E  L+EL+  +  E 
Sbjct: 461  VSNTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTES 520

Query: 504  EKLXXXXXXXXXXXXXXXXQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIE 563
            + L                +I + EK+LEPWN+KL E K++++++E+  ++F+ES  K++
Sbjct: 521  QLLENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLK 580

Query: 564  QDIILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILT 623
             +I  + K ++E      ++R  V +L  +  ++ +++  G +E   A +K+ EM+ IL 
Sbjct: 581  ANIEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILI 640

Query: 624  AHRQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTAC 683
              RQ++ DAR+SLS  EN++KVL ALL+LQ+SGRI+GFHGRLG+LG ID+KYDVAISTAC
Sbjct: 641  QDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTAC 700

Query: 684  PRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRP 743
            PRL+DIVV++VECGQQCIEYLRKN LG+ARFILLDKL  F++  I TP NVPRL+DL++ 
Sbjct: 701  PRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKV 760

Query: 744  NNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKAR 803
            N+ KF  AFYSVLR+TLVA DLKEAN VAYGK RYRVVTL G LID+SGTMSGGGN  ++
Sbjct: 761  NDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASK 820

Query: 804  GMMK---SEQQSNSAFTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIE 860
            G M+   S  +  S +++EEV +I+KELS RE N+Q A +T+ EME  L+ LK+ EP+IE
Sbjct: 821  GAMQLSNSTSKEKSTYSSEEVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIE 880

Query: 861  LDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELEN 920
            L+ISK   +IDSL +E      +L       + +++ + +++  +  L +L  + + +E+
Sbjct: 881  LEISKLNFEIDSLENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIES 940

Query: 921  EMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXXXXXQNDIK 980
            +M+SKK  +K LQ++IMK+GG KLQMQ+S VDS+ ++  I+              ++D++
Sbjct: 941  QMKSKKDRIKELQDKIMKIGGIKLQMQNSKVDSLQEQKKILIKKQKSEKAGIMKIESDVR 1000

Query: 981  RYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDELELTEERVRKAEE 1040
            +  K+ ++   +    +++K  +EN L +  + + +   ++N ++D+     E   K+E 
Sbjct: 1001 KLSKKLKESESDNTKLNEKKIALENELKNIEELLAQNENNMNCIQDKKFTLRE---KSEI 1057

Query: 1041 SIDEKT-VEG--RDFEALEIQCVAQLDKLKELFAILNK--EAAEFLHSLNSLKIRDVTAT 1095
            +++E T +EG   +F+ LE++   + +KL  L   + K  +A E  HS  SL IR+V   
Sbjct: 1058 TMNELTEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHS--SLSIREVAYD 1115

Query: 1096 LQALD--ESLENESKNEVAAETPGEEDGEHSSSLHDPMDVDENQGESTSTTEAQLQAGEA 1153
            L  L+  E    + K E+ A+    E  + +  ++D M +++N  E              
Sbjct: 1116 LDLLNIKEQEAQKIKTELYADF---EQNQSNDVINDEMIIEDNNNE-------------- 1158

Query: 1154 ERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIEY 1213
                    +  G+P  +E + + F++ ++E E+ QLQDY E A  D++ILEEY RR+IEY
Sbjct: 1159 --------IAKGIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEY 1210

Query: 1214 KARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELEL 1273
            + RK DLN +V++RDKVR+  E+LKK R +EFME FN I M LKEMYQ+ITMGGNAELEL
Sbjct: 1211 RQRKYDLNQSVEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELEL 1270

Query: 1274 VDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1333
            VDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA
Sbjct: 1271 VDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1330

Query: 1334 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLI 1393
            ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVG+YKN N TKS  L+N D++
Sbjct: 1331 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDIL 1390

Query: 1394 DR 1395
             R
Sbjct: 1391 CR 1392

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1221 bits (3159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 693/1389 (49%), Positives = 941/1389 (67%), Gaps = 48/1389 (3%)

Query: 26   PDVTRA----SRSRTPRKLVLGSPDKRFAFSQP----VXXXXXNVPHLQPLKNELSSSRG 77
            P++ R     S +RTPRKLVLGSP+K++A S            + P LQP      + RG
Sbjct: 14   PEIKRQRVSQSPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQP--PTAHAVRG 71

Query: 78   RVYXXXX----XXXXXXXXXXKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLV 133
            R Y                  KLELI+LSP K +RLE QK  E+       QRLCID+LV
Sbjct: 72   REYSQSPPRSPTRSPTRSPTRKLELIRLSPKKSTRLELQKMHEANTQTS--QRLCIDKLV 129

Query: 134  LHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHK 193
            L+NFKSYAG Q +GPFH SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQGKLSELIHK
Sbjct: 130  LNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHK 189

Query: 194  SELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYT 253
            SE  P L SC V I F YV D  +G T I+    +MV+ R+AF+NN+SKYY+NGKES+YT
Sbjct: 190  SEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYT 249

Query: 254  IITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLI 313
             +T+LL++EGIDLDHKRFLILQGEVESIAQMK KAEK++DDGLLEYLEDIIGTA++KP I
Sbjct: 250  EVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQI 309

Query: 314  ENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHL 373
            E  L EI  LN++C EKENRFE+V++EK +LE GK EALE+L+KE+  TIL+++LLQ  +
Sbjct: 310  EKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQI 369

Query: 374  WKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLT 433
            + + +KL ++ +KI+    +   EK++     +E   +  ++ + K     L    K + 
Sbjct: 370  YDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVN 429

Query: 434  LEKRACDRDRVSLEEKLKNLTQKEVKXXXXXXXXXXXXXXXXAKMEELANDQEQHEKDLL 493
             +KR+ ++D ++ +EKLK++ +K                    ++E L  + +  E +L 
Sbjct: 430  SKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELH 489

Query: 494  ELNGTMKEEKEKLXXXXXXXXXXXXXXXXQIREIEKELEPWNVKLQEKKAQVKLEETTIS 553
             LN ++  EKEKL                ++  +E++LEP+  ++QEK++++KL ET I+
Sbjct: 490  NLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKIT 549

Query: 554  VFKESHAKIEQDIILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVK 613
            + K SH+ + ++   +   I++L+ +  +Q+ +  SL  E+  +  +++  Q EC+ A K
Sbjct: 550  MLKSSHSNLLKEKATIESKIEDLQLEELKQKETETSLRNEKSKVEARISTAQKECEEAQK 609

Query: 614  KIKEMKGILTAHRQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDD 673
            +  EM+ +L   RQ   +A+++L+ F+NKN+VL AL +LQ SGRI+GFHGRLGDLGTIDD
Sbjct: 610  QTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDD 669

Query: 674  KYDVAISTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPEN 733
            +YD+AISTACPRLDDIVVETVECGQQCI++LRKNKLGY RFILLDKLR  NL  I TPEN
Sbjct: 670  QYDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPEN 729

Query: 734  VPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGT 793
            VPRL+DL+ P    FR AFYSVLRDTLVA+DL++AN+VAYGK+R+RVVTLDGKLID+SGT
Sbjct: 730  VPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGT 789

Query: 794  MSGGGNFKARGMMKSEQQSNSAFTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLK 853
            MSGGG+    G+M+S+  + S ++ +EV++++ +LS +E N++ A   +HEME ALQKL 
Sbjct: 790  MSGGGSSPQSGLMRSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLT 849

Query: 854  DREPEIELDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKS 913
            DR PEI++ ISK +L+  S  +E+++   RL  L +E +  E + + L   E KL  L+ 
Sbjct: 850  DRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDILRQ 909

Query: 914  EYRELENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXXX 973
              ++  +  +  + ++  L+++IM+ GG +L+MQ + V S+ Q I I+            
Sbjct: 910  HLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEKQKKEKTRSK 969

Query: 974  XXQNDIKRYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESI---NKLKDELEL 1030
                D+ R  ++  + +EE+  C+++ S++   L+S   + + + E +   N+ K EL  
Sbjct: 970  KLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERKAELNS 1029

Query: 1031 TEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIR 1090
            + E++++   SI+    +  +F+A E++   +L+KL  L   + K+   +  SL SLKIR
Sbjct: 1030 SVEKLKQELLSIER---DSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIR 1086

Query: 1091 DVTATLQALDESLENESKNEVAAETPGEEDGEHSSSLHDPMDVDENQGESTS---TTEAQ 1147
            DV+  L  L++ +  ES  +V A+                M+ D  Q +S +     +A 
Sbjct: 1087 DVSKLLSQLNDGI-IESCTDVTAKV---------------MNGDIVQTQSITDVGNNDAM 1130

Query: 1148 LQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYA 1207
              +GEA       +  +GLP L E ELEN ++ET+ELE+HQLQDY++N   DIE+LEEYA
Sbjct: 1131 EDSGEA-------ATHSGLPSLTETELENLDLETLELELHQLQDYLDNFNGDIEVLEEYA 1183

Query: 1208 RRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGG 1267
            RRL EY+ RK+DLN AV +R++VR   E+ K +RL++FMEGF  I M LKEMYQMITMGG
Sbjct: 1184 RRLAEYQRRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGG 1243

Query: 1268 NAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYV 1327
            NAELELVDSLDPFSEGVLFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYV
Sbjct: 1244 NAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYV 1303

Query: 1328 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVAL 1387
            MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+ LVG+YKN NMTKS  L
Sbjct: 1304 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTL 1363

Query: 1388 QNTDLIDRS 1396
            QN D++  S
Sbjct: 1364 QNIDILHSS 1372

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1147 bits (2966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/1429 (46%), Positives = 922/1429 (64%), Gaps = 67/1429 (4%)

Query: 2    DSPLAKKQKTHVXXXXXXXXXXXXPDVT---RASRSRTPRKLVLGSPDKRF---AFSQPV 55
            D P++K+QK  V            P      ++ R+ TPR L LGS ++       SQ +
Sbjct: 3    DRPVSKRQK--VTEEDEEEDVIHTPKAVTFEQSPRAITPRNL-LGSENRNVLPTGGSQNL 59

Query: 56   XXXXXNVPHLQPLKNELSSSRGR---VYXXXXXXXXXXXXXXKLELIQLSPMKKSRLESQ 112
                  +P L P ++ L S+RGR    Y              +L+LI+LSP+K SR E Q
Sbjct: 60   Q-----IPSLLPPES-LGSARGRDFKSYSQSPPRSPGRSPTRRLKLIELSPIKNSRAELQ 113

Query: 113  KFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLL 172
            K  ES+ +    +RL I +LVL++FKSYAG QV+GPFH SFSA+VGPNGSGKSNVIDS+L
Sbjct: 114  KLYESKKLDVKKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSML 173

Query: 173  FVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIR 232
            FVFGFRANKMRQ +LS+LIHKSE  PDL SC V++ F+YV D+ DG+T+I + K ++V+ 
Sbjct: 174  FVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVT 233

Query: 233  RKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKES 292
            RKAF+NN SKY++NGKES+YT +T LL+ EGIDLDHKRFLILQGEVE+IAQMK KAEKE+
Sbjct: 234  RKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKEN 293

Query: 293  DDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEAL 352
            DDGLLEYLEDIIGT++YK  IE    EI  LN+IC EKENRF IVEREK+SLE GK EAL
Sbjct: 294  DDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEAL 353

Query: 353  EYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMK 412
            ++L KEK L + +SKL QY+L ++ +KL+    K    Q++ + ++ +  K +  ++ + 
Sbjct: 354  QFLNKEKELVLEKSKLYQYNLMQDNKKLDDVLNKKTNVQQEQTKQEDEFRKANSHISDIT 413

Query: 413  ADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLEEKLKNLTQKEVKXXXXXXXXXXXXX 472
            A L  LK  L  +   E  L+  KR  +  +V  E+ + NL  K  +             
Sbjct: 414  ASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKIN 473

Query: 473  XXXAKMEELANDQEQHEKDLLELNGTMKEEKEKLXXXXXXXXXXXXXXXXQIREIEKELE 532
                +++ +  +Q    +    L+  +  EKEKL                QI E EKEL 
Sbjct: 474  STDQEIQTIIEEQSSLAEGTTVLSTNLDIEKEKLENIKLKLREKTEHLTIQIAEYEKELS 533

Query: 533  PWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIILVNKGIDELRNKMNEQRGSVFSLEK 592
            PWN + Q+ K ++K+ E+ +S+ +E+   +E DI  +   I   +  +  Q   + SL +
Sbjct: 534  PWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLLE 593

Query: 593  EQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHRQRSIDARSSLSTFENKNKVLAALLRL 652
            ++  + ++  +G+ EC NA   +  ++  + A RQ++I+ RS+ S  EN NKVL+ALLRL
Sbjct: 594  QKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRL 653

Query: 653  QRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDIVVETVECGQQCIEYLRKNKLGYA 712
            Q+SGR++GFHGRLGDL  ID KYDVAISTACPRL+D+VV+TVE GQQCIEYLRKNKLGYA
Sbjct: 654  QKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYA 713

Query: 713  RFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANKVA 772
            RFILLDKL  FN + I TP+   RL+DL+     +F NAFYSVLRDTLV +++++AN+VA
Sbjct: 714  RFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVA 773

Query: 773  YGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMM---KSEQQSNSAFTAEEVQQIDKELS 829
            YGK+RYRVVTLDG LIDLSGTM+GGG   ++G+M   KS  + ++ F+ EEVQ I+ EL+
Sbjct: 774  YGKKRYRVVTLDGNLIDLSGTMTGGGRNVSKGLMKLSKSSSKGSAFFSPEEVQAIENELN 833

Query: 830  EREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEGRLEYLLQ 889
            ++E+ ++ A D  HEMEE L++L+DR PEI+  +SK+++DI++  +++ ++   LE   +
Sbjct: 834  QKENQYKSALDAYHEMEEELRRLRDRAPEIDNLVSKKEMDIETAHNDINSNINVLEEKRK 893

Query: 890  EKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIMKVGGTKLQMQSS 949
            +    ++ N+   T   KLK LKS+  +++ + +S K ++K ++++I+++GG +L+ QS 
Sbjct: 894  KLESMKNQNDPSITLLAKLKELKSKLDDIDVQTKSTKDKIKTIKDKIIELGGDELKNQSL 953

Query: 950  MVDSVNQRITIVXXXXXXXXXXXXXXQNDIKRYQKQAEQLAEELKSCSQEKSLIENNLDS 1009
            +V  +  +I+                ++ +K++ K+  +  EEL + S+       N D 
Sbjct: 954  LVTDITNKISENSRRLKKIKSNKLKKESLLKKFNKELTEANEELTNFSKNAE----NADI 1009

Query: 1010 SSKKVD----ELSESINKLK-DELELTEE-RVRKAEESIDEKTVEGRDFEALEIQCVAQL 1063
             SK+++    ++ ESI  LK +E++L  E  ++  E    +K V   D++++ ++   +L
Sbjct: 1010 ESKEIESKLLDIKESIENLKENEVKLEHEIEMKHNELESHQKVVS--DYKSISLEYNNKL 1067

Query: 1064 DKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQAL-----------DESLENESKNEVA 1112
            +KL+   A L K    +   L+ L IRDVT  L  +           D  LEN S     
Sbjct: 1068 EKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTEENASVDKSDPKLENTS----- 1122

Query: 1113 AETPGEEDG-----EHSSSLHDPMDVDENQGESTSTTEAQLQAGEAERRNTEESLPNGLP 1167
            A    ++DG     E+ S  H+    DEN    ++  E   Q G          +  G+P
Sbjct: 1123 AVINADDDGISAVSENQSFNHN----DENDDIDSNKMEIDSQGG---------FINPGIP 1169

Query: 1168 KLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDLNHAVQER 1227
             L   EL   + + VEL I  L D++ ++ A++++LEEYA R +E+  RK DLN AVQ R
Sbjct: 1170 VLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSR 1229

Query: 1228 DKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEGVLFS 1287
            D V+   E +K+KR DEFMEGF  I M LKEMYQMIT+GGNAELELVDSLDPFSEGV FS
Sbjct: 1230 DSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFS 1289

Query: 1288 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1347
            VMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI
Sbjct: 1290 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1349

Query: 1348 KERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLIDRS 1396
            KERTKNAQFIVISLRNNMFEL KQLVG+YK++NMTKS AL N DL+ R+
Sbjct: 1350 KERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLVGRA 1398

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score =  181 bits (460), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 200/763 (26%), Positives = 351/763 (46%), Gaps = 107/763 (14%)

Query: 660  GFHGRLGDLG-TIDDKYDVAISTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILL 717
            G  G + DL     +KY +A+ST   +  D ++VE +   Q+CI +L+K + G A FI L
Sbjct: 528  GVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPL 587

Query: 718  DKLRNFNLSPIKTPENVPRLYDLVRPN-NPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQ 776
            D +    L  +  P++   +  +   +  P++  A   V  D+++   L  A  + + K 
Sbjct: 588  DTIET-ELPTLSLPDSQDYILSINAIDYEPEYEKAMQYVCGDSIICNTLNIAKDLKWKKG 646

Query: 777  -RYRVVTLDGKLIDLSGTMSGGGNFKARGMM-KSEQQSNSAFTAEEVQQIDKELSEREHN 834
             R ++VT++G LI  +G M+GG +  A     K E QS  +   + + QID ELS  + +
Sbjct: 647  IRGKLVTIEGALIHKAGLMTGGISGDANNRWDKEEYQSLMSLKDKLLIQID-ELSNGQRS 705

Query: 835  FQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQK 894
              I A    E+E ++  L      +   ++++K  +D    E+K     +E  +Q K   
Sbjct: 706  NSIRA---REVENSVSLLNSDIANLRTQVTQQKRSLDENRLEIKYHNDLIEKEIQPK--- 759

Query: 895  ESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSV 954
                         +  LK +  +LEN   +  KE + LQ  I K   +K+          
Sbjct: 760  -------------ITELKKKLDDLENTKDNLVKEKEALQNNIFKEFTSKIGFT------- 799

Query: 955  NQRITIVXXXXXXXXXXXXXXQNDIKRYQKQAEQL----AEELKSCSQEKSLIENNLDSS 1010
                                    IK Y+  + +L    ++EL+   ++   +EN L   
Sbjct: 800  ------------------------IKEYENHSGELMRQQSKELQQLQKQILTVENKLQFE 835

Query: 1011 SKKVDELSESINKLKDELELTEERVRKAEESIDEKTVEGRDFE----ALEIQCVAQLDKL 1066
            +              D L  T+ R  KA++ ++   VE +  E    A+E++  +   KL
Sbjct: 836  T--------------DRLSTTQRRYEKAQKDLENAQVEMKSLEEQEYAIEMKIGSIESKL 881

Query: 1067 KELFAILNKEAAEFL---HSLNSLK--IRDVTATLQALDESLENESKNEVAAETPGEEDG 1121
            +E    L++   +F+     LNS +  + D+ + LQ L      + + +   E   + D 
Sbjct: 882  EEHKNHLDELQKKFVTKQSELNSSEDILEDMNSNLQVL------KRERDGIKEDIEKFDL 935

Query: 1122 EHSSSLHDPMDVDENQGESTSTTEAQLQAGEAERR-----NTEESLPNGLPKLLEDELEN 1176
            E  ++L +    + N   S+ TT   L     +       N+ +    GLPK  ++   +
Sbjct: 936  ERVTALKNCKISNINIPISSETTIDDLPISSTDNEAITISNSIDINYKGLPKKYKENNTD 995

Query: 1177 FEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDLNHAVQERDKVRQSNEN 1236
               + +E +IH++++ +     +   LE Y      ++    +      E  K+      
Sbjct: 996  SARKELEQKIHEVEEILNELQPNARALERYDEAEGRFEVINNETEQLKAEEKKILNQFLK 1055

Query: 1237 LKKKRLDEFMEGFNAICMILKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1287
            +KKKR + F + F+ +   L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1056 IKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1115

Query: 1288 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1347
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1116 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1175

Query: 1348 -KERTKNAQFIVISLRNNMFELAKQLVGVYKNK--NMTKSVAL 1387
             + R  + QFIVISL+N MFE +  LVGVY+ +  N +K + L
Sbjct: 1176 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIITL 1218

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  169 bits (427), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 236/893 (26%), Positives = 402/893 (45%), Gaps = 173/893 (19%)

Query: 568  LVNKGIDELRNKMNEQRGS-VFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHR 626
            +  K +D  + K+ E+ GS   +LE E  DI +       E    VKK+KE++    ++ 
Sbjct: 424  MYTKRLDSSKEKLAEELGSEKENLEIEVQDITKSFDKKSHETSRTVKKLKELQSRAESNN 483

Query: 627  QRSIDA----RSSLSTFENKNKV-------------LAALLRLQRSGRISGFHGRLGDLG 669
             R  +     + +L+  ++ N V             ++ L RL       G  G + DL 
Sbjct: 484  NREYEINYKLKETLTKLDDMNAVQRESAKEKKLRENVSMLRRL-----FPGVRGLVHDLC 538

Query: 670  -TIDDKYDVAISTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSP 727
                +K+ VA+ST   +  D ++V+     QQC+ +L+K + G   FI LD +    +  
Sbjct: 539  HPKKEKFAVAVSTVLGKNFDAVIVDNFLVAQQCVSFLKKQRSGVVSFIPLDTVDVSKVPM 598

Query: 728  IKTPENVPRLYDLVRPNNPKFRNAFY-----SVLRDTL-VAKDLKEANKVAYGKQRYRVV 781
            I +      L        P    A       S++ DTL +AKDLK  + +     R ++V
Sbjct: 599  IASEFKGCILAIDAIDYEPDLERAMQYVCSDSIICDTLQIAKDLKWKHNI-----RSKLV 653

Query: 782  TLDGKLIDLSGTMSGGGNFKARGMMKSEQQSNSAFTAEEVQQID-------KELSEREHN 834
            +++G ++  +G M+GG    ++G        N+ +  EE Q +        KELSE    
Sbjct: 654  SINGSIVHRAGLMTGGA---SKG-------GNNRWDKEEYQSLMSLKDVFLKELSE---- 699

Query: 835  FQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQK 894
              ++A ++ + E        R   +E D+S    D+ SL +++  S+     +L+EK  +
Sbjct: 700  --LSAASISDAE--------RIRILENDLSILNTDLMSLKTQLAQSK----RMLKEKETE 745

Query: 895  ESSNEELSTAEV--KLKSLKSEYRELENEMQSKKKEMKVLQEQIMK-----VGGTKLQ-- 945
                 +L+  E+  ++K+LK +      E+   +K+   LQ  +       VG T ++  
Sbjct: 746  IQYQIDLAEGEIEPRIKTLKDDLHRYNQEIADLEKQKAKLQNSVYADVFRDVGFTAVEYE 805

Query: 946  MQSSMVDSVNQRITIVXXXXXXXXXXXXXXQNDIKRYQKQAEQLAEELKSCSQEKSLIEN 1005
            M S ++                        Q  +    K+ E   E L +  + +   + 
Sbjct: 806  MHSGII-------------LKKQAEDLRKLQMQMVSIDKKLEFEVERLHATQERQQKAQV 852

Query: 1006 NLDSSSKKVDELS---ESINKLKDELELTEERVRKAEESIDEKTVEGRDFEALEIQCVAQ 1062
            +L+ +  K++ L+   ESIN LK E+E   ER+      IDE+                Q
Sbjct: 853  DLEKAKIKLEALNNDEESIN-LKIEME---ERI------IDEEQ--------------KQ 888

Query: 1063 LDKLKELFAILNKEAAEFLHSLNSL--KIRDVTATL-------QALDESLENESKNEVA- 1112
            LD L++       EA++ L  LN+L  +I+++   L       +AL E LE  +   +  
Sbjct: 889  LDSLQD-------EASQNLAGLNALDEQIQEINDDLSASKRKNEALSEDLETNTLERLNV 941

Query: 1113 ---AETPGEEDGEHSSSLHD-PMD-VDE---NQGESTSTTEAQLQAGEAERRNTEESLPN 1164
                +    +  E SSSL + P+D VDE   N     S   A L   +  R++ EE    
Sbjct: 942  LKNCKMQNIKLPEGSSSLDELPLDKVDEFTLNAANDVSINYAGL--SKKLRQSGEEETGA 999

Query: 1165 GLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDLNHAV 1224
            GL K + DEL         L I Q        Y D ++          Y++   +     
Sbjct: 1000 GLKKSI-DELNEL------LTILQPNSKAAGRYEDAKL---------RYESIYKETEKCK 1043

Query: 1225 QERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMIT---------MGGNAELELVD 1275
             +  KV +    +K+ R + F + F+ +   + E+Y+ +T          GGNA L L D
Sbjct: 1044 AKEKKVNEDFTRIKRLRKEAFEKAFDHVSSSIDEIYRELTRDPHSRAELAGGNASLTLED 1103

Query: 1276 SLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1335
              +P+  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAAL
Sbjct: 1104 EDEPYLAGIRYHATPPAKRFKDMEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAAL 1163

Query: 1336 DFRNVSIVANYIKERT-KNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVAL 1387
            D  NV  VA+YI+ +   + QFIVISL+N MFE ++ LVGV++ +    S AL
Sbjct: 1164 DISNVERVASYIRRKAGADLQFIVISLKNTMFEKSQALVGVFRQQQNNTSKAL 1216

 Score =  105 bits (261), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 102/193 (52%), Gaps = 33/193 (17%)

Query: 132 LVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELI 191
           L L+NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G ++  +R   L++LI
Sbjct: 7   LELNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRSHLLADLI 66

Query: 192 HK--------------SELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFR 237
           ++              SE HP  +S +V  F+    +E D    +++      + R   R
Sbjct: 67  YRGTLSEEEASSADFESENHP--NSAYVKAFYSPSNNEDD----VVE------LSRTVTR 114

Query: 238 NNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLL 297
           +  S Y ++GK   Y   +Q L  E I +  + FL+ QG+VE +A  KP+        L 
Sbjct: 115 SQESTYRIDGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQE-------LT 167

Query: 298 EYLEDIIGTAQYK 310
           +  E + G+ QYK
Sbjct: 168 DLFEQVSGSLQYK 180

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (REAL)
          Length = 1264

 Score =  139 bits (349), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 70/163 (42%), Positives = 107/163 (65%), Gaps = 12/163 (7%)

Query: 1237 LKKKRLDEFMEGFNAICMILKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1287
            +KKKR + F + F+ +   L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1095 IKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSTVELAGGNASLTIEDEDEPFNAGIKYH 1154

Query: 1288 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1347
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1155 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1214

Query: 1348 -KERTKNAQFIVISLRNNMFELAKQLVGVYKNK--NMTKSVAL 1387
             + R  + QFIVISL+N MFE +  LVGVY+ +  N +K+V L
Sbjct: 1215 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTVTL 1257

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  138 bits (347), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 104/161 (64%), Gaps = 10/161 (6%)

Query: 1237 LKKKRLDEFMEGFNAICMILKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1287
            +++ R D F   F+ +   + ++Y+ +T          GGNA L L D  +P+  G+ + 
Sbjct: 1059 IRRLRKDAFESAFDHVSNAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPYLAGIRYH 1118

Query: 1288 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1347
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1119 ATPPTKRFKDMEFLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDILNVERIATYI 1178

Query: 1348 KERT-KNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVAL 1387
            ++R   N QFIVISL+N MFE ++ LVGV++ +    S AL
Sbjct: 1179 RQRALSNLQFIVISLKNTMFEKSQALVGVFRQQRDNTSRAL 1219

 Score =  101 bits (251), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 79/283 (27%), Positives = 135/283 (47%), Gaps = 42/283 (14%)

Query: 134 LHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHK 193
           L+NFKSY G   +G   ++F++V+GPNGSGKSN++D++ FV G ++  +R   L++LI++
Sbjct: 9   LYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRSHTLADLIYR 68

Query: 194 ------------SELHPDLD---SCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRN 238
                       SE H + +   S +V  F+      P G     Q+     + R    +
Sbjct: 69  GTLQDGDADSGYSETHDNENNPSSAYVKAFYS-----PSG-----QENDVAELTRTITLS 118

Query: 239 NTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLE 298
             S Y LNG+  S+      L  E I +  + FL+ QG+VE +A  KP+        L  
Sbjct: 119 QESTYKLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPRE-------LTT 171

Query: 299 YLEDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKS-----SLEQGKNEALE 353
             E + G+ QYK   +    E+ K      E      I  R+++     S ++G N+  E
Sbjct: 172 LFEQVSGSIQYKQEYDRLREELEKARSATSEL-----IQSRKRANIGLKSFKEGVNKDEE 226

Query: 354 YLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSA 396
           Y +  +    L+ +L+ + L+  + K +S  E +  +Q +L +
Sbjct: 227 YRKHLEERNKLQQQLIVWQLFHLQAKRDSLTESLKSSQRELQS 269

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  137 bits (345), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 70/163 (42%), Positives = 105/163 (64%), Gaps = 12/163 (7%)

Query: 1237 LKKKRLDEFMEGFNAICMILKEMYQMITM---------GGNAELELVDSLDPFSEGVLFS 1287
            +KK+R + F + F  +   L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFEKAFEHVTNHLDSIYRELTRDPHSSAELSGGNASLTLEDEDEPFNAGIRYH 1113

Query: 1288 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1347
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD RNV  +A YI
Sbjct: 1114 ATPPLKRFKDMEYLSGGEKTMAALALLFAINSFQPSPFFVLDEVDAALDVRNVERIAAYI 1173

Query: 1348 KER-TKNAQFIVISLRNNMFELAKQLVGVYKNK--NMTKSVAL 1387
            +     N QFIVISL+N MFE +  LVGVY+ +  N +K V L
Sbjct: 1174 RRHGNPNLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1216

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score =  137 bits (345), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 68/163 (41%), Positives = 107/163 (65%), Gaps = 12/163 (7%)

Query: 1237 LKKKRLDEFMEGFNAICMILKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1287
            +K+KR + F + F+ +   L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1061 IKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1120

Query: 1288 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1347
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1121 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1180

Query: 1348 -KERTKNAQFIVISLRNNMFELAKQLVGVYKNK--NMTKSVAL 1387
             + R  + QFIVISL+N MFE +  LVGVY+ +  N +K++ L
Sbjct: 1181 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTITL 1223

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  137 bits (344), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 71/163 (43%), Positives = 104/163 (63%), Gaps = 12/163 (7%)

Query: 1237 LKKKRLDEFMEGFNAICMILKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1287
            +KKKR + F   F+ +   L  +Y+ +T          GGNA L L D  +PF+ GV + 
Sbjct: 1062 IKKKRKELFENAFDFVSEHLDNIYRELTRNPNSSADLAGGNASLTLEDEDEPFNAGVRYH 1121

Query: 1288 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1347
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1122 ATPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYI 1181

Query: 1348 KER-TKNAQFIVISLRNNMFELAKQLVGVYKNK--NMTKSVAL 1387
            +     N QFIVISL+N MFE +  LVGV++ +  N +K V L
Sbjct: 1182 RRHGNPNLQFIVISLKNTMFEKSDALVGVFRQQQENSSKIVTL 1224

 Score =  111 bits (277), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 85/292 (29%), Positives = 148/292 (50%), Gaps = 27/292 (9%)

Query: 132 LVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELI 191
           L L+NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R++ +R   + +LI
Sbjct: 7   LELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNIVKDLI 66

Query: 192 HKSEL--------HPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKY 243
           ++  +        H  + S +V  F++    +         ++P  ++R  +   +T+ Y
Sbjct: 67  YRGVINDNGDTNEHGKVTSAYVKAFYEKNTADDGDNDDDDDERPVELMRAISTNGDTT-Y 125

Query: 244 YLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDI 303
            +NGK  +Y   ++ L  E I +  K FL+ QG+VE IA   P         L +  E++
Sbjct: 126 KINGKTVTYKEYSEFLERENILIKAKNFLVFQGDVEQIASQSPM-------DLSKLFEEV 178

Query: 304 IGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEY---LEKEKT 360
            G+ QYK   +    +I KLN    E       +  E  + ++G  +  EY   +EK K 
Sbjct: 179 SGSIQYKKEYDELKEQIEKLNQSAAESIRNRRRIHGELKTYKEGITKDEEYKNNIEKRKK 238

Query: 361 LTILRSKLLQYHLWKNEQK-----LNSTKEKIAKAQEKLSAEKA--KRTKHS 405
             +       YHL +NE+K     L + K +I++ + K++ E+   +R+K S
Sbjct: 239 YYMYLVLWQLYHL-ENEKKKSLDNLKNAKSEISQLKNKITNEEKNLQRSKSS 289

 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 95/407 (23%), Positives = 177/407 (43%), Gaps = 63/407 (15%)

Query: 660  GFHGRLGDLGTID-DKYDVAISTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILL 717
            G  G + DL     DKY +A+ST   +  D I+V+ +   Q+CI + +K + G A FI L
Sbjct: 534  GVRGLVHDLCRPKKDKYGLAVSTILGKNFDSIIVDNLNVAQECIAFFKKQRSGTASFIPL 593

Query: 718  DKLRNFNLSPIKTPENVPRLYDLVRPNN-----PKFRNAFYSVLRDTLVAKDLKEANKVA 772
            D      +S  +   N+P   D +   N     P++  A   V  D+++   L  A  + 
Sbjct: 594  D-----TISSEQPTLNLPSSQDYILTINAIEYDPEYERAMQYVCSDSIICNSLDIARDLK 648

Query: 773  YGKQ-RYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQSNSAFTAEEVQQI----DK- 826
            + K  R ++VT++G LI  +G M+GG +          + SN+ +  EE Q +    DK 
Sbjct: 649  WNKGVRSKLVTIEGALIHKAGLMTGGIS----------KDSNNRWDKEEYQSLMTLKDKL 698

Query: 827  --ELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEGRL 884
              ++ E     ++++    ++E  L  L      + + +S+ +  +D   +E+      L
Sbjct: 699  LLQVEEISTKSRLSSTRARDVEIELSTLNAEISSLRMQLSQVQRSLDENKTEINHQNTLL 758

Query: 885  EYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENE----------------------- 921
            +   Q   + +S  E++   +     LKS   +L+NE                       
Sbjct: 759  DQ--QYNPKLKSLKEKVDEFDKSWNELKSNKEKLQNEIFKELTDKVGFTIEEYERHSGEL 816

Query: 922  MQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXXXXXQNDIKR 981
            ++ + KE++ LQ++I+ +   KLQ +   +++  +R+T                   +K 
Sbjct: 817  LRKQSKELQQLQKEILNIEN-KLQFEIERLENTQKRLT-------SAESNLEKAHETLKS 868

Query: 982  YQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDEL 1028
             QK   +LAE++K    E +   N LDS +K        IN++++ L
Sbjct: 869  LQKDENELAEQVKQIESEINSARNELDSVNKVFTAQQLDINRMEESL 915

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  136 bits (342), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 70/163 (42%), Positives = 105/163 (64%), Gaps = 12/163 (7%)

Query: 1237 LKKKRLDEFMEGFNAICMILKEMYQMITM---------GGNAELELVDSLDPFSEGVLFS 1287
            +KK+R + F   F+ +   L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFENAFDFVNEHLDPIYRELTRNPNSSALLSGGNASLTLEDEDEPFNAGIKYH 1113

Query: 1288 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1347
             MPP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1114 AMPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYI 1173

Query: 1348 KER-TKNAQFIVISLRNNMFELAKQLVGVYKNK--NMTKSVAL 1387
            +     + QFIVISL+N MFE +  LVGVY+ +  N +K V L
Sbjct: 1174 RRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1216

 Score = 97.8 bits (242), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 84/293 (28%), Positives = 139/293 (47%), Gaps = 43/293 (14%)

Query: 132 LVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELI 191
           L L NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R++ +R   L +LI
Sbjct: 7   LELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLI 66

Query: 192 HKS--------------ELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFR 237
           ++               E HP   S +V  F+     E DG          + + R    
Sbjct: 67  YRGVIRDFSEEDPEDGEEQHP--TSAYVKAFY-----EMDGKV--------VELMRTINI 111

Query: 238 NNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLL 297
           N  + Y ++ K  SY      L  E I +  K FL+ QG+VE IA        +S   L 
Sbjct: 112 NGDTTYKIDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIAS-------QSALDLS 164

Query: 298 EYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEY--- 354
           +  E+I G+ QYK   ++   E+ KL     E       +  E  + ++G ++  EY   
Sbjct: 165 KLFEEISGSIQYKKEYDSLKDELEKLGKSTTESIRNRRRIHGELKTYKEGISKDEEYKNN 224

Query: 355 LEKEKTLTILRSKLLQYHL----WKNEQKLNSTKEKIAKAQEKLSAEKAKRTK 403
           +EK+K   +  +    +HL     + + KL   K +++K +EK++ E+   T+
Sbjct: 225 VEKKKKYEMYFTLWKLFHLDAQRIQFKDKLKQAKTEMSKLKEKINNEEKHLTR 277

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
            complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  136 bits (342), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 113/172 (65%), Gaps = 14/172 (8%)

Query: 1236 NLKKKRLDEFMEGFNAICMILKEMYQMIT---------MGGNAELELVDSLDPFSEGVLF 1286
            N+KKKR + F + F  +   +  +Y+ +T          GGNA L L D  +P++ GV +
Sbjct: 1051 NIKKKRKELFEKAFEYVNEHIDPIYRELTKNPNSSVELAGGNASLTLEDEDEPYNGGVKY 1110

Query: 1287 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1346
               PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD  NV  +A Y
Sbjct: 1111 HATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDITNVERIATY 1170

Query: 1347 IKERTKNA--QFIVISLRNNMFELAKQLVGVYKNK--NMTKSVALQNTDLID 1394
            I +R  N   QFIVISL+N+MFE ++ LVG+Y+++  N ++ + L  T+ ++
Sbjct: 1171 I-QRHGNPELQFIVISLKNSMFEKSEALVGIYRHQKENSSRIITLNLTNYVN 1221

 Score =  100 bits (250), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 88/283 (31%), Positives = 138/283 (48%), Gaps = 37/283 (13%)

Query: 132 LVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELI 191
           L L+NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G +++ +R   L +LI
Sbjct: 7   LELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRSNVLKDLI 66

Query: 192 HKSELHPD----------LDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTS 241
           ++  L  D           +S +V  F+Q    + D T  ++         R    +  S
Sbjct: 67  YRGFLSGDDEDNNNEDVNPNSAYVKAFYQ----KEDVTHELM---------RSISNSGDS 113

Query: 242 KYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLE 301
            Y +N K  SY   T  L DE I +  K FL+ QG+VE IA        +S   L +  E
Sbjct: 114 TYKINNKTVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIAS-------QSTTDLTKLFE 166

Query: 302 DIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEY---LEKE 358
           ++ G+ QYK   E    ++ KL+    E       +  E    + G  +  +Y   LEK 
Sbjct: 167 EVSGSIQYKKEYEELKEKVEKLSQSTAESIKNRRRINNEIKVYKDGITKDEKYKAQLEKR 226

Query: 359 KTLTILRSKLLQYHL----WKNEQKLNSTKEKIAKAQEKLSAE 397
           + L +  S    YHL     +++ KL   K K++K +EKL+ E
Sbjct: 227 RNLLVYSSLWQLYHLDEKKSQSKNKLKEAKSKVSKLKEKLANE 269

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 99/400 (24%), Positives = 179/400 (44%), Gaps = 36/400 (9%)

Query: 660  GFHGRLGDLGTID-DKYDVAISTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILL 717
            G  G + DL     +KY +A+ST   +  D I+ + +   Q+CI YL+K + G A FI L
Sbjct: 524  GVRGLVSDLCQPKKEKYALAVSTILGKNFDSIITDNISVAQECIAYLKKQRAGVASFIPL 583

Query: 718  DKLRN-FNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTL------VAKDLKEANK 770
            + + +     P    +      + +    P++  A   V  D++      +AKDLK  + 
Sbjct: 584  ESIESEVPTLPFSDGQGCILTINAIEY-EPEYERAMQYVCSDSIICDTLTIAKDLKWKHN 642

Query: 771  VAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMM-KSEQQSNSAFTAEEVQQIDKELS 829
            V     + ++VTL+G LI  +G M+GG    A     K E QS +    + + QI+ ELS
Sbjct: 643  V-----KSKLVTLEGALIHKAGLMTGGILRDATNRWDKEEFQSLTVLKDKLLSQIE-ELS 696

Query: 830  EREHNFQIAA----DTLHEMEEALQKLKDREPEIELDISKRKLDI----DSLSSE----M 877
                +F I       T+  +   +  L+    ++   + + K++I    D +  E    +
Sbjct: 697  TSSKSFAIKGRDLESTISLLNTDITSLRSEFTQLNRALEENKVEIQYQTDMIDKEFGPKL 756

Query: 878  KASEGRLEYLLQEKAQKESSNEELSTAEVK-----LKSLKSEYRELENEMQSKK-KEMKV 931
             A   +++   +E +Q E+  E+L     K     L     EY E   E++ K+ KE++ 
Sbjct: 757  DALNDKIKVYDEEISQFENKKEDLQGEIFKEFTNRLGFTIKEYEEHSGEIRRKQAKELQQ 816

Query: 932  LQEQIMKVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXXXXXQNDIKRYQKQAEQLAE 991
            LQ QI+ +   KLQ +   + S  +R                  + +    Q Q E++  
Sbjct: 817  LQRQILNIEN-KLQFEQERLASTEKRFEKGQSELQKTKISLDSLETEESELQTQIEEIDN 875

Query: 992  ELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDELELT 1031
            EL++   E   ++  LDS  K +  + +S+N++ + LE++
Sbjct: 876  ELETQRTEIDEMQKALDSKLKDISFIEDSLNEVSNSLEIS 915

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score =  135 bits (340), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 68/163 (41%), Positives = 106/163 (65%), Gaps = 12/163 (7%)

Query: 1237 LKKKRLDEFMEGFNAICMILKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1287
            +K+KR + F + F+ +   L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1059 IKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1118

Query: 1288 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1347
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1119 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1178

Query: 1348 -KERTKNAQFIVISLRNNMFELAKQLVGVYKNK--NMTKSVAL 1387
             + R  + QFIVISL+N MFE +  LVGVY+ +  N +K + L
Sbjct: 1179 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIITL 1221

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  135 bits (340), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 65/163 (39%), Positives = 109/163 (66%), Gaps = 12/163 (7%)

Query: 1237 LKKKRLDEFMEGFNAICMILKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1287
            +KKKR + F + F+ +   ++ +Y+ +T          GGNA L L D  +PF  G+ + 
Sbjct: 1050 IKKKRREVFEKAFDYVSEHIEPIYRELTKNPNSTAELSGGNASLTLEDEDEPFDAGIKYH 1109

Query: 1288 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1347
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  N+  +ANYI
Sbjct: 1110 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFILDEVDAALDVTNIERIANYI 1169

Query: 1348 KERTK-NAQFIVISLRNNMFELAKQLVGVYKNK--NMTKSVAL 1387
            ++ +  + QFIVISL+N+MFE +  LVG+++ +  N ++ V L
Sbjct: 1170 RKHSNSDIQFIVISLKNSMFEKSDALVGIHRQQQENSSRVVTL 1212

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  135 bits (340), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 112/171 (65%), Gaps = 12/171 (7%)

Query: 1229 KVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMIT---------MGGNAELELVDSLDP 1279
            K+R+    +K+ R + F + +N +   + ++Y+ +T          GG+A L L D  +P
Sbjct: 1051 KIREQYLKVKQSRREMFEKAYNHVSDHIDQIYRELTKDPHSTAALAGGSASLTLEDEDEP 1110

Query: 1280 FSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1339
            +  G+ +   PP K ++++ +LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  N
Sbjct: 1111 YLAGIKYHATPPMKRFKDMEHLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDNTN 1170

Query: 1340 VSIVANYIKER-TKNAQFIVISLRNNMFELAKQLVGVYKNK--NMTKSVAL 1387
            V  +A YIK   + N QFIVISL+N+MFE ++ LVGV++ +  N +K + L
Sbjct: 1171 VEKIATYIKRHASPNFQFIVISLKNSMFEKSQALVGVFRQQQENTSKVITL 1221

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
            YFL008W
          Length = 1226

 Score =  133 bits (335), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 69/162 (42%), Positives = 105/162 (64%), Gaps = 12/162 (7%)

Query: 1238 KKKRLDEFMEGFNAICMILKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFSV 1288
            KKKR + F   F+ +   +  +Y+ +T          GG+A L L D  +PF+ G+ +  
Sbjct: 1058 KKKRKELFDRAFDYVSTHIDGIYRELTKDPNSTAELAGGSASLTLEDEDEPFNAGIKYHA 1117

Query: 1289 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI- 1347
             PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD +NV  +A YI 
Sbjct: 1118 TPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDIKNVERIAAYIR 1177

Query: 1348 KERTKNAQFIVISLRNNMFELAKQLVGVYKNK--NMTKSVAL 1387
            K    + QFIVISL+N+MFE +  LVGVY+ +  N ++ V L
Sbjct: 1178 KHGNPSLQFIVISLKNSMFEKSDALVGVYRRQQENSSRLVTL 1219

 Score = 60.5 bits (145), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 95/400 (23%), Positives = 176/400 (44%), Gaps = 40/400 (10%)

Query: 660  GFHGRLGDLG-TIDDKYDVAISTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILL 717
            G  G + DL     DKY V+++T   +  D ++V+++   Q+CI YL+K + G   FI L
Sbjct: 528  GVKGIVSDLCHPKKDKYSVSVATVLGKNFDSVIVDSLSVAQECIAYLKKQRAGVISFIPL 587

Query: 718  DKLRNFNLSPIKTPENVPRLYDLVRPN----NPKFRNAFYSVLRDTLVAKDLKEANKVAY 773
            D +     S + T  +V     L+  N      ++  A   V  D ++   L  A K+ +
Sbjct: 588  DTVD----SAVATLPSVNIQGYLLAKNAMEYESQYERAINYVCGDAIICDTLDLAKKLKW 643

Query: 774  GKQ-RYRVVTLDGKLIDLSGTMSGG----GNFKARGMMKSEQQSNSAFTAEEVQQIDKEL 828
                + +++ LDG LI  +G M+GG    GN +     K E QS      + +QQI+   
Sbjct: 644  DHGFKNKLIALDGSLIHRAGLMTGGISKDGNNR---WDKEEYQSLMTLKDKILQQIEDTA 700

Query: 829  S----------EREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMK 878
            +          E E N  +    +  +   L ++     E +++I+ +   +D   S M 
Sbjct: 701  AYGRSASIQARELESNISLLNAEIASIRTQLTQINRSIEENKVEINHQIHLVDKEYSPMI 760

Query: 879  AS-EGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEY--RELENE----MQSKKKEMKV 931
             S + + E +L++  +     + +     K  + K  +  R+ E+     M+   KE++ 
Sbjct: 761  LSLKKKKESILKQSNELTEEKDRVQVVIFKAFTDKVGFSVRDYESHSGEVMRQNAKELQQ 820

Query: 932  LQEQIMKVGGTKLQMQSSMVDSVNQRITIVXXXXXXXXXXXXXXQNDIKRYQKQAEQLAE 991
            LQ++I+ V   KLQ +   ++S   R+                 +   K+Y  Q + L E
Sbjct: 821  LQKEILTVEN-KLQFERERLESTRGRLLKAEEDIKKAQLELSLLEEQEKKYHTQIKPLEE 879

Query: 992  ELKSCSQEKSLIENNLDSSSKK--VDELSESINKLKDELE 1029
            ++  CS EK + E   +   KK  ++   ES+N+++  +E
Sbjct: 880  DI--CSFEKQIEEKETEIEGKKLEINNKEESLNEVQSSVE 917

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score =  132 bits (332), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 126/213 (59%), Gaps = 21/213 (9%)

Query: 1200 IEILEEYARRLIEYKARKVDLNHAVQE----RDKVRQSNEN---LKKKRLDEFMEGFNAI 1252
            +EIL+  ++ +  Y   K  L+    E    R+K R++ E    +K KR + F   F  +
Sbjct: 1029 LEILQPNSKAVQRYDETKHKLDQVSNENERLRNKERKAKEKFLEVKAKRKELFEACFKHV 1088

Query: 1253 CMILKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSG 1303
               + ++Y+ +T          GGNA L + +  +P+  G+ +   PP K ++++  LSG
Sbjct: 1089 DKHIDQIYRALTKNPHDKSELAGGNASLTVENEDEPYLGGIKYFATPPLKRFKDMEYLSG 1148

Query: 1304 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK-NAQFIVISLR 1362
            GEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  +A+YIK     NAQFIVISL+
Sbjct: 1149 GEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYIKRNANPNAQFIVISLK 1208

Query: 1363 NNMFELAKQLVGVYK----NKNMTKSVALQNTD 1391
            N MFE ++ LVG+++    N +   S+ L+N D
Sbjct: 1209 NAMFEKSQSLVGIFREQEDNSSRMVSLNLENYD 1241

 Score = 97.1 bits (240), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 98/198 (49%), Gaps = 26/198 (13%)

Query: 132 LVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELI 191
           L LHNFKSY  T  VG   + F++++GPNGSGKSN++D++ FV G R+N++R   L +LI
Sbjct: 7   LELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLI 66

Query: 192 HKSEL--------------HPDLDSCHVDIFFQYVQDEP-DGTTSIIQQKPSMVIRRKAF 236
           ++  +                D DS        Y ++EP     S + QK  +    K  
Sbjct: 67  YRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSCVYQKDDLDEPTKFT 126

Query: 237 RN-NTSK---YYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKES 292
           R  NTS    Y +N +  SY    + L  E I +  K FL+ QG+VE IA   P++    
Sbjct: 127 RTINTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIASQGPES---- 182

Query: 293 DDGLLEYLEDIIGTAQYK 310
              L   LE + G+  YK
Sbjct: 183 ---LTLLLEQVSGSINYK 197

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  132 bits (331), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 68/163 (41%), Positives = 102/163 (62%), Gaps = 12/163 (7%)

Query: 1237 LKKKRLDEFMEGFNAICMILKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1287
            +K+KR   F E F  +   +  +Y+ +T          GG+A L L D  +PF+ G+ + 
Sbjct: 1053 IKRKRKSLFEEAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTLEDEDEPFNAGIRYH 1112

Query: 1288 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1347
              PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  VA YI
Sbjct: 1113 ATPPLKRFKDMEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAALDTTNVERVATYI 1172

Query: 1348 KER-TKNAQFIVISLRNNMFELAKQLVGVYKNK--NMTKSVAL 1387
            +     + QFIVISL+N MFE +  LVGVY+ +  N +K V L
Sbjct: 1173 RRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQELNTSKIVTL 1215

 Score = 99.4 bits (246), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 59/192 (30%), Positives = 93/192 (48%), Gaps = 35/192 (18%)

Query: 132 LVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELI 191
           L LHNFKSY GT  VG   ++F++++GPNGSGKSN++D++ FV G R+  +R   L +LI
Sbjct: 7   LELHNFKSYKGTVKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSRHLRSNVLKDLI 66

Query: 192 HKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIR-------------RKAFRN 238
           ++                   ++E DG + ++    +  ++             R   + 
Sbjct: 67  YRGVAS---------------EEEGDGESDVVNNPTTAYVKAFYSKGDSTIELSRSISKG 111

Query: 239 NTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLE 298
             + Y +NGK   Y      L DE I +  K FL+ QG+V  IA        +S   L +
Sbjct: 112 GDTTYRMNGKVVDYKRYASFLEDENILIRAKNFLVFQGDVVQIAS-------QSAMELTQ 164

Query: 299 YLEDIIGTAQYK 310
           + E+  G+ QYK
Sbjct: 165 FFEEFSGSIQYK 176

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  131 bits (330), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 116/190 (61%), Gaps = 18/190 (9%)

Query: 1220 LNHAVQERDKVRQSNEN-------LKKKRLDEFMEGFNAICMILKEMYQMIT-------- 1264
             N    E DK+++S          +K+KR++ F+  FN +   +  +Y+ +T        
Sbjct: 1027 FNAVSGESDKLKESERKAKELYLKIKEKRINTFLACFNHVRDNIDRIYRELTRNPGSTAE 1086

Query: 1265 -MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPT 1323
              GG+A L L D  +P+  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+
Sbjct: 1087 LAGGSASLTLEDEDEPYLGGIRYHATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPS 1146

Query: 1324 PLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAKQLVGVYKNKNMT 1382
            P +++DE+DAALD  NV  +A YI+   +   QFIVISL++N+F  ++ + GV++N++  
Sbjct: 1147 PFFILDEVDAALDVTNVERIAAYIRRHASPKMQFIVISLKSNLFSKSESMAGVFRNQHEN 1206

Query: 1383 KSVALQNTDL 1392
             S+ +  TDL
Sbjct: 1207 SSMVI-TTDL 1215

 Score = 93.6 bits (231), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/184 (33%), Positives = 93/184 (50%), Gaps = 18/184 (9%)

Query: 132 LVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELI 191
           L + NFKSY G   VG    +F ++VGPNGSGKSN++D++ FV G R++ +R   L +LI
Sbjct: 7   LEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDLI 66

Query: 192 HKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFR---NNT--SKYYLN 246
           ++  +     +   +    YV      T   ++Q  S   RR  F    +NT  S Y L+
Sbjct: 67  YRGRMEEGGSAHENNPKSAYV------TAFYVKQDASGAERRMEFTRVIHNTGDSTYKLD 120

Query: 247 GKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGT 306
           GK   Y     +L  E I +  + FL+ QG+VE IA        +S   L +  E + G+
Sbjct: 121 GKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIAS-------QSGVDLTKLFEQVSGS 173

Query: 307 AQYK 310
            QY+
Sbjct: 174 VQYQ 177

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
            Anc_8.68 YFL008W
          Length = 1232

 Score =  130 bits (327), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/162 (42%), Positives = 104/162 (64%), Gaps = 10/162 (6%)

Query: 1236 NLKKKRLDEFMEGFNAICMILKEMYQMITM---------GGNAELELVDSLDPFSEGVLF 1286
            N+KKKR + F   F+ +   ++ +Y+ +T          GG A L L D  +PF+ GV +
Sbjct: 1062 NIKKKRKELFESCFDFVNEHIEPIYKELTKDPNSTTELGGGQATLTLEDEDEPFNGGVKY 1121

Query: 1287 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1346
               PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A Y
Sbjct: 1122 HATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDHTNVERIAAY 1181

Query: 1347 I-KERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVAL 1387
            I K   K+ QFI+ISL+N MFE +  LVGV++ +    S AL
Sbjct: 1182 IRKHGNKDLQFIIISLKNTMFEKSDALVGVFRQQTENSSKAL 1223

 Score =  102 bits (253), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 110/204 (53%), Gaps = 29/204 (14%)

Query: 131 RLV---LHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKL 187
           RLV   L NFKSY GT  +G   ++F++++GPNGSGKSN++D++ FV G R+N +R   +
Sbjct: 3   RLVGLELSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRSSGM 62

Query: 188 SELIHKS-----ELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSK 242
            +LIH+S       + D  S +V  F++ V D  + T           + R    +  + 
Sbjct: 63  KDLIHRSVRDSQSSNDDPTSAYVKAFYK-VTDASEITE----------LMRIVNLSGETI 111

Query: 243 YYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLED 302
           Y +NGK +S+   +  L  E I +  K FL+ QG+VE+IA        +S   L +  E 
Sbjct: 112 YKINGKTTSFKNYSDWLAKENILIKAKNFLVFQGDVETIAS-------QSSLELTKLFEQ 164

Query: 303 IIGTAQYKP---LIENTLSEIAKL 323
           + G+ QYK    L++  L++I +L
Sbjct: 165 VSGSIQYKKEYDLLKEDLNKINRL 188

 Score = 71.6 bits (174), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 106/429 (24%), Positives = 182/429 (42%), Gaps = 86/429 (20%)

Query: 547 LEETTISVFKESHAKIEQDII---LVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTV 603
           LEE    +  E +  I+Q +I   L+N   +++   +NE   ++ SL  +  D+   LT 
Sbjct: 397 LEEKLNLLINEKNEIIDQKLIVEKLINNSNEKI---LNEFNINIDSLNLKIEDLNSNLTE 453

Query: 604 GQSECDNAVKKIKEMKGILTAHRQRSIDA----RSSLSTFENKN----------KVLAAL 649
             S     +K +K ++ I+ +   +  D     R +L   +N N          K+   +
Sbjct: 454 KNSTVKAKIKSLKSLQSIIESSNNKEYDLNFKLRDTLLKLDNINATKRESNKEKKLRENV 513

Query: 650 LRLQRSGRISGFHGRLGDLG-TIDDKYDVAISTACPR-LDDIVVETVECGQQCIEYLRKN 707
           L L+R     G  G + DL     DKY +AI T   +  + ++V+++   Q+CI YL+K 
Sbjct: 514 LTLKRI--FPGVRGLVHDLCHPKKDKYALAILTILGKNFNSVIVDSLSVAQECISYLKKQ 571

Query: 708 KLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNPKFRN----------------- 750
           + G   FI LD +             +P L  +++ NNPK+ N                 
Sbjct: 572 RAGIISFIPLDTIE----------AQIPSLPTIIQ-NNPKYNNDSNCILTINAIEYEPEF 620

Query: 751 -------AFYSVLRDTL-VAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKA 802
                     S++ D L +AKDLK    V    +  + VTLDG +I  S  M+GG +   
Sbjct: 621 ERAMQYICSNSIICDNLDIAKDLKWNQNV----KNVKFVTLDGSIIHKSNLMTGGAS--- 673

Query: 803 RGMMKSEQQSNSAFTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIEL- 861
               K+  QSN+ +  +E       L   + N  +  +T+ + E  L  +  RE E E+ 
Sbjct: 674 ----KNSMQSNNRWDKDEYSS----LMTLKDNLILEIETISK-ENKLASINSRELETEIS 724

Query: 862 ----DISKRKLDIDSLSSEMKASEGRLEYL-----LQEKAQKESSNEELSTAEVKLKSLK 912
               +I+  K  +  L+  +K +   L Y      L    + +  N ++   + K+K ++
Sbjct: 725 LLNSEITNLKTQLTQLTRNLKDNNTELLYHQNLIKLDYDPKLKDLNHKIIDIDSKMKIIE 784

Query: 913 SEYRELENE 921
            E   LENE
Sbjct: 785 DERESLENE 793

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
            Ashbya gossypii AGL023W
          Length = 1222

 Score =  129 bits (325), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 105/166 (63%), Gaps = 11/166 (6%)

Query: 1237 LKKKRLDEFMEGFNAICMILKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1287
            +K+KR+  F+  F  +   +  +Y+ +T          GG+A L L D  +P+  G+ + 
Sbjct: 1051 IKEKRVKTFLSCFQHVTDHIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLAGIRYH 1110

Query: 1288 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1347
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YI
Sbjct: 1111 ATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYI 1170

Query: 1348 KER-TKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDL 1392
            K   +   QFIVISL++N+F  ++ + GV++N+    S+ +  TDL
Sbjct: 1171 KRHASPKFQFIVISLKSNLFGKSQSMAGVFRNQQANSSMVI-TTDL 1215

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 85/172 (49%), Gaps = 11/172 (6%)

Query: 646 LAALLRLQRSGRISGFHGRLGDLGTID-DKYDVAISTACPR-LDDIVVETVECGQQCIEY 703
           +A L RL       G  G + DL     DKY +A+S+   +  D IVV++V   QQCI Y
Sbjct: 515 VATLKRL-----FPGVKGLVHDLCRPKKDKYALAVSSMLGKNFDSIVVDSVSVAQQCISY 569

Query: 704 LRKNKLGYARFILLDKLR-NFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVA 762
           L+K++ G A FI LD +  N    P++  +      + +  ++ +   A   V  D+++ 
Sbjct: 570 LKKHRSGAASFIPLDTIDINTPTLPVRNLKGCILTVNAIEYDS-ELEKAMQYVCSDSIIC 628

Query: 763 KDLKEANKVAYGKQ-RYRVVTLDGKLIDLSGTMSGG-GNFKARGMMKSEQQS 812
             L  A  + + +  + ++VT+ G LI  +G M+GG G        K+E QS
Sbjct: 629 DTLDIAKNLKWDRGIKSKLVTIQGALIHRAGLMTGGVGRNNTNRWDKAEYQS 680

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1217

 Score =  126 bits (317), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 101/163 (61%), Gaps = 12/163 (7%)

Query: 1237 LKKKRLDEFMEGFNAICMILKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1287
            +KKKR   F   F      +  +Y+ +T          GG+A L L D  +PF+ G+ + 
Sbjct: 1048 IKKKRKALFERAFEYASEHIDPIYRELTKNPGSTNELAGGSASLTLEDEDEPFNAGIRYH 1107

Query: 1288 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1347
              PP K ++++  LSGGEKT+++LAL+F ++ ++P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1108 ATPPFKRFKDMEYLSGGEKTVAALALLFTINSFQPSPFFVLDEVDAALDSTNVDRIAAYI 1167

Query: 1348 -KERTKNAQFIVISLRNNMFELAKQLVGVYKNK--NMTKSVAL 1387
             +   ++ QFIVISL+N MFE +  LVGVY+ +  N +K V L
Sbjct: 1168 SRHGNRDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1210

 Score = 66.6 bits (161), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 86/334 (25%), Positives = 148/334 (44%), Gaps = 50/334 (14%)

Query: 660 GFHGRLGDLGTID-DKYDVAISTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILL 717
           G  G + DL     DKY +AIST   +  D ++V+ V   Q+CI YL+K + G A FI L
Sbjct: 520 GVRGLVCDLCQPKKDKYALAISTILGKNFDSVIVDNVMVAQECIAYLKKQRAGIASFIPL 579

Query: 718 D----KLRNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANKVAY 773
           D    ++    LS  +         D       ++  A   V  D+++  D+  A  + +
Sbjct: 580 DTIDVEIPTLTLSDSQGCTLAINAIDY----EQEYERALQYVCSDSIICDDMNIAKDLKW 635

Query: 774 GKQ-RYRVVTLDGKLIDLSGTMSGGGNFKARGMM-KSEQQSNSAFTAEEVQQIDKELSER 831
            K  R ++VTL+G LI  +G M+GG +        K E QS      + +QQ+++   E 
Sbjct: 636 NKGVRSKLVTLEGALIHKAGLMTGGISKNTSNRWDKEEYQSLMTLKDKLLQQVEEAALEG 695

Query: 832 EHNFQIAADTLHEMEEALQKLKDREPEI--ELDISKRKLDIDSLSSEMKASEGRLEYLLQ 889
           ++    A+    E+E  L  L     E+  +L +++R L  +++  +        E L++
Sbjct: 696 KN----ASLMARELESTLSLLNTEISELRTQLTLTQRTLKENTVERDYH------EKLIK 745

Query: 890 EKAQKESSN--EELSTAEVKLKSLKSEYRELENE-----------------------MQS 924
           E+ + E  N  E +      L+ L S+  +L+NE                       M+ 
Sbjct: 746 EEYEPELLNLEERIQNFNFALQELDSQKEKLQNEIFEEFTNRVGFTVKDYESHSGEIMRQ 805

Query: 925 KKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRI 958
           + KE++ LQ QI+ V   KLQ +   + +  +R 
Sbjct: 806 QSKELQQLQRQILNVEN-KLQFEKDRLSTTERRF 838

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  126 bits (317), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 65/163 (39%), Positives = 101/163 (61%), Gaps = 12/163 (7%)

Query: 1237 LKKKRLDEFMEGFNAICMILKEMYQMITM---------GGNAELELVDSLDPFSEGVLFS 1287
            +K+KR + F   F  I   L  +Y  +T          GG+A + + D  +PF+ G+ + 
Sbjct: 1054 VKQKRKELFENAFEKINEHLDAIYSELTRNVNSTSILGGGSASMTIEDEDEPFNAGIRYH 1113

Query: 1288 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1347
              PP K ++++  LSGGEKT+++LAL+FA++ Y P+P +++DE+DAALD  NV  +A YI
Sbjct: 1114 ATPPMKRFKDMEYLSGGEKTVAALALLFAINSYNPSPFFILDEVDAALDISNVQRIAAYI 1173

Query: 1348 KER-TKNAQFIVISLRNNMFELAKQLVGVYKNK--NMTKSVAL 1387
            +     + QFIVISL+N MFE +  LVGV++ +  N +K V L
Sbjct: 1174 RRHGNPDLQFIVISLKNTMFEKSDALVGVFRQQQENSSKIVTL 1216

 Score = 94.7 bits (234), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 82/285 (28%), Positives = 139/285 (48%), Gaps = 39/285 (13%)

Query: 132 LVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELI 191
           L L+NFKSY GT  V    ++F++++GPNGSGKSN++D++ FV G R++ +R   L +LI
Sbjct: 7   LELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLI 66

Query: 192 HK-------SELHPDLD-----SCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNN 239
           ++       +    D D     + +V  F++Y     DG          + + R   R  
Sbjct: 67  YRDIISRENTPTGADNDENGNRTAYVKAFYEY-----DGKV--------VELMRLISRLG 113

Query: 240 TSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEY 299
            + Y L+G   +Y   +Q L  + I +  K FL+ QG+VE IA   P        GL + 
Sbjct: 114 DTSYKLDGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPL-------GLTKL 166

Query: 300 LEDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKN---EALEYLE 356
           +E++ G+ QYK   E    +  K+     E   +   +  E  + ++G +   E  +Y++
Sbjct: 167 IEEVSGSMQYKKEYEELKDQYDKICQASTESIKKRRRIHAELKTYKEGMSRDEEYRKYVQ 226

Query: 357 KEKTLTILRSKLLQYHL----WKNEQKLNSTKEKIAKAQEKLSAE 397
           K+K +    S    YH+    ++  QKL  ++  +   +EKL AE
Sbjct: 227 KKKRVQTNLSLWQLYHMEDERYQCLQKLEESQNDVDVIREKLEAE 271

 Score = 70.1 bits (170), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 71/131 (54%), Gaps = 10/131 (7%)

Query: 673 DKYDVAISTACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTP 731
           DKY +A+ST   +  D ++V+++   Q+CI +L+K + G   FI LD +   + +  + P
Sbjct: 540 DKYKLAVSTVLGKNFDSVIVDSLSVAQECISFLKKQRAGVISFIPLDTI---DAATPRMP 596

Query: 732 ENVPRLYDLVRPNNPKFRN----AFYSVLRDTLVAKDLKEANKVAYGKQ-RYRVVTLDGK 786
                 Y L   N  ++++    A Y V  DT++  +L  A  + + K    ++VTLDG 
Sbjct: 597 VPESETYTLA-INTVEYKDDLVRAMYYVCSDTIICDNLDIARDLKWNKNANVKIVTLDGA 655

Query: 787 LIDLSGTMSGG 797
           LI+ +G M+GG
Sbjct: 656 LINKTGLMTGG 666

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score =  108 bits (269), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 146/298 (48%), Gaps = 20/298 (6%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           ++ L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 188 SELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSII--QQKPSMVIRRKAFRNNTSKYYL 245
            +LI+K      +    V I F    D  D + S I     P + + R+     TSKY +
Sbjct: 63  QDLIYKRG-QAGVTKASVTIVF----DNTDKSNSPIGFTNSPQISVTRQVVLGGTSKYLI 117

Query: 246 NGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIG 305
           NG  +    + QL +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 306 TAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILR 365
           T  ++   E     ++K     + +ENR  + E  +  LE+ +NE   +LE + T T L 
Sbjct: 171 TKMFEDRREKAERTMSKKE--TKLQENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDLE 228

Query: 366 SK---LLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKL 420
                ++ Y  +  + K  S +E +   + ++        K SEE+ ++  D++ +KL
Sbjct: 229 KTERIVVSYEYYNIKHKHTSIRETLENGETRMKMLNEFVKKTSEEIDSLNEDVEEIKL 286

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1295 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1353
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1354 AQFIVISLRNNMFELAKQL 1372
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFANANRV 1155

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score =  105 bits (263), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 82/298 (27%), Positives = 153/298 (51%), Gaps = 20/298 (6%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           I+ L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 188 SELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSII--QQKPSMVIRRKAFRNNTSKYYL 245
            +LI+K      +    V + F    D  D   S I     P + + R+     TSKY +
Sbjct: 63  QDLIYKRG-QAGVTKASVTVVF----DNSDRDNSPIGFTNSPKISVTRQVVLGGTSKYLI 117

Query: 246 NGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIG 305
           NG  +    + QL +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 306 TAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILR 365
           T  ++   E     +AK     + +ENR  + E  +  LE+ ++E   +L+ + T T L 
Sbjct: 171 TKMFEDRREKAERTMAKKE--TKLQENRALLAEEIEPKLEKLRSEKRIFLDFQTTQTDLE 228

Query: 366 --SKLLQ-YHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKL 420
             S+++  ++ +  + + +S ++ +  +++K +  K +  K SEE+ ++  DL+ LKL
Sbjct: 229 RTSRVVSAFNYYNMKHRQSSFEQTLQDSEDKCNHLKEEIEKVSEEIKSLNEDLEELKL 286

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1295 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1353
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1354 AQFIVISLRNNMFELAKQL 1372
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFNNANRV 1155

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 99/223 (44%), Gaps = 29/223 (13%)

Query: 663 GRLGDLGTIDDK-YDVAIS---TACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLD 718
           G    L T+D + +D AI+    A  RL +I+V+      Q +E  R  K      I L 
Sbjct: 525 GVAAQLFTVDQQQFDNAIALQVCAGGRLYNIIVDNEITASQLLERGRLKK--RVTIIPLS 582

Query: 719 KL--RNFNLSPIK-----TPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANKV 771
           K+  R  N + +       P  V    +L+  ++ +   A   +  + LV KD   A KV
Sbjct: 583 KIATRTLNKNTLALAKELAPGKVELALNLIGYDD-EVSKAMEFIFGNGLVCKDADTAKKV 641

Query: 772 AYGKQ-RYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQSNSAFTAEEVQQIDKELSE 830
            +    R R +T  G + D  GT+SGG     R ++   Q+ N A    +V +++ +L E
Sbjct: 642 TFHPNIRTRSITQQGDVYDPEGTLSGGSRNTTRSLLVDIQKYNHAVA--KVNELELKLIE 699

Query: 831 REHNFQIAADTLHEMEEALQKLKDREPEI-----ELDISKRKL 868
            +         L E EE  QK K  + E+     +L+I++R+L
Sbjct: 700 MQKK-------LKEQEETSQKTKSLQNELNLADHKLNIAQRRL 735

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score =  105 bits (261), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 150/295 (50%), Gaps = 16/295 (5%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           ++ L++  FKSYA   V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 188 SELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNG 247
            +LI+K      +    V I F     +P  +    +  P + + R+     TSKY +NG
Sbjct: 63  QDLIYKRG-QAGVIKASVTIVFD--NSDPSSSPFGFETYPKISVTRQIILGGTSKYLING 119

Query: 248 KESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTA 307
             +    +  L +   +++++  FLI+QG++  +  MKP       D +L  +E+  GT 
Sbjct: 120 HRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP-------DEILALIEEAAGTR 172

Query: 308 QYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILR-- 365
            ++   E     +AK     + +E R  ++E  +  L + +NE   +LE ++T T L   
Sbjct: 173 MFEDRREKAEKTMAKKE--TKLQEIRALLLEEIEPKLNRLRNEKRAFLEFQQTQTDLEKT 230

Query: 366 SKLLQYHLWKN-EQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLK 419
           S+++  + ++   QK +S +E++   Q+++   +    K+ +E++ +  D +S++
Sbjct: 231 SRIVNTYDYQTLVQKRSSMQERLQSDQKRIKDLEFSVEKYRDEISTLTEDFESIR 285

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1295 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1353
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1354 AQFIVISLRNNMF 1366
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score =  102 bits (255), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 143/297 (48%), Gaps = 22/297 (7%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           I+ L++  FKSYA   V+  +   F+A+ G NGSGKSNV+D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 188 SELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNG 247
            +LI+K      +    V I F  +  +P  +    +  P + + R+     TSKY +NG
Sbjct: 63  QDLIYKRG-QAGVTKASVTIVFSNL--DPKCSPIGFENSPKLSVTRQIILGGTSKYLING 119

Query: 248 KESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTA 307
             +    + QL +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 308 QY---KPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEA---LEYLEKEKTL 361
            +   K   E T+ +        + KENR  + E  +  LE+ +NE    LE+ E +  L
Sbjct: 173 MFEDRKGKAERTMGKKE-----LKLKENRTLLQEEIEPQLEKLRNEKRIFLEFQEIQTDL 227

Query: 362 TILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSL 418
             ++  +L Y       K +S KE +   + +++      +K  EE+  +  DL  +
Sbjct: 228 EKIQRIVLAYEYHSLVGKQSSIKETLDTGESRMAELHGLISKTGEEVMHLTEDLNRI 284

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1295 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1353
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1354 AQFIVISLRNNMFELAKQL 1372
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 132/311 (42%), Gaps = 62/311 (19%)

Query: 672 DDKYDVAIS---TACPRLDDIVVETVECGQQCIEY--LRKNKLGYARFILLDKL--RNFN 724
           ++ YD A++    A  RL +++V+      Q +E   LRK        I L+K+  R  N
Sbjct: 535 ENNYDSALALQVCAGGRLFNVIVDDQNTASQLLERGKLRKR----VTIIPLNKIATRVIN 590

Query: 725 LSPIK-----TPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQ-RY 778
              +K      P  V    +LV     +   A   +  ++LV  D + A ++ +  Q R 
Sbjct: 591 SESLKLAKQLAPGKVQLALNLV-GYEEEVSKAMEYIFGNSLVCNDAETAKRLTFHPQIRT 649

Query: 779 RVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQSNSAFTAEEVQQIDKELSEREHNFQIA 838
           R +T  G + D  GT+SGG       ++   Q+ NSA  A+ ++ ++ EL        + 
Sbjct: 650 RSITQQGDVYDPEGTLSGGSRNNKSTLLVDIQKYNSA--AKRMKVLEDEL-------LVI 700

Query: 839 ADTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSN 898
           ++ L E E A  K K  E + +L++   KL I                       + + N
Sbjct: 701 SNKLKEQESASAKTK--EIQNKLNLVSHKLSIF----------------------QRTLN 736

Query: 899 EELSTAEVKLK-SLKSEYRELENEMQSKKKEMKVLQEQIMKV----------GGTKLQMQ 947
           E  +T  +K    L  + RE E E++ K+  M  LQ++I K+           GTKL+  
Sbjct: 737 ENPATQIIKRNDDLTRQIRECEEEIEQKQSYMSQLQDEIRKIQDDMEEFNNDKGTKLEKL 796

Query: 948 SSMVDSVNQRI 958
              +DS+ + I
Sbjct: 797 KKEIDSLTKEI 807

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score =  102 bits (255), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 143/298 (47%), Gaps = 20/298 (6%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQGKL 187
           ++ L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +  + R   L
Sbjct: 3   VEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRASNL 62

Query: 188 SELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSII--QQKPSMVIRRKAFRNNTSKYYL 245
            +LI+K      +    V I F    D  D T S I       + + R+     TSKY +
Sbjct: 63  QDLIYKRG-QAGVTKASVTIVF----DNSDKTNSPIGFNNSSKISVTRQIILGGTSKYLI 117

Query: 246 NGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIG 305
           NG  +    + QL +   +++++  FLI+QG++  +  MKP       + +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP-------NEILSLIEEAAG 170

Query: 306 TAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILR 365
           T  ++   E     +AK     +E     E  E  +  LE+ +NE   +LE + T     
Sbjct: 171 TKMFENRREKAERTMAKKETKLQESRTLLE--EEIEPKLEKLRNEKRMFLEFQTTQADFE 228

Query: 366 SKLLQYHLWKNEQKLN---STKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKL 420
             +   H +  +  +N   S K+ +  ++ +++  K    + +EE+ ++  DL+ +K+
Sbjct: 229 KTMKVVHAFDYKNMINRHASVKDVLESSEARMAELKGLILRTAEEIGSLNEDLEQVKI 286

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1295 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1353
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1354 AQFIVISLRNNMFELAKQL 1372
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 97/443 (21%), Positives = 183/443 (41%), Gaps = 54/443 (12%)

Query: 663  GRLGDLGTID-DKYDVAIS---TACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLD 718
            G    L T++ D +D A +    A  RL ++VV+  +     +E  R  K      I L+
Sbjct: 525  GVAAQLFTLNKDHFDAASALQVCAGGRLYNVVVDNEKTASLLLEKGRLRK--RVTIIPLN 582

Query: 719  KL-------RNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANKV 771
            K+       R   ++    P  V    +L+  ++   R A   +   +LV +D   A KV
Sbjct: 583  KIAARTLNARTLQMAKDIAPGKVELALNLIGYDDEVSR-AMEFIFGGSLVCQDANTAKKV 641

Query: 772  AYGKQ-RYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQSNSAFTAEEVQQIDKELSE 830
             +  Q R R +TLDG + D  GT+SGG       ++ + Q  N +   + ++++  EL +
Sbjct: 642  TFHPQIRTRSITLDGDVYDPEGTLSGGSRNNTNNLLINIQTYNES--CQTLKKLRYELDD 699

Query: 831  REHNFQIAADTLHEMEEALQKLKDREPEI-----ELDISKRKLDIDSLSSEMKASEGRLE 885
                       L   E   QK K  +  +     +L +++R L+ +S +  ++       
Sbjct: 700  -------IVSLLRAQEATSQKTKLLQNNLNLAQHKLHLAQRALEDNSATQIIR------- 745

Query: 886  YLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIMKVGGTKLQ 945
                   + E  ++E+ T    + S +S  R+ E E++  KK+M    +      G KLQ
Sbjct: 746  -------RNEELHKEIETCHSDITSQQSTVRDYEMEIERIKKDMNEFDQN----KGAKLQ 794

Query: 946  MQSSMVDSVNQRIT-------IVXXXXXXXXXXXXXXQNDIKRYQKQAEQLAEELKSCSQ 998
                 +  + ++IT       +               ++DI   +   EQ+   L +  +
Sbjct: 795  ELKDGLQKMAEKITKQEQMADVKSELYQNIQLETEQLESDISANETAIEQVITALTTLEE 854

Query: 999  EKSLIENNLDSSSKKVDELSESINKLKDELELTEERVRKAEESIDEKTVEGRDFEALEIQ 1058
            E+   E  LD+ + ++  +   +N+ K  L   ++ +R+ E  I EK     ++E  + +
Sbjct: 855  ERQQTEKKLDNLNAEISTVQTKLNEEKRRLLDIDDELRELENLIKEKNENKANWELEQQR 914

Query: 1059 CVAQLDKLKELFAILNKEAAEFL 1081
               +LDK K     L K  ++ L
Sbjct: 915  LTHELDKNKSNTNSLQKRISDLL 937

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  101 bits (252), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 78/297 (26%), Positives = 143/297 (48%), Gaps = 20/297 (6%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           ++ L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 188 SELIHKSELHPDLDSCHVDIFFQYVQ--DEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYL 245
            +LI+K      +    V I F      + P G T+     P + + R+     TSKY +
Sbjct: 63  QDLIYKRG-QAGVTKASVTIVFNNTDKLNSPIGFTN----SPQISVTRQVVLGGTSKYLI 117

Query: 246 NGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIG 305
           NG  +    + QL +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 306 TAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILR 365
           T  ++   E     ++K     + +E+R  + E  +  LE+ +NE   +LE + T T L 
Sbjct: 171 TKMFEDRREKAERTMSKKE--TKLQESRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDLE 228

Query: 366 SK---LLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLK 419
                +  Y  +  + K  S +E +   +  +        K SEE+ ++  D++ +K
Sbjct: 229 KTERIVASYDYYNIKHKHTSIRETLENGEAHMKKLNDFIRKTSEEIESLNEDIREIK 285

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1295 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1353
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1354 AQFIVISLRNNMFELAKQL 1372
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 106/237 (44%), Gaps = 29/237 (12%)

Query: 662 HGRLGDLGTIDD---KYDVAIST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILL 717
           HG +G L  +D    +Y  A+ T A  RL ++VV+  +   Q +E  R  K      I L
Sbjct: 524 HGVVGQLFQLDYDNIRYSTALQTCAGGRLFNVVVQDSQTATQLLERGRLRK--RVTIIPL 581

Query: 718 DKL--RNFN-----LSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANK 770
           DK+  R  N     L+    P  V    +L++ +      A   +  ++L+ +D + A K
Sbjct: 582 DKIYARTINPQVLELAKTVAPGKVELAINLIKFDKT-VTKAMEFIFGNSLICEDPETAKK 640

Query: 771 VAYG-KQRYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQSNSAFTAEEVQQIDKELS 829
           + +  K R R +TL G + D  GT+SGG    +  ++   Q+ N         QI K++ 
Sbjct: 641 ITFHPKIRIRSITLQGDVYDPEGTLSGGSKNTSDSLLVDIQKYN---------QIQKKIG 691

Query: 830 EREHNFQIAADTLHEMEEALQKLKDREPEI-----ELDISKRKLDIDSLSSEMKASE 881
             + +     + L       QK K  + ++     +LD++KR L+++  S  M  +E
Sbjct: 692 TLQADLNHVTEELQRQYATSQKTKTVQNDLSVSVHKLDLAKRNLEVNPASQIMARNE 748

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  101 bits (251), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 82/301 (27%), Positives = 145/301 (48%), Gaps = 28/301 (9%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           ++ L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 188 SELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSII--QQKPSMVIRRKAFRNNTSKYYL 245
            +LI+K      +    V I F    D  D + S I     P + + R+     TSKY +
Sbjct: 63  QDLIYKRG-QAGVTKASVTIVF----DNTDKSNSPIGFANSPQISVTRQVVLGGTSKYLI 117

Query: 246 NGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIG 305
           NG  +    + QL +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 306 TAQY---KPLIENTLSEI-AKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTL 361
           T  +   K   E T+S+   KL      +ENR  + E  +  LE+ +NE   +LE + T 
Sbjct: 171 TKMFEDRKEKAERTMSKKETKL------QENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQ 224

Query: 362 TILRSK---LLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSL 418
           T L      ++ Y  +  + K  S +E +   +  +        K  +E+ ++  D++ +
Sbjct: 225 TDLEKTERIVVSYDYYNLKHKHTSIRETLENGEAHMKNLNEFIEKTIQEINSLNEDVEEI 284

Query: 419 K 419
           K
Sbjct: 285 K 285

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1295 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1353
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1354 AQFIVISLRNNMFELAKQL 1372
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 136/305 (44%), Gaps = 36/305 (11%)

Query: 655 SGRISGFHGRLGDLGTIDDKYDVAIST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYAR 713
           +  + G  GRL  L   + +Y  A+ T A  RL ++VV   +   Q +E  R  K     
Sbjct: 520 TSSVYGVVGRLFQLDNDNIRYSSALQTCAGGRLFNVVVRDSQTATQLLEGGRLRK--RVT 577

Query: 714 FILLDKLRNFNLSP-------IKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLK 766
            I LDK+    ++P          P  V    +L+R + P    A   +  ++L+  D +
Sbjct: 578 IIPLDKIYTRPITPQVLELAKSIAPGKVELAINLIRFDKP-VTKAMEFIFGNSLICDDPE 636

Query: 767 EANKVAY-GKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQSNSAFTAEEVQQID 825
            A K+ +  K R R +TL G + D  GT+SGG    ++ ++   Q+ N         QI 
Sbjct: 637 TAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSQSLLVDIQKYN---------QIQ 687

Query: 826 KELSEREHNFQIAADTLHEMEEALQKLKDREPEI-----ELDISKRKLDIDSLSSEMKAS 880
           +++   + +    A+ L +     QK K  + ++     +LD++KR L+++  S  M  +
Sbjct: 688 EKIGTIQADLNQVAEELRKQYATSQKTKTIQNDLNLSQHKLDLAKRNLEVNPSSQIMVRN 747

Query: 881 E------GRLEYLLQEKAQ-KESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQ 933
           E      G  E  ++ K    +   EE+ST E  +K   S+     NE+   KKE+K+  
Sbjct: 748 EEILRDIGDCENEIKNKQMILQRWQEEISTIEKDMKEYDSDKGSKLNEL---KKELKLFA 804

Query: 934 EQIMK 938
           + + K
Sbjct: 805 KDLEK 809

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1170

 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 149/297 (50%), Gaps = 20/297 (6%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           ++ L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   +
Sbjct: 3   VEELIIDGFKSYATRTVISGWDAQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNM 62

Query: 188 SELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIR--RKAFRNNTSKYYL 245
            +LI+K      +    V I F    D  D + S I    S+ I   R+     TSKY +
Sbjct: 63  QDLIYKRG-QAGVTKASVTIVF----DNSDKSNSPIGFNDSLKISVTRQIVLGGTSKYLI 117

Query: 246 NGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIG 305
           NG  +    + QL +   +++++  FLI+QG++  +  M+P         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMRPSE-------ILSLIEEAAG 170

Query: 306 TAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILR 365
           T  ++   E     ++K     E  ENR  + E  +  L + + E   +LE + T T L 
Sbjct: 171 TKMFEDRREKAERTMSKKETKLE--ENRTLLAEEIEPKLNKLRGEKRIFLEFQVTQTDLE 228

Query: 366 --SKLLQYHLWKN-EQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLK 419
             S+++    + N   + +S ++K++  + ++   K   +K ++E+ ++K DL+ +K
Sbjct: 229 KISRVVTAFDYHNMSTRRDSARDKVSSNERRMEELKTLISKTTDEIISLKEDLEQIK 285

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1295 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1353
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1354 AQFIVISLRNNMFELAKQL 1372
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFTNANRV 1155

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
           Ashbya gossypii AGR236W
          Length = 1170

 Score =  100 bits (248), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 78/297 (26%), Positives = 150/297 (50%), Gaps = 20/297 (6%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           ++ L++  FKSYA   V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 188 SELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSII--QQKPSMVIRRKAFRNNTSKYYL 245
            +LI+K      +    V I F    D  D  +S I  ++ P + + R+     TSKY +
Sbjct: 63  QDLIYKRG-QAGVIKASVTIVF----DNSDIKSSPIGFERYPKISVTRQIALGGTSKYLI 117

Query: 246 NGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIG 305
           NG  +    +  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMKPTE-------ILSLIEEAAG 170

Query: 306 TAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILR 365
           T  ++   E     +AK     + +E R  + E  +  L++ ++E   +LE ++T T L 
Sbjct: 171 TRMFEDRREKAEKTMAKKE--TKLQEIRALLQEEIEPKLDKFRSEKRAFLEFQETQTDLE 228

Query: 366 S--KLLQYHLWKN-EQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLK 419
              +++  H + N   K NS +E +  +++++   ++   K+  E++++  D  ++K
Sbjct: 229 MTLRIVNTHDYHNLVTKQNSIQETVQNSEQRVQELESSIKKYQNELSSLNEDFTAIK 285

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1295 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1353
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1354 AQFIVISLRNNMFELAKQL 1372
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFNNANRV 1155

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 79/328 (24%), Positives = 141/328 (42%), Gaps = 55/328 (16%)

Query: 658 ISGFHGRLGDLGTIDDKYDVAIS---TACPRLDDIVVETVECGQQCIE--YLRKNKLGYA 712
           + G   ++  LG   D +D A +    A  RL +I+V+  +   Q +E   LRK      
Sbjct: 523 VKGVAAQVFTLG--KDNFDSANALQVCAGGRLFNIIVDNEKTASQLLEKGMLRKR----V 576

Query: 713 RFILLDKL-------RNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDL 765
             I L+K+        +  L+    P  V    +L+         A   +   +L+  D 
Sbjct: 577 TIIPLNKISTRVLSDESLALAKKIAPGKVELALNLI-GYEEDVSKAMQYIFGGSLICADA 635

Query: 766 KEANKVAYGKQ-RYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQSNSA--------- 815
           + A K+ +  Q R R +TLDG + D  GT+SGG +     ++K  Q+ N A         
Sbjct: 636 ETAKKITFHPQIRARSITLDGDIYDPEGTLSGGSSNNTNSLLKDIQKYNEASRRSKSFES 695

Query: 816 ---------FTAEEVQQIDK----ELSEREHNFQIAADTLHEMEEALQKLKDREPEIELD 862
                       E   Q+ K    EL   EH FQ++   L     A    K+ E   E++
Sbjct: 696 ELSLIQQQIMECERASQLTKSLQNELDLAEHKFQLSQKALVSNPAAQIIKKNDEMLNEIE 755

Query: 863 ISKRKLDIDSLSS-EMKASEGRLEYLLQEKAQKESS-----NEELST--AEVKLKSLKSE 914
             K  +D+  +S+ E++A   R++  +QE    + S     N+E+ST   ++K K + +E
Sbjct: 756 TCKTDIDLQKISTAELQAEVVRIQKDMQEFNTDKGSKLKQLNKEVSTLAKQIKDKEVVTE 815

Query: 915 -----YRELENEMQSKKKEMKVLQEQIM 937
                Y+ L+ E +  + ++  ++++I+
Sbjct: 816 QKYDLYQNLQMETEQLQTDISAMKQEIV 843

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 99.8 bits (247), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 81/302 (26%), Positives = 143/302 (47%), Gaps = 28/302 (9%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRAN-KMRQGKL 187
           ++ L++  FKSYA   V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRASNL 62

Query: 188 SELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSII--QQKPSMVIRRKAFRNNTSKYYL 245
            +LI+K      +    V I F    D  D ++S I  +  P + + R+     TSKY +
Sbjct: 63  QDLIYKRG-QAGVTKASVTIVF----DNTDKSSSPIGFESYPKISVTRQIILGGTSKYLI 117

Query: 246 NGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIG 305
           NG  +    +  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 306 TAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLE-------KE 358
           T  ++   E     +AK     +E     E  E  +  LE+ +N+   +LE        E
Sbjct: 171 TRMFEDRREKAEKTMAKKETKLQEIRTLLE--EEIEPKLEKLRNQKRAFLEFQETQTDLE 228

Query: 359 KTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSL 418
           KTL IL +    Y  +    K ++ KE +  +  ++        K   E++ +  DL+++
Sbjct: 229 KTLRILNA----YEYYDMATKNSTIKETLQNSTARVEELNNFIQKTKNEISNLDEDLKTI 284

Query: 419 KL 420
           K+
Sbjct: 285 KI 286

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1295 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1353
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1354 AQFIVISLRNNMFELAKQL 1372
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFTNANRV 1155

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 88/202 (43%), Gaps = 20/202 (9%)

Query: 682 ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKL--RNFNLSPIK-----TPENV 734
           A  RL ++VV+      Q +E  R  K      I L+K+  R  N + +K      P NV
Sbjct: 548 AGGRLFNVVVDNEVTASQLLERGRLRK--RVTIIPLNKIASRTLNENALKLAKSVAPGNV 605

Query: 735 PRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQ-RYRVVTLDGKLIDLSGT 793
               +L+   +   R A   +   +L+ KD + A +V +  Q R R +TLDG + D  GT
Sbjct: 606 ELALNLIGYEDEVSR-AMEFIFGTSLICKDAETAKRVTFHPQIRARSITLDGDIYDPEGT 664

Query: 794 MSGGGNFKARGMMKSEQQSNSAFTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLK 853
           +SGG       ++   Q  N+A          K L+E E   +     + E E+  QK K
Sbjct: 665 LSGGSRNTKNSLLIDIQTFNAA---------SKRLNEMELELKQINSKIAEYEQTSQKTK 715

Query: 854 DREPEIELDISKRKLDIDSLSS 875
             + E+ L   K  L   SL++
Sbjct: 716 SLQNELNLATHKLSLAKKSLAA 737

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
           YFR031C
          Length = 1171

 Score = 99.4 bits (246), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 117/235 (49%), Gaps = 17/235 (7%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           ++ L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGITSMTTVRASNL 62

Query: 188 SELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSII--QQKPSMVIRRKAFRNNTSKYYL 245
            +LI+K      +    V I F    D  D T S I       + + R+     TSKY +
Sbjct: 63  QDLIYKRG-QAGITKASVTIVF----DNTDKTNSPIGFNNSAKISVTRQVVLGGTSKYLI 117

Query: 246 NGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIG 305
           NG  +    + QL +   +++++  FLI+QG++  +  MKPK        +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAG 170

Query: 306 TAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKT 360
           T  ++   E     +AK     + +ENR  + E  +  LE+ +NE   +LE + T
Sbjct: 171 TKMFEDRREKAERTMAKKE--TKLQENRTLLQEEIEPKLEKLRNEKRIFLEFQVT 223

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1295 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1353
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1354 AQFIVISLRNNMFELAKQL 1372
            +QFIV+SL+  MF  A ++
Sbjct: 1138 SQFIVVSLKEGMFSNANRV 1156

 Score = 33.9 bits (76), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 46/82 (56%), Gaps = 3/82 (3%)

Query: 750 NAFYSVLRDTLVAKDLKEANKVAYGKQ-RYRVVTLDGKLIDLSGTMSGGGNFKARGMMKS 808
           NA   +   +L+ +D   A KV +  Q R R +TL+G + D  GT+SGG    +  ++  
Sbjct: 621 NAMEFIFGGSLICQDADTAKKVTFHPQIRTRSITLEGDVYDPEGTLSGGSRNNSSSLLLD 680

Query: 809 EQQSNSAFTAEEVQQIDKELSE 830
            Q+ N +  ++++Q  +KEL+E
Sbjct: 681 IQRYNES--SQKLQSTEKELNE 700

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
           (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score = 95.9 bits (237), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 145/298 (48%), Gaps = 20/298 (6%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           ++ L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 188 SELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSII--QQKPSMVIRRKAFRNNTSKYYL 245
            +LI+K      +    V I F    D  D + + I  +  P++ + R+     TSKY +
Sbjct: 63  QDLIYKRG-QAGVTKASVTIVF----DNSDKSNAPIGFESSPTISVTRQVALGGTSKYLI 117

Query: 246 NGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIG 305
           NG  +    +  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 306 TAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEA---LEYLEKEKTLT 362
           T  ++   E     + K     + +ENR  + E  +  LE+ ++E    LE+ E +K L 
Sbjct: 171 TKMFEDRREKAERTMGKKE--AKLQENRTLLNEEIEPKLEKLRSEKRIFLEFQETQKDLE 228

Query: 363 ILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKL 420
                +  +      QK  S  E +  ++ ++   K   TK ++E+ ++  DL+ +++
Sbjct: 229 ETHRVVSAFDYNYLVQKQTSVVETLQTSENRIIELKELITKVTDELGSLNEDLEQIQV 286

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1295 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1353
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1354 AQFIVISLRNNMF 1366
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score = 94.4 bits (233), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 91/182 (50%), Gaps = 11/182 (6%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           ++ L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 188 SELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNG 247
            +LI+K      +    V I F    D+   +    +  P + + R+     TSKY +NG
Sbjct: 63  QDLIYKRG-QAGVTKASVTIVF--TNDDKANSPIGFESYPKISVTRQIVLGGTSKYLING 119

Query: 248 KESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTA 307
             +    +  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 308 QY 309
            +
Sbjct: 173 MF 174

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1295 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1353
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1354 AQFIVISLRNNMFELAKQL 1372
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFTNANRV 1155

 Score = 36.2 bits (82), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 76/313 (24%), Positives = 141/313 (45%), Gaps = 39/313 (12%)

Query: 659 SGFHGRLGDLGTIDDK-YDVAIS---TACPRLDDIVVETVECGQQCIEYLRKNKLGYARF 714
           S   G    L ++D+K Y  A +    A  RL ++VV+      Q +E  R  K      
Sbjct: 521 SSVKGVAAQLFSLDEKNYSSATALQVCAGGRLFNVVVDNEGTASQLLERGRLRK--RVTI 578

Query: 715 ILLDKL--RNFNLSPIKT-----PENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKE 767
           I L+K+  R+ + + +K      P NV    +L+     +   A   +   +L+ +D + 
Sbjct: 579 IPLNKISARSLHQNAVKAAKELAPGNVELALNLI-GYEEEVSKAMEFIFGTSLICQDAET 637

Query: 768 ANKVAYG-KQRYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQSNSAFTAEEVQQIDK 826
           A KV +  + R R +TL G + D  GT+SGG    +   +   Q+ NS         I K
Sbjct: 638 AKKVTFHPRVRARSITLQGDIYDPEGTLSGGSRNNSSSFLIDIQKFNS---------ISK 688

Query: 827 ELSEREHNFQIAADTLHEMEEALQ-KLKDREPEIELDISKRKLDIDSLSSEMKASEGRLE 885
           ++ + E+     AD +  +++  +  +K +  + EL+++  KL + + S E   S   L 
Sbjct: 689 KVIDLENKL---ADVIGRIKQYSEISVKTKSVQNELNLATHKLHLANRSLENNPSAQLL- 744

Query: 886 YLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIMKVGGTKLQ 945
                 A+ +   EE+      +K+ + + R LE E+   +K++    E+  K  G+KL 
Sbjct: 745 ------ARNKEIQEEIENCTESMKNGREDVRRLEGEVSRIEKDI----EEFSKDKGSKLD 794

Query: 946 MQSSMVDSVNQRI 958
              + V S++++I
Sbjct: 795 ELKNEVTSISKQI 807

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 143/297 (48%), Gaps = 20/297 (6%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           ++ L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQNL 62

Query: 188 SELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSII--QQKPSMVIRRKAFRNNTSKYYL 245
            +LI+K      +    V I F    +  D + S I  +    + I R+      SKY +
Sbjct: 63  QDLIYKRG-QAGVTKASVTIVF----NNSDTSNSPIGFESHAKISITRQIILGGVSKYLI 117

Query: 246 NGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIG 305
           NG  +    + QL +   +++++  FLI+QG++  +  MKP+        +L  +E+  G
Sbjct: 118 NGHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQE-------ILSLIEEAAG 170

Query: 306 TAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILR 365
           T  ++   E     +AK     +E   R  + E  +  LE+ +NE   YLE ++T + L 
Sbjct: 171 TRMFEDRREKAERTMAKKETKLQEI--RTLLTEEIEPKLERFRNEKRTYLEFQETQSDLE 228

Query: 366 SKLLQYHLWKNEQKLNSTK---EKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLK 419
           + +   + ++  Q  N  K   E +   Q +L   +   ++   E+  + +DL +LK
Sbjct: 229 NVMRVVNAFEFSQLSNKKKHIEESLHSGQSRLEELEDTISRLKNEVENLGSDLDALK 285

 Score = 68.9 bits (167), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 88/148 (59%), Gaps = 1/148 (0%)

Query: 1225 QERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEGV 1284
            +++ K++++ E L + + +  ++ +  + +    ++  +     A+LE  +  D  +EG+
Sbjct: 1009 KDKQKIQETIEKLNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFAKLEPSEGKD-VTEGL 1067

Query: 1285 LFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1344
               V   K    ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + 
Sbjct: 1068 EVKVKLGKIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIG 1127

Query: 1345 NYIKERTKNAQFIVISLRNNMFELAKQL 1372
            + IK R K +QFIV+SL+  MF  A ++
Sbjct: 1128 HLIKTRFKGSQFIVVSLKEGMFTNANRV 1155

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 92/184 (50%), Gaps = 15/184 (8%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           ++ L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 188 SELIHKSELHPDLDSCHVDIFFQYV--QDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYL 245
            +LI+K      +    V I F      + P G  S     P + + R+     TSKY +
Sbjct: 63  QDLIYKRG-QAGVTKASVTIVFANSDKNNSPIGFESY----PKISVTRQIVLGGTSKYLI 117

Query: 246 NGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIG 305
           NG  +    +  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 306 TAQY 309
           T  +
Sbjct: 171 TKMF 174

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1295 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1353
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1354 AQFIVISLRNNMFELAKQL 1372
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFTNANRV 1155

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 91.7 bits (226), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 92/184 (50%), Gaps = 15/184 (8%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           ++ L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMTTVRASNL 62

Query: 188 SELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSII--QQKPSMVIRRKAFRNNTSKYYL 245
            +LI+K      +    V I F    D  D + S I     P + + R+     TSKY +
Sbjct: 63  QDLIYKRG-QAGVTKASVTIVF----DNTDKSNSPIGFNTSPRISVTRQIVIGGTSKYLI 117

Query: 246 NGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIG 305
           NG  +    + QL +   +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKSTE-------ILSLIEEAAG 170

Query: 306 TAQY 309
           T  +
Sbjct: 171 TKMF 174

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1295 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1353
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1081 WKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1140

Query: 1354 AQFIVISLRNNMFELAKQL 1372
            AQFIV+SL+  MF  A ++
Sbjct: 1141 AQFIVVSLKEGMFTNANRV 1159

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 68/107 (63%), Gaps = 3/107 (2%)

Query: 1276 SLDPFSEGVLFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1333
            S++    GV  SV     K   +++  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDA
Sbjct: 1096 SVEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLFDEIDA 1155

Query: 1334 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGV-YKNK 1379
            ALD +  + VA+ IKE ++NAQFI  + R++M E+A +   V Y+NK
Sbjct: 1156 ALDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKFYRVKYENK 1202

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 79/183 (43%), Gaps = 9/183 (4%)

Query: 127 LCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+V+  FK+Y    ++  F    + V+G NGSGKSN   ++ FV       +++ +
Sbjct: 1   MYIRRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSNDYANLKREE 60

Query: 187 LSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLN 246
              LIH+      + S  V+I F          + I  ++   V  R+        Y LN
Sbjct: 61  RQGLIHQG--SGSVMSASVEIVFHDPSHRIILPSGIPPRENDEVFVRRTVGLKKDDYQLN 118

Query: 247 GKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGT 306
            +  + + + ++L   G  + +   ++ QG + ++   K       D   L  LE+++G 
Sbjct: 119 DRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIVALTNAK-------DRERLHLLEEVVGA 171

Query: 307 AQY 309
             +
Sbjct: 172 KSF 174

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 64/104 (61%), Gaps = 3/104 (2%)

Query: 1279 PFSEGVLFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1336
            P   GV  SV    K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD
Sbjct: 1099 PMYTGVSISVSFNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158

Query: 1337 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGV-YKNK 1379
             +  + VAN +KE +KNAQFI  + R +M ++A +   V Y+NK
Sbjct: 1159 KQYRTAVANTLKELSKNAQFICTTFRTDMLQVADKFFRVKYENK 1202

 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 124/260 (47%), Gaps = 27/260 (10%)

Query: 127 LCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+++  FK+Y    ++  F    + ++G NGSGKSN+  ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 187 LSELIHK-SELHPDLDSCHVDIFFQYVQDEPD------GTTSIIQQKPSMVIRRKAFRNN 239
              LIH+ +     + SC V+I F     +PD         SI+ +  + V  R+     
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVFH----DPDNRMILASNASIVPRPNNEVFIRRTVGLK 116

Query: 240 TSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEY 299
              Y +N +  + + I ++L   G  + +   ++ QG++ ++   K K         L+ 
Sbjct: 117 KDDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKIIALTNAKDKER-------LQL 169

Query: 300 LEDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEA-LEYLEKE 358
           LED++G   ++  + ++L +I       +E E +   +++E S L+   NE   E LE E
Sbjct: 170 LEDVVGAKSFEIKLNDSLKKI-------KETEFKKSTIDKELSELKNKLNEMEWEKLELE 222

Query: 359 KTLTILRS-KLLQYHLWKNE 377
           K     ++ K+LQ+ L+  E
Sbjct: 223 KFNKFDKNRKVLQFTLYDRE 242

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 63/140 (45%), Gaps = 8/140 (5%)

Query: 663 GRLGDLGTIDDKYDVAIST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLR 721
           G +G+L    +KY   +      +L  I+V+T E     ++ L + K G   FI L+K+ 
Sbjct: 543 GTVGELIKASEKYKNCVEIIGGNQLFHIIVDTEETASLLMQELYRMKGGRVTFIPLNKI- 601

Query: 722 NFNLSPIKTP--ENVPRLYDLVRP--NNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQR 777
            +N   I  P  +       L++      KF  A   +   T+V KDL    K+A  K +
Sbjct: 602 -YNDPNITYPPADQYSSFTPLIKKLKYESKFEGAMKHIFGKTIVVKDLSYGLKLA-KKFK 659

Query: 778 YRVVTLDGKLIDLSGTMSGG 797
              +TLDG   D  G ++GG
Sbjct: 660 LNAITLDGDRADKRGVLTGG 679

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
            YFR031C
          Length = 1170

 Score = 82.4 bits (202), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 58/86 (67%)

Query: 1281 SEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1340
            +EG+ F V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEFKVRLGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHT 1123

Query: 1341 SIVANYIKERTKNAQFIVISLRNNMF 1366
              + + IK R K +QFIV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

 Score = 52.4 bits (124), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 130/289 (44%), Gaps = 30/289 (10%)

Query: 658 ISGFHGRLGDLGTIDDKYDVAIS---TACPRLDDIVVETVECGQQCIEYLRKNKLGYARF 714
           + G   +L  L   +D YD A +    A  RL ++VV+      Q +E  R  K      
Sbjct: 523 VKGVAAQLFTLA--EDNYDSATALQVCAGGRLYNVVVDNERTASQLLEKGRLRK--RVTI 578

Query: 715 ILLDKL-------RNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKE 767
           I L+++       +   L+    P  V    +LV       R A   +  ++L+ KD + 
Sbjct: 579 IPLNRIAARALNSQTLQLAQKTAPGKVELALNLVGYEEEVSR-AMEFIFGNSLICKDAET 637

Query: 768 ANKVAYGKQ-RYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQSNSAFTAEEVQQIDK 826
           A K+ +  Q R R +TL G + D  GT+SGG       ++   Q+ N   TA+ +++++ 
Sbjct: 638 AKKITFHPQIRTRSITLQGDVYDPEGTLSGGSRNNTSSLLIDVQKYNK--TAKRIEELEL 695

Query: 827 ELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEGRL-E 885
           +L        I  D L E E  LQK +    ++ L   K  L   SL S   A   R  E
Sbjct: 696 KLK------SITRD-LEEQESKLQKTRSVRNDLNLATHKLTLAQRSLESNQAAHIIRKNE 748

Query: 886 YLLQE--KAQKE--SSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMK 930
            L++E  ++QKE  S    +S  E +++ ++++ +E   +  SK K++K
Sbjct: 749 ELIKEIDESQKEIASKRSSISDCEKEIQRIQTDIQEFSTDKGSKLKQLK 797

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
            YFR031C (REAL)
          Length = 1170

 Score = 82.0 bits (201), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1295 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1353
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1354 AQFIVISLRNNMF 1366
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 53.1 bits (126), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 131/292 (44%), Gaps = 41/292 (14%)

Query: 662 HGRLGDLGTIDD---KYDVAIST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILL 717
           +G +G L  +DD   +Y  A+ T A  RL ++VV+  +   Q +E  R  K      I L
Sbjct: 524 YGVVGQLFELDDDKIRYSTALQTCAGGRLFNVVVQDSQTATQLLERGRLRK--RVTIIPL 581

Query: 718 DKLRNFNLSPIK-------TPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANK 770
           +K+    +SP          P  V    +L++ +      A   +  ++L+ +D + A K
Sbjct: 582 NKISTRPISPQVLELAKKIAPGKVELAINLIKFDKS-VTKAMEFIFGNSLICEDPETAKK 640

Query: 771 VAYG-KQRYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQSNSAFTAEEVQQID---- 825
           + +  K R R +TL G + D  GT+SGG    +  ++   Q+ N      E+ Q D    
Sbjct: 641 ITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSDSLLVDIQKYNQIQRKIEIIQADLNHV 700

Query: 826 -KELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEGRL 884
            +EL ++    Q      +++  +L KL         D++KR L+++  S  M     R 
Sbjct: 701 TEELQKQYTTSQKTKTIQNDLNASLHKL---------DLAKRNLEVNPSSQIM----ARN 747

Query: 885 EYLLQEKAQKESSNE------ELSTAEVKLKSLKSEYRELENEMQSKKKEMK 930
           E +L+E    E  NE      +L     ++ S++ + +E +N+  SK  E+K
Sbjct: 748 EEILREIG--ECENEIKIRQMDLERCRQEVSSIEKDMKEYDNDKGSKLNELK 797

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
            YJL074C (SMC3) - SMC chromosomal ATPase family member
            [contig 224] FULL
          Length = 1247

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 64/109 (58%), Gaps = 3/109 (2%)

Query: 1274 VDSLDPFSEGVLFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1331
             D+LD    GV  SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEI
Sbjct: 1114 ADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEI 1173

Query: 1332 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGV-YKNK 1379
            DAALD +  + VAN IKE + +AQFI  + R +M ++A     V ++NK
Sbjct: 1174 DAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFYRVKFENK 1222

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 114/252 (45%), Gaps = 19/252 (7%)

Query: 104 MKKSRLESQKFQESRAMMGS--IQRLCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNG 161
           MK  R+ S + Q SRA   +  I  + I  +++  FK+Y     V  F   F+ V+G NG
Sbjct: 1   MKPRRVNSIRNQ-SRASFRAREIVEMYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNG 59

Query: 162 SGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTS 221
           SGKSN   ++ FV     + +++ +   LIH+      + S +V+I F    D+   T+ 
Sbjct: 60  SGKSNFFAAVRFVLSDDYSSLKREERQGLIHQG--TGSIMSAYVEIVFHDPSDQMMMTSG 117

Query: 222 IIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESI 281
           I   +  +V  R+       +Y +NGK    + I+++    G    +   ++ QG + ++
Sbjct: 118 IPVTEEHIVRVRRTIGLKKDEYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAV 177

Query: 282 AQMKPKAEKESDDGLLEYLEDIIGTAQYK-------PLIENTLSEIAKLNDICEEKENRF 334
              K K         L  LED++G   ++         +E T  + AK+     E + R 
Sbjct: 178 TNAKDKER-------LLLLEDVVGARSFEIKLRESSKKMEATNRDRAKITSELSELKARL 230

Query: 335 EIVEREKSSLEQ 346
           E ++ E+  LE+
Sbjct: 231 EELDEERQELEK 242

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1229

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (66%), Gaps = 1/84 (1%)

Query: 1297 NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1356
            ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAALD +  + VAN IKE + NAQF
Sbjct: 1119 HVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAALDKQYRTSVANTIKELSANAQF 1178

Query: 1357 IVISLRNNMFELAKQLVGV-YKNK 1379
            I  + R++M  +A     V Y+NK
Sbjct: 1179 ICTTFRSDMLRVADVFYRVKYENK 1202

 Score = 72.0 bits (175), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 91/201 (45%), Gaps = 16/201 (7%)

Query: 127 LCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+ +  FK+Y  T ++  F    + V+G NGSGKSN   ++ FV     N +++ +
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 187 LSELIHKSELHPDLDSCHVDIFFQYVQDEPDG---TTSIIQQKPSMVIRRKAFRNNTSKY 243
              LIH+      + S +V+I F    D  DG     +     P  V+ R+       +Y
Sbjct: 61  RQGLIHQG--SGSVMSAYVEIVF----DNSDGRLLNAAASPSSPDEVVIRRTIGLKKDEY 114

Query: 244 YLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDI 303
            LN K  S   I  LL   G    +  +++ QG + ++   K       D   L+ L+++
Sbjct: 115 SLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRIVALTNAK-------DYERLQLLKEV 167

Query: 304 IGTAQYKPLIENTLSEIAKLN 324
            G   ++  + ++L+++   N
Sbjct: 168 TGANSFEKKLRDSLNKMDATN 188

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar to
            uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
            chromosome segregation protein
          Length = 1170

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1295 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1353
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1354 AQFIVISLRNNMFELAKQL 1372
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFTNANRV 1155

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 94/415 (22%), Positives = 181/415 (43%), Gaps = 64/415 (15%)

Query: 658  ISGFHGRLGDLGTIDDKYDVAIS-TACPRLDDIVVETVECGQQCIEYLRKNKLGYARFIL 716
            + G    L  +   + KY + +   A  RL +++V+  + G   ++  R  K      I 
Sbjct: 523  VKGVTAELFSIPEQNMKYVIGLQICAGGRLYNVIVDNEKTGSALLQKGRLRK--RVTIIP 580

Query: 717  LDKL--RNFNLSPIK-----TPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEAN 769
            LDK+  R  N + +K      P  V    +L+  ++   + A   +  ++L+  D + A 
Sbjct: 581  LDKVISRPLNQNKLKLAKQLAPGKVELALNLIGYSDEVVK-AMEFIFGNSLICDDAETAK 639

Query: 770  KVAYGKQ-RYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQSNS-----AFTAEEVQQ 823
            K+ +    R R +TL+G + D  GT+SGG       ++   QQ N+         EE Q 
Sbjct: 640  KITFNPGIRTRSITLEGDIYDPEGTLSGGTRNNTNTLLVDIQQYNTLKKELLAMNEEKQN 699

Query: 824  IDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDI--DSLSSE----M 877
            I K+L   E      ++        LQK        EL + K +LDI   +++SE    M
Sbjct: 700  IHKQLKILEAKSNETSN--------LQK--------ELSLKKHRLDILERTMNSEPSLMM 743

Query: 878  KASEGRLEYLLQEKAQKESSNEEL---STAEVKLKSLKSEYRELENEMQSKKKEMKV--- 931
            +   G +E   + K  ++S+ +++   S+ E +++ L+ +  +      +K KE+K    
Sbjct: 744  QNRNGEIEN--EVKTLEDSTKQKMLENSSLEAEIEKLRKDMVDFSKNKGAKLKELKAEVH 801

Query: 932  -LQEQIMKVGGTKLQMQSSMVDSVNQRITI----VXXXXXXXXXXXXXXQNDIKRYQKQA 986
             L EQI       L+ +S  ++   ++I +    +                DI++  ++ 
Sbjct: 802  ELNEQI-----KDLESESEKLNDTYEKIKVETEQIANEIDTDTKSLDSTVQDIEKKLEEE 856

Query: 987  EQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDELELTEERVRKAEES 1041
             ++ + LK+  +E   ++N+L+   K+       I+ + DELE  E  +++ EES
Sbjct: 857  IKINKMLKTSEEELMSVQNDLNVERKR-------ISNIDDELEELERTIKQKEES 904

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 58/81 (71%), Gaps = 1/81 (1%)

Query: 1293 KSWR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1351
            K W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1352 KNAQFIVISLRNNMFELAKQL 1372
            K +QFIV+SL+  MF  A ++
Sbjct: 1135 KGSQFIVVSLKEGMFNNANRV 1155

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 131/293 (44%), Gaps = 29/293 (9%)

Query: 663 GRLGDLGTIDDK-YDVAIS---TACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLD 718
           G    L TID + YD A +    A  RL ++VV+      + +E  R  K      I L+
Sbjct: 525 GVAARLFTIDKQNYDSATALQVCAGGRLYNVVVDNETTASKLLEKGRLRK--RVTIIPLN 582

Query: 719 KL-------RNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANKV 771
           K+          N +    P  V    +L+   + +   A   +   +L+  D + A K+
Sbjct: 583 KISARTIDNNTLNYAKQLAPGKVELALNLIGYED-EVAKALQFIFGSSLICNDAETAKKI 641

Query: 772 AYG-KQRYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQSNSAF-----TAEEVQQID 825
            +  K R R +TLDG + D  GT+SGG       ++   Q+ N +         E++ I 
Sbjct: 642 TFNPKIRTRSITLDGDVYDPEGTLSGGSRTNTSSILVDIQKYNESTEKINNYQNELKSIR 701

Query: 826 KELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEGRLE 885
           K+LSE+E  ++       E++  L  L  +     L+ISKR    +  S  +K ++   E
Sbjct: 702 KKLSEQEDIYK----QTKELQNQLSLLNHK-----LEISKRNFGSNPASQVLKRNKDIQE 752

Query: 886 YLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIMK 938
            +L  + + E+S E  +  E +++S+  +  E  N+  SK KE+K   E++ K
Sbjct: 753 EILICEKENETSYENSNALEKEIQSITKDLNEFNNDKGSKLKELKAEVEKLSK 805

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1224

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 2/121 (1%)

Query: 1275 DSLDPFSEGVLFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1332
            DS++    GV  SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1092 DSIETMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1151

Query: 1333 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDL 1392
            AALD +  + VAN IKE + +AQFI  + R++M ++A     V  +  +++  A+   D 
Sbjct: 1152 AALDKQYRTSVANVIKELSVHAQFICTTFRSDMLQVADSFYRVRFDNKISEISAVSQQDA 1211

Query: 1393 I 1393
            I
Sbjct: 1212 I 1212

 Score = 63.2 bits (152), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 84/187 (44%), Gaps = 17/187 (9%)

Query: 127 LCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I  +V+  FK+Y  T  V      F+ ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 187 LSELIHKSELHPDLDSCHVDIFFQYVQDEPDG----TTSIIQQKPSMVIRRKAFRNNTSK 242
              LIH+      + S +V+I F     +P G    T+ I   +  +V  R+       +
Sbjct: 61  RQGLIHQGT--GSVMSAYVEIIFH----DPSGQMMITSGIPMTEEHIVRVRRTIGLKKDE 114

Query: 243 YYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLED 302
           Y +NGK    + I+++    G    +   ++ QG + ++   K       D   L  LE+
Sbjct: 115 YSVNGKTCHKSDISRMFESVGFSAVNPYNIVPQGRIVAVTNAK-------DRERLALLEE 167

Query: 303 IIGTAQY 309
           ++G   +
Sbjct: 168 VVGAKSF 174

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
            complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 80.5 bits (197), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 93/186 (50%), Gaps = 19/186 (10%)

Query: 1213 YKARKVDLNHAVQERDKVRQSNENL----KKKRLDEFMEGFNAICMILKEMYQMITMGGN 1268
            +  +K++LN    E D  + S +NL    K++++      F  +      +++ +   G 
Sbjct: 1001 FNEKKIELNERAAELDDSKVSIQNLIEKLKQQKVTAVDSTFKKVSENFSTVFEKLVPRGT 1060

Query: 1269 AELEL------------VDSLDPFSEGVLFSVM--PPKKSWRNITNLSGGEKTLSSLALV 1314
            A+L +             +S +    G+  SV     K    ++  LSGG+KT+ ++AL+
Sbjct: 1061 AKLIIHRQEENKTRSKDKNSTESIYSGISISVSFNSKKNEQLHVEQLSGGQKTVCAIALI 1120

Query: 1315 FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVG 1374
             A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQFI  + R +M ++A +   
Sbjct: 1121 LAIQMVDPAPFYLFDEIDAALDKQYRAAVADVIKSLSGNAQFICTTFRTDMLQVADKFFR 1180

Query: 1375 V-YKNK 1379
            V Y+NK
Sbjct: 1181 VKYENK 1186

 Score = 67.0 bits (162), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 70/310 (22%), Positives = 137/310 (44%), Gaps = 37/310 (11%)

Query: 127 LCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+V+  FK+Y    V+  F  +++ V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIHRIVIKGFKTYRNETVIDFFSPNYNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 187 LSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLN 246
              LIH+      + S  V+I F+         + ++ ++   +  R+        Y +N
Sbjct: 61  RQGLIHQG--SGSVMSASVEIVFRDPGHRMILPSGVVPRENDEIFIRRTVGLKKDDYQVN 118

Query: 247 GKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGT 306
            +  + + + ++L   G  + +   ++ QG + ++   K K         L+ LED++G 
Sbjct: 119 DRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIIAVTNAKDKER-------LQLLEDVVGA 171

Query: 307 AQYKPLIENTLSEI-------AKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEK 359
             ++  +  +L ++        K+++   E   +   +E E+  LE  K  ALE      
Sbjct: 172 KSFESKLRASLKKMDETEQKRKKISEEMSELNKKLGDMEEERKELE--KFNALEG----- 224

Query: 360 TLTILRSKLLQYHLWKNE--------QKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAM 411
                + K+LQ+ L+  E        + L+S    I  + E+   +  KR    EEM  +
Sbjct: 225 -----KRKVLQFTLYDREINDIINQIEGLDSEYNNILASSEEYLQQLNKRETVVEEMTTI 279

Query: 412 KADLQ-SLKL 420
             D+  SLKL
Sbjct: 280 LQDIDASLKL 289

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 79.7 bits (195), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 67/111 (60%), Gaps = 3/111 (2%)

Query: 1272 ELVDSLDPFSEGVLFSVMPPKKSWR--NITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1329
            E++++ +    GV  SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1330 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGV-YKNK 1379
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++A +   V Y+NK
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRVKYENK 1202

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 84/186 (45%), Gaps = 13/186 (6%)

Query: 127 LCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+V+  FK+Y    V+  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 187 LSELIHKSELHPDLDSCHVDIFFQYVQDE---PDGTTSIIQQKPSMVIRRKAFRNNTSKY 243
              LIH+      + S  V+I F   + +   P G   + ++    +  R+        Y
Sbjct: 61  RQGLIHQGS-GGSVMSASVEIVFHDPEHKMILPSGV--VPRENNDEICIRRTVGLKKDDY 117

Query: 244 YLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDI 303
            LN +  +   + ++L   G  + +   ++ QG++ S+   K K         L+ LED+
Sbjct: 118 QLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER-------LQLLEDV 170

Query: 304 IGTAQY 309
           +G   +
Sbjct: 171 VGAKSF 176

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 79.7 bits (195), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 65/106 (61%), Gaps = 3/106 (2%)

Query: 1277 LDPFSEGVLFSV-MPPKKSWR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1334
            L+    GV  SV    KK+ +  +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1095 LESVYTGVSISVSFSSKKNEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1154

Query: 1335 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGV-YKNK 1379
            LD +  + VAN IK+ +KNAQFI  + R +M  +A +   V Y+NK
Sbjct: 1155 LDKQYRTSVANAIKKLSKNAQFICTTFRTDMLAVADRFYRVKYENK 1200

 Score = 61.6 bits (148), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 87/195 (44%), Gaps = 17/195 (8%)

Query: 127 LCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+V+  FK+Y    ++  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 187 LSELIHKSELHPDLDSCHVDIFFQYVQDEPDG----TTSIIQQKPSMVIRRKAFRNNTSK 242
              LIH+      + S  V+I F     +PD     ++ +I +    V  R+        
Sbjct: 61  RQGLIHQG--SGSVMSASVEIVFH----DPDHRIILSSGVIPRPNDEVFVRRTVGLKKDD 114

Query: 243 YYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLED 302
           Y +N +  + + + ++L   G  +     ++ QG + ++   K K         L  LED
Sbjct: 115 YQINDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRIIALTNAKDKER-------LLLLED 167

Query: 303 IIGTAQYKPLIENTL 317
           +IG   ++  +  +L
Sbjct: 168 VIGAKSFETKLRASL 182

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1223

 Score = 79.0 bits (193), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 60/100 (60%), Gaps = 3/100 (3%)

Query: 1283 GVLFSVMPPKKSWR--NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1340
            GV  SV    K  R  ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  
Sbjct: 1099 GVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLFDEIDAALDKQYR 1158

Query: 1341 SIVANYIKERTKNAQFIVISLRNNMFELAKQLVGV-YKNK 1379
            + VA  IK  + NAQFI  + R +M ++A +   V Y+NK
Sbjct: 1159 TAVAGIIKALSANAQFICTTFRTDMLQVADKFFRVKYENK 1198

 Score = 62.4 bits (150), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 84/187 (44%), Gaps = 17/187 (9%)

Query: 127 LCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+++  FK+Y    V+  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIRRVIIKGFKTYRNETVIDDFSPHHNIVIGSNGSGKSNFFAAIRFVLSGDYSNLKREE 60

Query: 187 LSELIHKSELHPDLDSCHVDIFFQYVQDEPDG----TTSIIQQKPSMVIRRKAFRNNTSK 242
              LIH+      + S  V+I F     +PD      + +  +    V+ R+        
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFH----DPDHRIILPSGVAPRSNDEVLVRRTVGLKKDD 114

Query: 243 YYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLED 302
           Y LN +  +   + ++L   G  +++   ++ QG + ++   K K         L+ LED
Sbjct: 115 YQLNDRNVTKGDVVRMLESAGFSMNNPYNIVPQGRIIALTNAKDKER-------LQLLED 167

Query: 303 IIGTAQY 309
           ++G   +
Sbjct: 168 VVGAKSF 174

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1229

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 62/106 (58%), Gaps = 3/106 (2%)

Query: 1277 LDPFSEGVLFSVMPPKKSWR--NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1334
            ++P   GV  SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1335 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGV-YKNK 1379
            LD +  + VA  I++ + NAQFI  + R +M E+A     V Y+NK
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVADTFFRVKYENK 1204

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 144/311 (46%), Gaps = 26/311 (8%)

Query: 663 GRLGDLGTIDDKYDVAIST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLR 721
           G LG+L +++ KY           L  ++V+T E   + ++ L + K G   FI L+K+ 
Sbjct: 538 GTLGELVSVNSKYKTCAEVIGGNSLFHVIVDTEETASKIMKELYRMKGGRVTFIPLNKVY 597

Query: 722 NFNLSPIKTPENVPRLYDLVRP--NNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYR 779
            F+ S    PE+      L++    + KF  A   V   T+V KDL    K+A  K +  
Sbjct: 598 -FDNSITFPPEDQSSYTPLIKKIKYDEKFDKAVKHVFGKTIVVKDLSTGLKLA-KKYKLS 655

Query: 780 VVTLDGKLIDLSGTMSGGGNFKARGM-------MKSEQQSNSAFTAEEVQQIDKELSERE 832
            +TLDG   D  G ++GG + + +         + S +  + A TA E+ QI ++L E +
Sbjct: 656 AITLDGDRADKRGVLTGGYHDQHKKTRLDSLKSLNSSRTKHKAVTA-ELDQITQQLEEMD 714

Query: 833 HNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEGRLEYLLQEKA 892
                    +  +  +++KL   +  I  +I   ++ +++  SE    E  L+       
Sbjct: 715 SG-------IDALNGSMRKLVSNKDSIVSNIQSMRIKLNAKKSEKLLLEESLDAF---AV 764

Query: 893 QKESSNEELSTAEVKLKSLKSEY-RELENEM-QSKKKEMKVLQEQIMKVGGTKLQMQSSM 950
           + E    +L+  + K+ + K +  +E ++E+ QS+K E+  L + I  +   KL + +  
Sbjct: 765 KSERLTAQLTQTKEKITAYKEDMTKEFDSELSQSEKTELLTLNDDIHTI-QKKLTLTTEA 823

Query: 951 VDSVNQRITIV 961
           ++S+   + I+
Sbjct: 824 LESITGEMDIL 834

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] {ON}
            YJL074C (REAL)
          Length = 1229

 Score = 77.0 bits (188), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 55/84 (65%), Gaps = 1/84 (1%)

Query: 1297 NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1356
            ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE +KNAQF
Sbjct: 1121 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLIKELSKNAQF 1180

Query: 1357 IVISLRNNMFELAKQLVGV-YKNK 1379
            I  + R +M ++A +   V Y+NK
Sbjct: 1181 ICTTFRTDMLQVADKFFRVKYENK 1204

 Score = 66.6 bits (161), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 58/261 (22%), Positives = 120/261 (45%), Gaps = 33/261 (12%)

Query: 127 LCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+++  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 187 LSELIHKSELHPDLDSCHVDIFFQYVQDEPDGT----TSIIQQKPSMVIRRKAFRNNTSK 242
              LIH+      + S  V+I F     +PD +    + ++ +    V  R+        
Sbjct: 61  RQGLIHQGS-GGSVMSASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 243 YYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLED 302
           Y LN +  +   I ++L   G  +++   ++ QG++ ++   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 303 IIGTAQYKPLIENTLSEIAKLNDICEEKENRFEI------VEREKSSLEQGKNEALEYLE 356
           ++G   ++  ++      A L  + E ++ +F+I      +  + + +EQ + E  +Y E
Sbjct: 169 VVGAKSFEVKLK------ASLKKMEETEQKKFQINKEMDELNSKLTEMEQERKELEKYNE 222

Query: 357 KEKTLTILRSKLLQYHLWKNE 377
            E+     + K+ QY L+  E
Sbjct: 223 LER-----KRKIYQYTLYDRE 238

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 76.6 bits (187), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 81/149 (54%), Gaps = 5/149 (3%)

Query: 1235 ENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKS 1294
            +NLK+++++     FN +     ++++ +   G  EL +      +S GV   V    K+
Sbjct: 953  DNLKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSKN 1011

Query: 1295 --WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1352
                 I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  ++
Sbjct: 1012 DEQLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLSQ 1071

Query: 1353 NA-QFIVISLRNNMFELAKQLVGV-YKNK 1379
            N  QFI+ + R++M E+A  +  V Y NK
Sbjct: 1072 NGTQFILTTFRSDMIEIADMIYMVKYHNK 1100

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1216

 Score = 76.3 bits (186), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 55/84 (65%), Gaps = 1/84 (1%)

Query: 1297 NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1356
            ++  LSGG+KT+ ++A++ A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQF
Sbjct: 1108 HVEQLSGGQKTVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYRTAVADVIKSLSSNAQF 1167

Query: 1357 IVISLRNNMFELAKQLVGV-YKNK 1379
            I  + R +M ++A +   V Y+NK
Sbjct: 1168 ICTTFRTDMLQVADKFFRVKYENK 1191

 Score = 59.7 bits (143), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 89/204 (43%), Gaps = 29/204 (14%)

Query: 127 LCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I ++++  FK+Y    ++  F   ++ ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 187 LSELIHKSELHPDLDSCHVDIFF----------QYVQDEPDGTTSIIQQKPSMVIRRKAF 236
              LIH+      + S  V+I F            V   PD T SI          R+  
Sbjct: 61  RQGLIHQG--SGSVMSASVEIQFYDPGNSMILPSGVAVNPDSTVSI----------RRTV 108

Query: 237 RNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGL 296
                 Y +N +  + + I +++   G  + +   ++ QG + ++   K K         
Sbjct: 109 GLKKDDYQINDRNVTKSDIVRMMESTGFSMSNPYNIVPQGRIVALTNAKDKER------- 161

Query: 297 LEYLEDIIGTAQYKPLIENTLSEI 320
           L+ LED++G   ++  +  +L ++
Sbjct: 162 LQILEDVVGAKSFEAKLTASLKKM 185

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score = 75.9 bits (185), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 55/84 (65%), Gaps = 1/84 (1%)

Query: 1297 NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1356
            ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  +KE +KNAQF
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQF 1181

Query: 1357 IVISLRNNMFELAKQLVGV-YKNK 1379
            I  + R +M ++A +   V Y+NK
Sbjct: 1182 ICTTFRTDMLQVADKFFRVKYENK 1205

 Score = 62.8 bits (151), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 86/187 (45%), Gaps = 16/187 (8%)

Query: 127 LCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+++  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 187 LSELIHKSELHPDLDSCHVDIFFQYVQDEPDGT----TSIIQQKPSMVIRRKAFRNNTSK 242
              LIH+      + S  V+I F     +PD +    + ++ +    V  R+        
Sbjct: 61  RQGLIHQGS-GGSVMSASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 243 YYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLED 302
           Y LN +  +   I ++L   G  +++   ++ QG++ ++   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 303 IIGTAQY 309
           ++G   +
Sbjct: 169 VVGAKSF 175

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 75.1 bits (183), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 54/84 (64%), Gaps = 1/84 (1%)

Query: 1297 NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1356
            ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE + NAQF
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATMIKELSTNAQF 1181

Query: 1357 IVISLRNNMFELAKQLVGV-YKNK 1379
            I  + R +M ++A +   V Y+NK
Sbjct: 1182 ICTTFRTDMLQVADKFFRVKYENK 1205

 Score = 63.2 bits (152), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 86/187 (45%), Gaps = 16/187 (8%)

Query: 127 LCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+V+  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 187 LSELIHKSELHPDLDSCHVDIFFQYVQDEPDGT----TSIIQQKPSMVIRRKAFRNNTSK 242
              LIH+      + S  V+I F     +PD +    + ++ +    V  R+        
Sbjct: 61  RQGLIHQGS-GGSVMSASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 243 YYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLED 302
           Y LN +  +   I ++L   G  +++   ++ QG++ ++   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 303 IIGTAQY 309
           ++G   +
Sbjct: 169 VVGAKSF 175

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 75.1 bits (183), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 108/431 (25%), Positives = 191/431 (44%), Gaps = 70/431 (16%)

Query: 991  EELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDELELTEERVRKAEESIDEKTVEGR 1050
            E L+S ++E +++ N LD +S  ++ ++ +I+ L  ELE    ++   E  ++ K  E  
Sbjct: 803  ERLESLTKEINILHNKLDVTSDALEGITSTIDSLNAELE---SKLIPQENDLEAKMAEVG 859

Query: 1051 DFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQALDESLENESKNE 1110
            D   L +Q     D+LKEL   L  E+AE  H   +L++  V   ++ L           
Sbjct: 860  DAFILGLQ-----DELKEL--QLEMESAEKQHEDAALELSTVQGEIETL----------- 901

Query: 1111 VAAETPGEEDGEHSSS----LHDPMDVDENQGESTSTTEAQLQAGEAERRNTEESLPNGL 1166
            +A ET  ++  E +++    L   +D  +   E T   +  L      RR   +     +
Sbjct: 902  IAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTL----VSRREELQQRIREI 957

Query: 1167 PKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIE----YKARKVDLNH 1222
              L ED L N   +  ++   QL   + +   +I  L+   +R  E    +  ++ DL+ 
Sbjct: 958  GLLPEDALIN---DFSDITSDQLLQKLNDMNTEISGLKNVNKRAFENFKKFNEKRKDLSE 1014

Query: 1223 AVQERDKVRQSNENL----KKKRLDEFMEGFNAICMILKEMYQMITMGGNAELEL----- 1273
               E D+ + S ++L    K++++      F  +    + +++ +   G A+L +     
Sbjct: 1015 RASELDESKNSIQDLIVRLKQQKVSAVDSTFQKVSENFETVFERLVPRGTAKLVIHRRNE 1074

Query: 1274 -----VDSLD-----------------PFSEGVLFSVMPPKKS--WRNITNLSGGEKTLS 1309
                  DS D                     GV  SV    K     ++  LSGG+KT+ 
Sbjct: 1075 NVGDQTDSADVEMDADASKVTSSRDGETVYTGVSISVSFNSKQNEQLHVEQLSGGQKTVC 1134

Query: 1310 SLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1369
            ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE + +AQFI  + R +M ++A
Sbjct: 1135 AIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLIKELSNDAQFICTTFRTDMLQVA 1194

Query: 1370 KQLVGV-YKNK 1379
             +   V Y+NK
Sbjct: 1195 DKFFRVKYENK 1205

 Score = 62.4 bits (150), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 85/187 (45%), Gaps = 16/187 (8%)

Query: 127 LCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+V+  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 187 LSELIHKSELHPDLDSCHVDIFFQYVQDEPDGT----TSIIQQKPSMVIRRKAFRNNTSK 242
              LIH+      + S  V+I F     +PD +    + ++ +    V  R+        
Sbjct: 61  RQGLIHQGS-GGSVMSASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 243 YYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLED 302
           Y LN +  +   I ++L   G  + +   ++ QG++ ++   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 303 IIGTAQY 309
           ++G   +
Sbjct: 169 VVGAKSF 175

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074c SMC3 required for structural maintenance of
            chromosomes
          Length = 1219

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 61/104 (58%), Gaps = 4/104 (3%)

Query: 1279 PFSEGVLFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1336
            P+ EGV  SV    K      +  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAALD
Sbjct: 1092 PY-EGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALD 1150

Query: 1337 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGV-YKNK 1379
             +    VA  I + + NAQFI  + R++M + A +   V Y+NK
Sbjct: 1151 KQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRVKYENK 1194

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 106/228 (46%), Gaps = 16/228 (7%)

Query: 127 LCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+++  FK+Y    ++G F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 187 LSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIR-RKAFRNNTSKYYL 245
              LIH+      + S  V+I F   +      T I     S  +R R+        Y +
Sbjct: 61  RQGLIHQGA-GASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQV 119

Query: 246 NGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIG 305
           N +  +   + ++L   G  + +   ++ QG + S+   K K         L+ LE+++G
Sbjct: 120 NDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKER-------LQLLEEVVG 172

Query: 306 TAQYKPLIENTLSEI-------AKLNDICEEKENRFEIVEREKSSLEQ 346
              ++  ++ ++ ++       A+++   EE E++   +E+E+  LE+
Sbjct: 173 AKSFEVKLKASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEK 220

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 72.0 bits (175), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 59/97 (60%), Gaps = 6/97 (6%)

Query: 1297 NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1356
            ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA  +K+ +  AQF
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQF 1181

Query: 1357 IVISLRNNMFELAKQLVGV-YKNK-----NMTKSVAL 1387
            I  + R +M  +A +   V ++NK      +TK+ AL
Sbjct: 1182 ICTTFRGDMIAVADRFYRVNFENKISTVVEVTKAEAL 1218

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 68.9 bits (167), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 49/83 (59%), Gaps = 1/83 (1%)

Query: 1298 ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1357
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1358 VISLRNNMFELAKQLVGV-YKNK 1379
              + R +M  +A     V ++NK
Sbjct: 1177 CTTFRTDMINVADTFFRVKFENK 1199

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 79/159 (49%), Gaps = 16/159 (10%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLS 188
           + RL LHNF +Y+  +    F  S + VVGPNGSGKS ++ +L      R   + + K S
Sbjct: 57  VVRLRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGRMKRS 114

Query: 189 ELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGK 248
           +   K+      DS  +D+   ++  E  GTT     K S V+ R       S YY++G 
Sbjct: 115 DSFIKN----GADSARIDV---WLAGEDPGTTL----KVSRVLTRN--HKKASLYYVDGV 161

Query: 249 ESSYTIITQLLRDE-GIDLDHKRFLILQGEVESIAQMKP 286
           E+S   + QL+  +  I LD+    + Q  V+  A+++P
Sbjct: 162 ETSEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLRP 200

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 78/171 (45%), Gaps = 16/171 (9%)

Query: 1178 EVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENL 1237
            +VE +E EI      + +  + I IL+E  R+L + KAR   L   V++ D    S   +
Sbjct: 885  QVERLESEIR----MINHDESSIAILQEVERKLADVKAR---LPAMVRKLDAATASMSTM 937

Query: 1238 KKK---RLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEGVL--FSVMPPK 1292
            + +   RLD  +E    I      ++  +   G  +L        +   ++  F    P 
Sbjct: 938  QAELEPRLDTIVE---KISERFTNLFTNVGSAGAIQLSKPHLYQEWEMKIMVKFRDNAPL 994

Query: 1293 KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1343
            K   + T  SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 995  KRLDSHTQ-SGGERAVSTVLYIIALQEFTSAPFRVVDEINQGMDQRNERIV 1044

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
           Ashbya gossypii AAL182W
          Length = 1232

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 86/191 (45%), Gaps = 12/191 (6%)

Query: 127 LCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I ++++  FK+Y     +  F    + VVG NGSGKSN   ++ FV       +++ +
Sbjct: 1   MYIRKVIISGFKTYKNKTEIDNFSAHHNVVVGLNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 187 LSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLN 246
              LI++      + S +V+I F    D  + T   I      +  R+       +Y +N
Sbjct: 61  RRSLIYQGT--SSVMSGYVEIVF---HDAENRTLLGIPDSNGAIRIRRTVGLKKDEYMIN 115

Query: 247 GKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGT 306
            K SS + + +LL   G    +   ++ QG + S+   K       D   L+ LE+++G 
Sbjct: 116 NKNSSRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAK-------DRERLQLLEEVVGA 168

Query: 307 AQYKPLIENTL 317
             ++  ++ +L
Sbjct: 169 KSFERKLKESL 179

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 81/304 (26%), Positives = 133/304 (43%), Gaps = 42/304 (13%)

Query: 109 LESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVGPFH--NSFSAVVGPNGSGKSN 166
           L S++ + S+      Q   I ++ L NF +YA T+    FH   S + ++GPNGSGKS 
Sbjct: 28  LPSKRLKLSKVNYTDFQPGSIIKIRLKNFVTYALTE----FHLSPSLNMIIGPNGSGKST 83

Query: 167 VIDSLLFVFGFRANKM-RQGKLSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQ 225
            + ++      R   + R  ++ + I   E     D C ++I  +    +  G  +++  
Sbjct: 84  FVCAICLGLAGRPEYIGRSKRVEDFIKNGE-----DECEIEITLKN-NSKIQGIANVLSS 137

Query: 226 KPSMVIRRKAFRNN-TSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQM 284
              + I R   R+   S Y++N + +S  ++  ++    I LD+    + Q  VE  A++
Sbjct: 138 DDVIKITRVLIRHRKKSDYFINDRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEFARL 197

Query: 285 KPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLN--DICEEKE-----NRFEIV 337
           K      SD  L E +  I        LI   L E+ +L   ++ EEKE      R + +
Sbjct: 198 K------SDKLLFETIRSIDTD-----LI-TVLEELKELQGEELAEEKEVSFKQQRLQEL 245

Query: 338 EREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAE 397
             EK  LE      LE  +++K    +  KLL Y       K+   KEKI  +  K   E
Sbjct: 246 TAEKERLETSVR-VLEEFQRKKDQLEIHKKLLPY------VKIKDHKEKIRAS--KKCYE 296

Query: 398 KAKR 401
            AKR
Sbjct: 297 DAKR 300

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 76/172 (44%), Gaps = 28/172 (16%)

Query: 1220 LNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDP 1279
            L H    RD V++  + L+  RLDE ++    +      ++  +   G   LE      P
Sbjct: 915  LTHLANIRDSVKEKRDVLEP-RLDEVVQ---RVSQRFARLFVGVGSAGAVNLE-----KP 965

Query: 1280 --FSEGVLFSVMPPKKSWRNITNL-----SGGEKTLSSLALVFALHKYKPTPLYVMDEID 1332
              FSE  L  +M   +    +  L     SGGE+ +S++  + AL ++   P  V+DEI+
Sbjct: 966  TLFSEWKL-EIMVKFRDNATLKRLDSHTQSGGERAVSTVLYMIALQEFTTAPFRVVDEIN 1024

Query: 1333 AALDFRNVSIVANYIKERT---KNAQFIVISLRNNMFELAKQLVGVYKNKNM 1381
              +D RN  IV   + E       +Q+ +I+         K L G+Y ++ M
Sbjct: 1025 QGMDTRNERIVHKAMVENACAENTSQYFLIT--------PKLLTGLYYHEKM 1068

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q08204 YOL034W Saccharomyces
           cerevisiae YOL034W SMC5 Structural maintenance of
           chromosomes (SMC) protein, interacts with Rhc18p and
           Nse1p to form a large complex
          Length = 1119

 Score = 52.8 bits (125), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 134/303 (44%), Gaps = 59/303 (19%)

Query: 109 LESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVGPFH--NSFSAVVGPNGSGKSN 166
           L +++ +   + +   Q   + +L L NF +YA T+    FH   S + ++GPNGSGKS 
Sbjct: 40  LSTKRLRIQHSELNEFQPGAVVKLKLTNFVTYALTE----FHLSPSLNMIIGPNGSGKST 95

Query: 167 VIDSLLFVFGFRANKM-RQGKLSELIHKSE---------------LHPDLDSCHVDIFFQ 210
            + ++      +   + R  K+ E I                   LH D +  + D    
Sbjct: 96  FVCAICLGLAGKPEYIGRSKKVEEYIKNGTDEGVIEITLKNSSALLHSDFNMINTD---- 151

Query: 211 YVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKR 270
                      ++  K  + + +K      SKYY+N K  +  ++  ++R   I LD+  
Sbjct: 152 ---------DDVVHVKRVLSMEKKK-----SKYYINNKVVTEEVVKSMVRVLNIQLDNLC 197

Query: 271 FLILQGEVESIAQMKP-----KAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLND 325
             + Q  VE  A++KP     +  +  + GLLE L +          +++  +E  +L  
Sbjct: 198 QFLSQERVEEFARLKPDTLLNETIRSIEAGLLEKLSE----------LKSLQAEGNELQI 247

Query: 326 ICEEKENRFEIVEREKSSLEQGKNEALE-YLEKEKTLTILRSKLLQY-HLWKNEQKLNST 383
               KEN+ + +   +++LE  +  ALE Y EK + L I   KLL Y +L ++++K+   
Sbjct: 248 DLGAKENKLKELTSSRAALE-SQAHALELYEEKARELDI-HQKLLNYTYLKEHKEKIRGL 305

Query: 384 KEK 386
           K+K
Sbjct: 306 KDK 308

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 60/139 (43%), Gaps = 23/139 (16%)

Query: 1241 RLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITN 1300
            RLD+ ++    I      ++  +   G  EL+  DS + +        +  K  +R+ + 
Sbjct: 955  RLDDIVK---QISKKFSHLFAYVGSAGQVELKKPDSFNDW-------CIEIKVKFRDNSE 1004

Query: 1301 L--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA-----NYI 1347
            L        SGGE+ +S++  + AL ++  +P  V+DEI+  +D  N  IV      N  
Sbjct: 1005 LQQLNPHVQSGGERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNERIVHRIMVENAC 1064

Query: 1348 KERTKNAQFIVISLRNNMF 1366
             E T     I   L  N+F
Sbjct: 1065 AENTSQYFLITPKLLTNLF 1083

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 76/158 (48%), Gaps = 16/158 (10%)

Query: 132 LVLHNFKSYAGTQVVGPFH--NSFSAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQGKLS 188
           L L NF +YA T+    FH   S + ++GPNGSGKS  + ++      +   + R  K+ 
Sbjct: 50  LRLENFVTYALTE----FHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSTKIE 105

Query: 189 ELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNN-TSKYYLNG 247
           + I   E     D   +++    ++ +P+     +    +  + R   RN   S+Y+LNG
Sbjct: 106 DYIKNGE-----DRSVIEV---TLKRDPEAEDRYVASDGTTKVTRVLHRNRKASEYFLNG 157

Query: 248 KESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMK 285
           +  + + + +L+ +  I LD+    + Q  VE  A++K
Sbjct: 158 QSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLK 195

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1302 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1358
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1359 IS 1360
            ++
Sbjct: 1049 VT 1050

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 118/259 (45%), Gaps = 34/259 (13%)

Query: 128 CIDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQG 185
            I ++ L NF +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 37  SIVKIKLQNFVTYRLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAK 93

Query: 186 KLSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSI-----IQQKPSMVIRRKAFRNNT 240
           ++ + I   E     D+  ++IF +  +D  +  +S+     +  K  + + R   R+  
Sbjct: 94  RVDDFIKNGE-----DTSRIEIFLKNYEDPTELQSSLNLKFNLAGKDLLKVTRLIQRDGN 148

Query: 241 ---SKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKP-----KAEKES 292
              S Y++N K  +  +I  L++   I LD+    + Q  VE  A++K      +  +  
Sbjct: 149 KCKSDYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLKSDKLLVETVRSI 208

Query: 293 DDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEAL 352
           D  LL+ L+D+  +   +  +EN +       DI   K+ RF  +E +++ LE     +L
Sbjct: 209 DAQLLQILDDLKSSQNDETTLENEV-------DI---KQKRFNELETDRNKLE-ASVRSL 257

Query: 353 EYLEKEKTLTILRSKLLQY 371
           +  E  K    +  KLL Y
Sbjct: 258 KEFETMKEDIEIHKKLLPY 276

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1302 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1358
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1359 IS 1360
            I+
Sbjct: 1050 IT 1051

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
           YOL034W - Protein required for cell viability [contig
           47] FULL
          Length = 1117

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 87/196 (44%), Gaps = 21/196 (10%)

Query: 111 SQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVGPFH--NSFSAVVGPNGSGKSNVI 168
           S++ +  +  +   Q   I +L L NF +Y+ T+    FH   S + ++GPNGSGKS  +
Sbjct: 51  SKRLKFGKEDLSQFQPGSIVKLRLENFVTYSLTE----FHLSPSLNMIIGPNGSGKSTFV 106

Query: 169 DSLLFVFGFRANKMRQGK-LSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKP 227
            ++      +   + +GK +   I   E    ++          ++ +P  T S +    
Sbjct: 107 CAVCLGLAGKPEYIGRGKRVDSFIKNGENRGLIEVT--------LKRDPGRTGSFVAVDG 158

Query: 228 SMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPK 287
           +  + R  +    S+YYLN +  S   +  L+ +  I LD+    + Q  VE  A++K  
Sbjct: 159 TTKVSRVLWVGKKSEYYLNDEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLK-- 216

Query: 288 AEKESDDGLLEYLEDI 303
               SD  L+E +  +
Sbjct: 217 ----SDKLLMETVRSV 228

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 83/360 (23%), Positives = 158/360 (43%), Gaps = 53/360 (14%)

Query: 1021 INKLKDELELTEERVRKAEESIDEKTVEGRDFEALEIQC------VAQLDKLKELFAILN 1074
            I  L+D+LE+ E   R+ + ++  K ++G+  E ++ Q       V  + KL++L   +N
Sbjct: 747  IRTLEDKLEMAERESRR-DVTVKIKQLQGQIQEHVQEQIKGISEIVKYISKLQKLQNKIN 805

Query: 1075 KEAAEFLHSLNSLKIRDVTATLQALDESLENESKN-EVAAETPGEEDG--EHSSSLHDPM 1131
                E+L + N  K+R +   L   +E+ +N ++  E A  T     G  E+ S +    
Sbjct: 806  MANIEYLEASN--KMRSMNEVLGFFNETEDNLTEAYEEAKRTHNNMKGTPEYKSWIE--- 860

Query: 1132 DVDENQGESTSTTEAQLQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQD 1191
                 Q ++ S+ E    A  AE      SL     K + D ++    E   +  +Q + 
Sbjct: 861  -----QIKTYSSAEKSTLAKLAEEYEKNNSLE---LKFVSDLIDRLHSEIGMM--NQDES 910

Query: 1192 YVENAYADIEILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNA 1251
             +E      + LE   R + + +A   DL  A+++   V + N       +D  +EG   
Sbjct: 911  VIEKMRQTEKELETLNRSIPQIQASLNDLTIAIEKERSVLEPN-------VDGIVEG--- 960

Query: 1252 ICMILKEMYQMITMGGNAELEL--------VDSLDPFSEGVLFSVMPPKKSWRNITNLSG 1303
            I +    ++Q +  GG+  LE         ++ +  F +  L   +  +         SG
Sbjct: 961  ISINFSRLFQNVGSGGSVVLEKNELFSNWKINIMVRFRDSALMKKLDSQIQ-------SG 1013

Query: 1304 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIVIS 1360
            GE+ +S++  + AL ++   P  ++DEI+  +D RN  IV   + E     K +Q+I+++
Sbjct: 1014 GERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYILVT 1073

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 45/85 (52%), Gaps = 3/85 (3%)

Query: 1279 PFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1338
            P  + +++++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  
Sbjct: 987  PAKQLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQV 1046

Query: 1339 NVSIVANYIKERTKN---AQFIVIS 1360
            N  +    I E+ KN    Q I+I+
Sbjct: 1047 NRKMGTRLILEKLKNNSRTQTIIIT 1071

 Score = 33.1 bits (74), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 13/78 (16%)

Query: 129 IDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG-K 186
           I ++ L NF  +   ++ +GP  N    +VG NGSGKS ++ ++    G +A+   +G  
Sbjct: 74  IKKVSLRNFMCHENFELALGPRLN---FIVGNNGSGKSAILTAITIGLGAKASDTNRGTS 130

Query: 187 LSELIHKSELHPDLDSCH 204
           L  LI         + CH
Sbjct: 131 LKSLIK--------EGCH 140

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 88/419 (21%), Positives = 187/419 (44%), Gaps = 85/419 (20%)

Query: 977  NDIKR-YQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDE--LELTEE 1033
            N +KR Y +Q  +L + +++   EK +I+N L++++K++ EL + +NK+ D   L+  ++
Sbjct: 697  NKLKREYDEQINELKQNIRTLDNEKKIIQNKLNNNTKQITELKKDLNKVVDTGVLDSAKD 756

Query: 1034 RVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLK----- 1088
              ++ + +I              +     L+ LKE    L ++A      LN ++     
Sbjct: 757  EYQRIQNAI--------------VSYETALEGLKENMNTLLEKA----RPLNDIRDTAQK 798

Query: 1089 -IRDVTATLQALDESLENES------KNEVAAETPGEEDGEHSSSLHDPMD-VDENQGES 1140
              R++    +AL + LE+        K+++  +       +  + + + +D V  N  + 
Sbjct: 799  TYRNIKKEFEALKQELEDRDIRIRRYKDDITIQ------NDEKARIQEKIDRVQSNINDL 852

Query: 1141 TSTTEAQLQAGE---AERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAY 1197
             S  E Q++      +E  +T E+LP+      +D++   E+E +  +I + +  +  +Y
Sbjct: 853  MSGIETQIENASEFCSEEESTSENLPDN-----QDDIRK-ELEDISRKIKRNESDIGVSY 906

Query: 1198 AD-IEILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMIL 1256
               +E+ E+   + +  K + +++++A+         N ++K + ++     F       
Sbjct: 907  EKALELYEQTMSKFLSAKEKYIEMDNALS------ILNHSIKSRTVN-----FG------ 949

Query: 1257 KEMYQMITMGGNAELELVDSL--DPFSEGVLFS--------VMPPK--KSWRNITNLSGG 1304
               YQ  +   +A+ +  +SL    F   + F            P+  K  RN+  LSGG
Sbjct: 950  ---YQKTSTFADADFDFRNSLRIRKFKGKLDFGKTKETLNVYTGPQTDKEPRNVDTLSGG 1006

Query: 1305 EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN---AQFIVIS 1360
            EK+ S +AL+ A  K   + +  +DE D  +D  N       I ++ K+    Q I+I+
Sbjct: 1007 EKSFSQIALLLATWKPMRSRIIALDEYDVFMDQVNRKTSTQLIVQKLKDDSRTQTIIIT 1065

 Score = 34.3 bits (77), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 129 IDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK- 186
           I ++ L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +AN   +G  
Sbjct: 71  IKKIKLVNFMCHEHFELTLGP---RLNFIVGNNGSGKSAILTAITIGLGAKANSTNRGNS 127

Query: 187 LSELI 191
           L +LI
Sbjct: 128 LKDLI 132

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1080

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 92/211 (43%), Gaps = 36/211 (17%)

Query: 103 PMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNG 161
           P +K    S  +  S+   G+I +L      L N  +Y+ T+  + P   S + +VGPNG
Sbjct: 16  PRRKRMKPSPTYDYSKFQPGNIVKL-----RLQNVMTYSITEFNLSP---SLNMLVGPNG 67

Query: 162 SGKSNVIDSLLFVFGFRANKM-RQGKLSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTT 220
           SGKS  + ++      +   + R  K+   I   E     ++  +D F +          
Sbjct: 68  SGKSTFVCAVCLGLAGKPEYIGRSKKIDNFIKNGE-----NTAQIDTFLR---------- 112

Query: 221 SIIQQKPSMVIR--RKAFRNNT-SKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGE 277
                 P+ VI+  R   RN   S+YY++   S+ T + +L  +  I LD+    + Q  
Sbjct: 113 ---GHMPNEVIKITRIMTRNKKKSEYYIDDSPSTETAVRKLASELNIQLDNLCQFLSQEH 169

Query: 278 VESIAQMKP-----KAEKESDDGLLEYLEDI 303
           VE  A++K      +  +  +  LLE LED+
Sbjct: 170 VEDFAKLKSDKLLIETIRSINPSLLETLEDL 200

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 46/98 (46%), Gaps = 11/98 (11%)

Query: 1302 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1358
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1359 ISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLIDRS 1396
            I+         K L  +Y ++ M        + + D S
Sbjct: 1035 IT--------PKLLTDLYYHEKMAVHCVFAGSAIPDPS 1064

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
           (REAL)
          Length = 1092

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 137/306 (44%), Gaps = 51/306 (16%)

Query: 111 SQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSNVID 169
           S++ + + A + S Q   I ++ L +F +Y  T+  + P   S + ++GPNGSGKS  + 
Sbjct: 24  SKRVKVAAADLSSFQPGSIIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVC 80

Query: 170 SLLFVFGFRANKM-RQGKLSELIHKSELHPDLDSCHV-----------DIFFQYVQDEPD 217
           ++      +   + R  K+ + I   +     D+  +           DI F    DE  
Sbjct: 81  AVCLGLAGKPEYIGRSKKVEDFIKNGQ-----DTSRIEITLKNSPKIHDIEFINTHDETI 135

Query: 218 GTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGE 277
             T II +      RR       S Y +N ++ S  ++  L+    I LD+    + Q  
Sbjct: 136 KVTRIITRSK----RR-------SDYLINDEQVSENVVKTLVAQLNIQLDNLCQFLSQER 184

Query: 278 VESIAQMKP-----KAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKEN 332
           VE  A++K      +  +  D  LL+ L++++     +  ++  L ++ KL         
Sbjct: 185 VEEFARLKSVKLLVETIRSIDASLLDVLDELMELQANEQSLQKDL-DVKKL--------- 234

Query: 333 RFEIVE-REKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKN-EQKLNSTKEKIAKA 390
             ++V  R++S   +   E+L   +K+K    L S+LL Y   K+ ++KLN+ KE+  +A
Sbjct: 235 --KVVHLRQESDKLRKSVESLRDFQKKKGEIELHSQLLPYVKVKDHKEKLNTYKEEYERA 292

Query: 391 QEKLSA 396
           +  L A
Sbjct: 293 KSNLRA 298

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1302 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1358
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1359 IS 1360
            I+
Sbjct: 1047 IT 1048

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 1285 LFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1344
            +F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I  
Sbjct: 996  IFILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGT 1055

Query: 1345 NYIKERTKN---AQFIVIS 1360
              I  + K+    Q I+I+
Sbjct: 1056 KLILNKLKDIARTQTIIIT 1074

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 47/88 (53%), Gaps = 9/88 (10%)

Query: 129 IDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK- 186
           I ++VL NF  +   ++ +GP     + +VG NGSGKS ++ ++    G RA    +G  
Sbjct: 75  IKKVVLWNFMCHEHFELELGP---RLNFIVGNNGSGKSAILTAITVGLGARAMDTNRGNS 131

Query: 187 LSELI----HKSELHPDLDSCHVDIFFQ 210
           L +LI    H +++   LD+ +   ++Q
Sbjct: 132 LKDLIREGCHSTKIRLHLDNLNHGAYYQ 159

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1089

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 85/192 (44%), Gaps = 21/192 (10%)

Query: 101 LSPMKKSRLESQKFQESRAMMGSI-----QRLCIDRLVLHNFKSYAGTQ-VVGPFHNSFS 154
           +SP K  ++ + K    R  + +I     Q   I ++ L NF +Y+  +  + P   S +
Sbjct: 11  VSPTKDRQISTSKPARKRLKITAIDTEQFQPGSIIKIKLWNFVTYSLAEFTLSP---SLN 67

Query: 155 AVVGPNGSGKSNVIDSLLFVFGFRANKM-RQGKLSELIHKSELHPDLDSCHVDIFFQYVQ 213
            ++GPNGSGKS  + ++      +   + R  KL + I   E     D   V++  + V 
Sbjct: 68  MIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSSKLEDYIKNGE-----DQSVVEVTLKNVP 122

Query: 214 DEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLI 273
            E D  T  I  K ++   +K       +Y +NG   + T I   ++   I LD+    +
Sbjct: 123 -ESDFNTDTILIKTTINRGKKK-----PEYAINGSTVTETYIRAFVKKLNIQLDNLCQFL 176

Query: 274 LQGEVESIAQMK 285
            Q  VE  A++K
Sbjct: 177 SQERVEEFARLK 188

 Score = 40.4 bits (93), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1302 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1358
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I+   + E       +Q+ +
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIIHKAMVENACAENTSQYFL 1043

Query: 1359 IS 1360
            I+
Sbjct: 1044 IT 1045

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar
           to uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 62/134 (46%), Gaps = 26/134 (19%)

Query: 129 IDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG-K 186
           I +L LHNF  +    V +GP     + +VG NGSGKS ++ ++    G +A++  +G  
Sbjct: 80  IKKLTLHNFMCHRNFDVELGP---GLNFIVGKNGSGKSAILTAITIGLGAKASETNRGSS 136

Query: 187 LSELIHKSELHPDLDSCHVDIFFQ------YVQDEPDGTTSIIQQKPSMVIRRKAFRNNT 240
           L +LI         +S  + I+        YV   P G     Q   +++I R   R +T
Sbjct: 137 LKDLITAG-----CNSSRITIYLSNSGIGAYV---PKGK----QYGDTIIIERTISRTST 184

Query: 241 SKYYL---NGKESS 251
           + + L   NG E S
Sbjct: 185 AGFSLKSENGTEIS 198

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 1285 LFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1344
            +  + P    +R ++  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +
Sbjct: 1004 ILILTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGS 1063

Query: 1345 NYIKERTK---NAQFIVIS 1360
              I ++ K   N Q I+I+
Sbjct: 1064 KLIVKKLKDIPNTQTIIIT 1082

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034w SMC5
          Length = 1105

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 84/376 (22%), Positives = 169/376 (44%), Gaps = 53/376 (14%)

Query: 101 LSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPN 160
           L+P +K RL+ +         GSI ++ ++  V +N+  +     + P   S + ++GPN
Sbjct: 16  LTPSRK-RLKIKPVDYDVFKPGSIVKIRLENFVTYNYTEFN----LSP---SLNMIIGPN 67

Query: 161 GSGKSNVIDSLLF--------------VFGFRANKMRQGKLSELIHKSELHPDLDSCHVD 206
           GSGKS  + ++                V  F  N     K+ E++ K +  P++D   + 
Sbjct: 68  GSGKSTYVCAVCLGLAGKPEYIGRSKQVEDFIKNGQDTSKI-EIVLKDD--PNIDIEFLG 124

Query: 207 IFFQYVQDEPD--GTTSIIQQ-KPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEG 263
             F  +++  +  G  +I +  +    I R   +  T +Y +NG  ++ + +  L+    
Sbjct: 125 SSFHRIRNNGNYKGLLTITRNLEKRTKIGRNLEKRRTQEYSINGLPTTESNVRNLVSKFH 184

Query: 264 IDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKL 323
           I LD+    + Q  VE  A+++P  EK  D+ +     +++  + ++ L +  L EI   
Sbjct: 185 IQLDNLCQFLSQERVEEFAKLRP--EKLLDETIRAIDSELL--SMFEVLKKLQLQEIEMS 240

Query: 324 NDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTIL--RSKLLQY-HLWKNEQKL 380
           N+I    +   + +++ K+  E  + E     E ++TL  L    KLL Y  +  + +KL
Sbjct: 241 NEI----QTNTDSLKKLKTDEENFQQEVQLLNEYQETLDTLDKHKKLLPYLKIQDHREKL 296

Query: 381 NSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACD 440
            + K ++  A+++L   + +R  + +              +L  L ES+ +L +EK   +
Sbjct: 297 LTYKRQVEGAKKQLQEFQKEREPYMQ--------------VLASLNESDAQLNIEKENIE 342

Query: 441 RDRVSLEEKLKNLTQK 456
             +VS + KL+    K
Sbjct: 343 EKKVSTKRKLEKTVSK 358

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1302 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD-----FRNVSIVANYIKERTKNAQF 1356
            SGGE+ +S++  + AL K+   P  V+DEI+  +D       + ++V N  +E T  +Q+
Sbjct: 1000 SGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVHKAMVQNACEEGT--SQY 1057

Query: 1357 IVIS 1360
             +I+
Sbjct: 1058 FLIT 1061

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
           (REAL)
          Length = 1093

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 82/193 (42%), Gaps = 27/193 (13%)

Query: 109 LESQKFQESR-----------AMMGSIQRLCIDRLVLHNFKSYAGTQV-VGPFHNSFSAV 156
           +ES +F E R           A + S Q  CI ++ L +F +Y  T+  + P   S + +
Sbjct: 11  VESSRFGEDRGPRSKRVKIAGADLSSFQPGCITKIRLQDFVTYTLTEFNLSP---SLNMI 67

Query: 157 VGPNGSGKSNVIDSLLFVFGFRANKM-RQGKLSELIHKSELHPDLDSCHVDIFFQY---V 212
           +GPNGSGKS  + ++      +   + R  K+ + I   +     D   ++I  +    V
Sbjct: 68  IGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKVEDFIKNGQ-----DVSRIEITLKNSPKV 122

Query: 213 QDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFL 272
            D  +        K + +I R   R   S Y +N  + S   +  L+    I LD+    
Sbjct: 123 HDIENINAHDETIKITRIITRSKRR---SDYLINDGQVSENTVKTLVTQLNIQLDNLCQF 179

Query: 273 ILQGEVESIAQMK 285
           + Q  VE  A++K
Sbjct: 180 LSQERVEEFARLK 192

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 11/83 (13%)

Query: 1302 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1358
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1359 ISLRNNMFELAKQLVGVYKNKNM 1381
            I+         K L G+Y ++ M
Sbjct: 1047 IT--------PKLLTGLYYHEKM 1061

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 15/85 (17%)

Query: 1302 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1356
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1357 IVISLRNNMFELAKQLVGVYKNKNM 1381
             +I+         K L G+Y ++ M
Sbjct: 1056 FLIT--------PKLLTGLYYHEKM 1072

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1119

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 126/297 (42%), Gaps = 53/297 (17%)

Query: 111 SQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSN-VI 168
           S+K + S       Q   I ++ L NF +Y  T+  + P   S + ++GPNGSGKS  V 
Sbjct: 34  SKKLKLSTVNYDKFQPASIVKIKLENFVTYKLTEFNLSP---SLNMIIGPNGSGKSTFVC 90

Query: 169 DSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQYVQ--------------- 213
            + L + G      R  ++ + I   E     D   ++IF + V+               
Sbjct: 91  AACLGLAGKPEYIGRSKRVDDYIKNGE-----DRSKIEIFLKNVESMDKLKNFNNNNNKN 145

Query: 214 -------DEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDL 266
                  D   G   +I  K + +I R   +   S YY+N K  S   +  L++   I L
Sbjct: 146 NNNGAQVDLKCGQLDLI--KFTRIIHRDKKK---SDYYINDKPVSELTVKNLVKALSIQL 200

Query: 267 DHKRFLILQGEVESIAQMKP-----KAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIA 321
           D+    + Q  VE  A++K      +  +  D  LL+ LE++        +++N   E  
Sbjct: 201 DNLCQFLSQERVEEFARLKSDKLLVETVRSIDPNLLDILEEL-------KVLQN---EEQ 250

Query: 322 KLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQ 378
            + D  E K+ R+  +  E++ LE    ++L+  E +K      +KLL Y + K+ +
Sbjct: 251 TVEDELEIKQKRYTELCNERTKLE-ASVQSLKEFENKKLEIEYHNKLLPYVMIKDHR 306

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1302 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1358
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1359 IS 1360
            I+
Sbjct: 1074 IT 1075

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 1285 LFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1344
            +F +    +  RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I  
Sbjct: 981  MFVLTANDEKPRNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGT 1040

Query: 1345 NYIKERTKN---AQFIVIS 1360
              + ++ K+    Q I+I+
Sbjct: 1041 TLVVKKLKDLARTQTIIIT 1059

 Score = 36.6 bits (83), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 129 IDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK- 186
           I ++ L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +A+   +G  
Sbjct: 64  IKKVSLRNFMCHENFELELGP---KLNFIVGSNGSGKSAILTAITIALGAKASDTNRGNS 120

Query: 187 LSELI 191
           L ELI
Sbjct: 121 LKELI 125

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 52/101 (51%), Gaps = 5/101 (4%)

Query: 1296 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1353
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1354 -AQFIVISLRN--NMFELAKQLVGVYKNKNMTKSVALQNTD 1391
              Q I+I+ ++   + E+    V ++K K+  +     NTD
Sbjct: 1074 RTQTIIITPQDIGKITEIDSTGVKIHKMKDPQRQNNSNNTD 1114

 Score = 36.6 bits (83), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 13/119 (10%)

Query: 129 IDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK- 186
           I ++VL NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +A +  +G  
Sbjct: 82  IKKVVLKNFMCHEHFEMDLGP---KLNFIVGNNGSGKSAILTAITVGLGAKAAETNRGNS 138

Query: 187 LSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYL 245
           L +LI         + CH       +++E  G          ++I R   R+ T+ + L
Sbjct: 139 LKDLIK--------EGCHRAKIAITLENESYGAYQPDVFGSEIIIERTIKRDGTATFSL 189

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1296 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1353
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1354 -AQFIVIS 1360
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

 Score = 32.7 bits (73), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG-KL 187
           I +++L NF  +   ++     +  + +VG NGSGKS ++ ++    G +A++  +G  L
Sbjct: 88  IKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSL 145

Query: 188 SELI 191
            +LI
Sbjct: 146 KDLI 149

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1296 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1353
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1354 -AQFIVIS 1360
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

 Score = 33.1 bits (74), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 5/65 (7%)

Query: 129 IDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK- 186
           I ++ L NF  +   ++  GP     + +VG NGSGKS V+ ++    G +A+   +G  
Sbjct: 85  IKKIKLRNFMCHENFEMEFGP---RLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGNS 141

Query: 187 LSELI 191
           L +LI
Sbjct: 142 LKDLI 146

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1296 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1353
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1354 -AQFIVIS 1360
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 32.7 bits (73), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 129 IDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG-KL 187
           I +++L NF  +   ++     +  + +VG NGSGKS ++ ++    G +A++  +G  L
Sbjct: 82  IKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSL 139

Query: 188 SELI 191
            +LI
Sbjct: 140 KDLI 143

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1117

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 11/83 (13%)

Query: 1302 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1358
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1359 ISLRNNMFELAKQLVGVYKNKNM 1381
            I+         K L G++ ++ M
Sbjct: 1072 IT--------PKLLTGLFYHEKM 1086

 Score = 37.0 bits (84), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 4/41 (9%)

Query: 129 IDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSNVI 168
           I ++ LHNF +Y  T+  + P   S + ++GPNGSGKS  +
Sbjct: 66  IIKIKLHNFVTYEFTEFDLSP---SLNMIIGPNGSGKSTFV 103

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 7/92 (7%)

Query: 1296 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1350
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1351 TKNAQFIVISLRN--NMFELAKQLVGVYKNKN 1380
              + Q I+I+ ++   M  +  +   ++K KN
Sbjct: 1057 KSDTQTIIITPQDIGKMANIDDKYFNIHKMKN 1088

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 66/131 (50%), Gaps = 21/131 (16%)

Query: 1241 RLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITN 1300
            RLDE +E    I    ++++  + +G   E+ LV   D +SE  +      K  +R++  
Sbjct: 933  RLDEIVEN---ISTRFRKLF--LNVGSAGEVCLVKP-DLYSEWKI----EIKVKFRDVAE 982

Query: 1301 L--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-- 1350
            L        SGGE+ +S++  + +L ++   P  V+DEI+  +D RN  IV   + E   
Sbjct: 983  LKKLDSHIQSGGERAVSTVLYMISLQEFTNAPFRVVDEINQGMDARNERIVHKAMVENAC 1042

Query: 1351 TKN-AQFIVIS 1360
             KN +Q+ +I+
Sbjct: 1043 AKNTSQYFLIT 1053

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 141/308 (45%), Gaps = 39/308 (12%)

Query: 96  LELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVGPFH--NSF 153
           L L Q   +KK+  +  +FQE     G+I +L   RLV  NF +Y+ T+    FH   S 
Sbjct: 23  LLLRQRKKLKKNNQDYSEFQE-----GAIIKL---RLV--NFVTYSLTE----FHLSPSL 68

Query: 154 SAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQGKLSELI----HKSELHPDLDSCHVDIF 208
           + ++GPNGSGKS+ + ++      +   + R  K+ + I     +S +   + +      
Sbjct: 69  NMIIGPNGSGKSSFVCAICLGLAGKPEYIGRAKKVEDFIKNGTEESVIELTVKNSKAVSG 128

Query: 209 FQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDH 268
           +  +     G+  +I  K  ++  +K        YY+NG+      +  L+    I LD+
Sbjct: 129 YSMI----GGSDEVINIKTVIMKAKKK-----CIYYINGQSVGENQVKALVCLLNIQLDN 179

Query: 269 KRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYK-PLIENTLSEIAKLNDIC 327
               + Q  VE  A++K      SD  L E +  I  T   K  ++++   E   +    
Sbjct: 180 LCQFLSQERVEEFARLK------SDKLLEETIRSIDSTLVEKLDMLKDKQQEEVTIGRDV 233

Query: 328 EEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQ-KLNSTKEK 386
           E  +++ E +   K SLE  +  ALE  E++K    +  KLL Y   KN + +LN+ K+ 
Sbjct: 234 ELNKSKLEKLIIRKESLE-SQVRALEEYERKKNEIDIHKKLLPYVRVKNHKLQLNNLKKV 292

Query: 387 IAKAQEKL 394
             +++++L
Sbjct: 293 YEQSKQEL 300

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1296 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1353
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1354 -AQFIVIS 1360
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1296 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1353
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1354 -AQFIVIS 1360
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar to
            uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
            Structural maintenance of chromosomes (SMC) protein
            interacts with Rhc18p and Nse1p to form a large complex
            S. pombe homolog forms a heterodimer with S. pombe Rad18p
            that is involved in DNA repair
          Length = 1088

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1302 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1356
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN      S+V N   E T  +Q+
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENT--SQY 1038

Query: 1357 IVIS 1360
             +I+
Sbjct: 1039 FLIT 1042

 Score = 39.7 bits (91), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 131/282 (46%), Gaps = 38/282 (13%)

Query: 128 CIDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
            I ++ L NF +Y  T+  + P   S + ++GPNGSGKS  + ++      +   +++ K
Sbjct: 35  AIVKMRLENFVTYTLTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSK 91

Query: 187 -LSELIHKSELHPDLDSCHVDIFFQYVQDEP--DGTTSIIQQKPSMVIRRKAFRNNT-SK 242
            + + I   E     D   ++I    +++ P  +G   +  +  ++ I R+  ++ + S+
Sbjct: 92  RVEDFIKNGE-----DRGSIEI---TLKNSPKVEGMPGVDSEADTIKITRELIKSKSKSR 143

Query: 243 YYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMK-----PKAEKESDDGLL 297
           Y +N +  S   +  L+    I LD+    + Q  VE  A++K      +  +  D  LL
Sbjct: 144 YMINDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLKSDKLLAETTRSIDAKLL 203

Query: 298 EYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEK 357
           + LE +      K L    +S   +L D+ ++K +   +V++EK S E  K  A + LE 
Sbjct: 204 DVLELL------KDLQAKEISSQREL-DLNKQKYDEL-LVQKEKLS-ESVK--AFKELES 252

Query: 358 EKTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKA 399
           +K+   L  +LL Y       KL   KEK+A  +  L   KA
Sbjct: 253 KKSELELHLQLLPY------AKLKDHKEKLADYKRDLDQAKA 288

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1296 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1353
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 1008 RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLL 1067

Query: 1354 -AQFIVIS 1360
              Q I+I+
Sbjct: 1068 RTQTIIIT 1075

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 14/98 (14%)

Query: 129 IDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG-K 186
           I +++L NF  +    V + P   + + +VG NGSGKS ++ +++   G +A++  +G  
Sbjct: 73  IRKVILRNFMCHENFSVELTP---NLNFIVGNNGSGKSAILTAIIVALGVKASETSRGSS 129

Query: 187 LSELIHKS------ELHPDLDSCHVDIF---FQYVQDE 215
           L ELI K        LH D +   +DI    F Y  D+
Sbjct: 130 LKELIRKGCNSSKVTLHLDNNKGDLDINGKDFAYKHDQ 167

 Score = 37.4 bits (85), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1296 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1342
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 129 IDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG 185
           I R+ L NF  +   ++  GP  N    +VG NGSGKS ++ ++  VFG +A+   +G
Sbjct: 62  IKRITLKNFMCHEHFELEFGPMLN---FIVGSNGSGKSAILTAITIVFGAKASDTNRG 116

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 1296 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1353
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I ++  +  
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTIGTKMIMKKLSSNI 1060

Query: 1354 -AQFIVIS 1360
              Q I+I+
Sbjct: 1061 RTQTIIIT 1068

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
            complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 1302 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1358
            SGGEK +S+   + +L  +   P  V+DEI+  +D RN  I+   + E       +Q+I+
Sbjct: 995  SGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIHRIMVENACEDNTSQYIL 1054

Query: 1359 IS 1360
            ++
Sbjct: 1055 VT 1056

 Score = 36.2 bits (82), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 4/44 (9%)

Query: 129 IDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSNVIDSL 171
           I ++ + NF +Y   +  + P   SF+ ++GPNGSGKS V+ +L
Sbjct: 51  IIKIKMKNFMTYGLVEYQLCP---SFNMIIGPNGSGKSTVVCAL 91

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 11/83 (13%)

Query: 1302 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1358
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1359 ISLRNNMFELAKQLVGVYKNKNM 1381
            I+         K L G++ ++ M
Sbjct: 1047 IT--------PKLLTGLHYHEKM 1061

 Score = 39.3 bits (90), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 131/288 (45%), Gaps = 35/288 (12%)

Query: 121 MGSIQRLCIDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRA 179
           + S Q   +  + L +F +Y  T+  + P   S + ++GPNGSGKS  + ++      + 
Sbjct: 34  LSSFQPGSVISVRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKP 90

Query: 180 NKM-RQGKLSELIHKSELHPDLDSCHVDIFFQY---VQDEPDGTTSIIQQKPSMVIRRKA 235
             + R  ++ + I   +     D   ++I  +    V D  +        K + +I R  
Sbjct: 91  EYIGRSKRVEDFIKNGQ-----DVSRIEITLKNSPKVNDIENVNAHDETIKITRIITRSK 145

Query: 236 FRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDG 295
            R   S Y +N  E S +++  L+    I LD+    + Q  VE  A++K      S   
Sbjct: 146 RR---SDYLINDCEVSESVVKALVAQLNIQLDNLCQFLSQERVEEFARLK------SVKL 196

Query: 296 LLEYLEDIIGTAQYKPLIENTLSEIAKL--NDICEEKE---NRFEIVE-REKSSLEQGKN 349
           L+E +  I  +      + + L E+ +L  N+ C +K+    + +I+  R++S   +   
Sbjct: 197 LVETIRSIDSS------LLDVLDELRELQGNEQCLQKDLDVKKSKILHLRQESDKLRKSV 250

Query: 350 EALEYLEKEKTLTILRSKLLQYHLWKN-EQKLNSTKEKIAKAQEKLSA 396
           E+L   +K+K    L S+LL Y   K+ ++KLN  KE+  +A+  L A
Sbjct: 251 ESLRDFQKKKGEIELHSRLLPYVKVKDHKEKLNVYKEEYERAKANLRA 298

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; binds single-stranded DNA and has ATPase
            activity; S. pombe homolog forms a heterodimer with S.
            pombe Rad18p that is involved in DNA repair
          Length = 1093

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 11/83 (13%)

Query: 1302 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1358
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1359 ISLRNNMFELAKQLVGVYKNKNM 1381
            I+         K L G++ ++ M
Sbjct: 1047 IT--------PKLLTGLHYHEKM 1061

 Score = 40.0 bits (92), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 83/181 (45%), Gaps = 18/181 (9%)

Query: 111 SQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSNVID 169
           S++ + ++  + S Q   I ++ L +F +Y  T+  + P   S + ++GPNGSGKS  + 
Sbjct: 24  SKRVKIAKPDLSSFQPGSIIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVC 80

Query: 170 SLLFVFGFRANKM-RQGKLSELIHK----SELHPDLDSCHVDIFFQYVQDEPDGTTSIIQ 224
           ++      +   + R  K+ + I      S++   L +       +Y+ D  D T  I  
Sbjct: 81  AVCLGLAGKPEYIGRSKKVEDFIKNGQDVSKIEITLKNSPNVTDIEYI-DARDETIKI-- 137

Query: 225 QKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQM 284
              + +I R   R   S Y +N  + S +++  L+    I LD+    + Q  VE  A++
Sbjct: 138 ---TRIITRSKRR---SDYLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARL 191

Query: 285 K 285
           K
Sbjct: 192 K 192

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 40.0 bits (92), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 45/87 (51%), Gaps = 7/87 (8%)

Query: 1280 FSEGVLFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1337
            FS+G L  ++  P     RN+  LSGGEK+ S  +L+ A  +   + +  +DE D  +D 
Sbjct: 984  FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRIIALDEFDVFMDQ 1043

Query: 1338 RNVSI----VANYIKERTKNAQFIVIS 1360
             N  I    + N + + T+  Q I+I+
Sbjct: 1044 VNRQIGTKLIMNKLSKETR-TQTIIIT 1069

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 91/230 (39%), Gaps = 34/230 (14%)

Query: 100 QLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQV-VGPFHNSFSAVVG 158
            L+PM  ++ +SQ   E+     +     I ++ L NF  +   ++ +GP  N    +VG
Sbjct: 43  HLAPM--TQWDSQSSSENIGNETTHPPGFIKKVQLRNFMCHEHFELELGPRLN---FIVG 97

Query: 159 PNGSGKSNVIDSLLFVFGFRANKMRQG-KLSELIHKSELHPDLDSCHVDIFFQYVQDEPD 217
            NGSGKS V+ ++    G +A    +G  L +LI         + C        + +E  
Sbjct: 98  NNGSGKSAVLTAITIGLGAKATDTNRGSSLKDLIR--------EGCQSSKISIVLNNEGF 149

Query: 218 GTTSIIQQKPSMVIRRKAFRNNTSKYYL---NGKESSYTIITQLLRDEGIDLDHKRFLIL 274
           G          + I R   RN  + + L   NGKE S               + KR L +
Sbjct: 150 GGYDQGTYGSEIRIERTIKRNGPATFSLKSENGKEVS---------------NKKRDLQV 194

Query: 275 QGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLN 324
             +  ++  M P     S D    +L     T +YK  +  TL E  ++N
Sbjct: 195 IVDYFAVPVMNPMCFL-SQDAARSFLTASTPTDKYKHFMRGTLLEDTEMN 243

>YNL225C Chr14 complement(222724..224469) [1746 bp, 581 aa] {ON}
           CNM67Component of the spindle pole body outer plaque;
           required for spindle orientation and mitotic nuclear
           migration
          Length = 581

 Score = 39.7 bits (91), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 67/129 (51%), Gaps = 9/129 (6%)

Query: 821 VQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIEL-DISKRKLDIDSLSSEMKA 879
           ++ + K+LS  +   + A DT+     AL  L D   + EL +I    L  D   SE  +
Sbjct: 230 IENLTKDLSLNKEMLEKANDTIQTKHTALLSLTDSLRKAELFEIPIGILFFDLYDSEENS 289

Query: 880 SEGRLEYLLQEKAQK------ESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQ 933
           S  +L+++LQEK          S  EELS    + K+ K+E  +L NE+++KK E++ ++
Sbjct: 290 S--KLDHILQEKYPNIKGFLCASQQEELSRISQRFKNAKAEAEDLRNELENKKIEIQTMR 347

Query: 934 EQIMKVGGT 942
           E+   + GT
Sbjct: 348 EKNNTLIGT 356

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 38.9 bits (89), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 5/63 (7%)

Query: 1299 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1358
            T LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R     F  
Sbjct: 600  TQLSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTT 654

Query: 1359 ISL 1361
            IS+
Sbjct: 655  ISI 657

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 110/260 (42%), Gaps = 40/260 (15%)

Query: 134 LHNFKSYAGTQVVGPFH--NSFSAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQGKLSEL 190
           L NF +Y+    +  FH   S + ++GPNGSGKS  + ++      +   + R  ++ + 
Sbjct: 51  LTNFVTYS----LAEFHMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRAKRVEDF 106

Query: 191 IHKSELHPDL-----DSCHVD-IFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYY 244
           I        +     +S +V  +     +DE     +++     M  RRK        YY
Sbjct: 107 IKNGTAESTIEIQLRNSRNVSGLPMISAEDEAINVRTVL-----MKARRKC------AYY 155

Query: 245 LNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKP-----KAEKESDDGLLEY 299
           +NG+  S   +  L+    I LD+    + Q  VE  A++K      +  +  D  LL  
Sbjct: 156 INGEPVSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLKADKLLEQTVRSVDASLLGL 215

Query: 300 LEDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEK 359
           LE  + T+Q + L          LN   E  + + E +   K SLE  +  ALE  E++K
Sbjct: 216 LEQ-LKTSQQEEL---------SLNREVELGQKKLEKLMTHKESLE-NQVRALEEYERKK 264

Query: 360 TLTILRSKLLQYHLWKNEQK 379
               +  +LL Y   KN ++
Sbjct: 265 EEIDIHKRLLPYVRVKNHKR 284

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 1302 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1358
            SGGE+ +S++  + AL  +   P  V+DEI+  +D R   IV   + E       +Q+ +
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENACAENTSQYFL 1051

Query: 1359 IS 1360
            I+
Sbjct: 1052 IT 1053

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 131 RLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG 185
           R+ L NF  +   ++  GP     + +VG NGSGKS ++ ++  VFG +A+   +G
Sbjct: 64  RITLKNFMCHEHFELEFGP---RLNFIVGSNGSGKSAILTAITVVFGAKASDTNRG 116

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1296 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1347
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

>YLR440C Chr12 complement(1015568..1017697) [2130 bp, 709 aa] {ON}
            SEC39Component of the Dsl1p tethering complex that
            interacts with ER SNAREs Sec20p and Use1p; proposed to be
            involved in protein secretion; localizes to the ER and
            nuclear envelope
          Length = 709

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 57/111 (51%), Gaps = 15/111 (13%)

Query: 1006 NLDSSSKKVDELSESINKLKDELELTEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDK 1065
            NL S + K+DEL   ++   DE+ + E++   A        +E + F    I+C  +   
Sbjct: 290  NLSSLTHKLDELWSILSGFPDEITIEEQKTITA--------LEMKQFMEFFIKCSTKF-S 340

Query: 1066 LKELFAILNKEAAEFLHSLNSL------KIRDVTATLQALDESLENESKNE 1110
             KE+FAI  +E +  L   +SL      K  ++++ LQA+ E++ + SK++
Sbjct: 341  FKEIFAITQEEESAQLAHFSSLCHEEFNKANEISSFLQAMYETVLDISKDD 391

>Suva_5.108 Chr5 (163870..164901) [1032 bp, 343 aa] {ON} YER016W
            (REAL)
          Length = 343

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 53/118 (44%), Gaps = 18/118 (15%)

Query: 1102 SLENESKNEVAAETPGEEDGEHSSSLHDPMDVDENQGESTSTTEAQLQAGEAERRNTEES 1161
            SL   + N +    PG     HSS       +  N G  TS T+ QL A +AE  N +E+
Sbjct: 147  SLSTGTNNTI----PGGPPIRHSS-------LGVNTGRKTSATQGQLNAVQAELSNAQET 195

Query: 1162 LPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVD 1219
            + +     L +E+E ++     LEI   +++  N   DIEIL    + LI     K D
Sbjct: 196  IGS-----LNEEIEQYKGTVSTLEIE--REFYFNKLRDIEILVHTTQDLINEGVYKFD 246

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1111

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1296 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1342
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTI 1056

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1102

 Score = 36.2 bits (82), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1296 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1353
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1354 -AQFIVIS 1360
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 9/76 (11%)

Query: 122 GSIQR----LCIDRLVLHNFKSYAGTQV-VGPFHNSFSAVVGPNGSGKSNVIDSLLFVFG 176
           GSIQ       + +++L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G
Sbjct: 61  GSIQEESPSGSLKKVILRNFMCHENFEMELGP---RLNFIVGNNGSGKSAILTAIAVGLG 117

Query: 177 FRANKMRQG-KLSELI 191
            +A++  +G  L +LI
Sbjct: 118 VKASETNRGVSLKDLI 133

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 36.2 bits (82), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 9/71 (12%)

Query: 1324 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAKQLVG 1374
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1375 VYKNKNMTKSV 1385
              K  +  KS 
Sbjct: 999  FIKKVDSCKSC 1009

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%)

Query: 1290 PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1347
            P  +  RN+   SGGEK+ S ++L+ A  +   + +  +DE D  +D  N  I    I
Sbjct: 996  PNDEKPRNVDTFSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRQIGTKLI 1053

>NDAI0K01100 Chr11 complement(256280..258946) [2667 bp, 888 aa] {ON}
            Anc_8.704 YPL174C
          Length = 888

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 48/84 (57%), Gaps = 7/84 (8%)

Query: 985  QAEQLAEEL-KSCSQEKSLIENNLDSSSKKVDELSESINKLKDELELTEERVRKAEESID 1043
            Q   L  E+ K  S+E + ++++L+S SK    L + ++ L++ LE  EER+ + E  I 
Sbjct: 313  QVNSLTHEIEKLSSKENTTLDDHLNSESK----LQQQLDTLQNLLESKEERIHQLENVIK 368

Query: 1044 EKTVEGRDFEALEIQCVAQLDKLK 1067
            E  VEGRD E   ++   QL KL+
Sbjct: 369  EIDVEGRDQEQKHLK--MQLTKLR 390

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
            Ashbya gossypii AFR683C
          Length = 683

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 58/98 (59%), Gaps = 7/98 (7%)

Query: 1299 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF-I 1357
            T LSGG+K   ++A  F L    P+ L ++DE  +ALD ++  I+A  ++ R+++ +  I
Sbjct: 567  TQLSGGQKQRIAIARAFIL---DPSIL-ILDEATSALDSQSEDIIAQALRARSESGKITI 622

Query: 1358 VISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLIDR 1395
             I+ R +  E + +++ + +N  ++++ A    DLI++
Sbjct: 623  SIAHRISTIEHSNRVIVLSRNGGVSETGAF--CDLINQ 658

>KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {ON}
            Anc_4.238 YDL058W
          Length = 2220

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 88/160 (55%), Gaps = 17/160 (10%)

Query: 783  LDGKLIDLSGTMSGGGNFKARGMMKSEQQSNSAFTAEEVQQIDKELSEREHNFQIAADTL 842
            L+G++ D  GT+      +  G++KS +++        +Q++   + +RE N Q    ++
Sbjct: 1135 LNGRIADYEGTIE-----ELNGIIKSHEET--------IQELSSSIDDREKNIQKLNTSI 1181

Query: 843  HEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASE---GRLEYLLQEKAQKESSNE 899
            +E+   + +LK+   E+E  +S+ +  +  L+ +++ S+      E  +++  QK SS+E
Sbjct: 1182 NELNSEIVELKETNQELEECVSRHEKTVTELNEKIEKSDPIISSYEAEIKDLKQKISSSE 1241

Query: 900  E-LSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIMK 938
            + +++ E+K K L+ +   LE E+++ K + +  ++ I++
Sbjct: 1242 DKITSQELKYKELQEKVTLLEKEIETFKTKREDFEKTILQ 1281

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 1280 FSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1339
            F EGV   V P        T LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVNTLVGPRG------TQLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1340 VSIVANYIKERT 1351
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>NCAS0B06660 Chr2 (1263611..1264717) [1107 bp, 368 aa] {ON}
           Anc_2.207 YNL084C
          Length = 368

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 44/81 (54%), Gaps = 6/81 (7%)

Query: 862 DISKRKLDIDSLSSE-----MKASEGRLEYLL-QEKAQKESSNEELSTAEVKLKSLKSEY 915
           D SK+  D+ S+ SE      +  EG LEYLL Q  +   +S  ++      L +++ + 
Sbjct: 283 DSSKKSTDLSSIPSEKLDLIREQYEGLLEYLLNQASSPANNSPVDVRVVTEDLDNIEQQV 342

Query: 916 RELENEMQSKKKEMKVLQEQI 936
             LE  +Q+KK+E++ L E+I
Sbjct: 343 NGLETYLQNKKQELQSLNEEI 363

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa] {ON}
            similar to uniprot|P33310 Saccharomyces cerevisiae
            YLR188W MDL1 Half-type ATP-binding cassette (ABC)
            transporter of the inner mitochondrial membrane mediates
            export of peptides generated upon proteolysis of
            mitochondrial proteins plays a role in the regulation of
            cellular resistance to oxidative stress
          Length = 714

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 51/96 (53%), Gaps = 7/96 (7%)

Query: 1301 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA-QFIVI 1359
            LSGG+K   +LA  F L       L V+DE  +ALD ++  IVA  ++ER +     I I
Sbjct: 590  LSGGQKQRVALARAFLLDP----ALLVLDEATSALDSQSEEIVARTLQERVRRGLTTISI 645

Query: 1360 SLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLIDR 1395
            + R +    + ++V + ++  + +S   Q  +LIDR
Sbjct: 646  AHRISTIAHSTRVVVLGRDGFVVESGPFQ--ELIDR 679

>Skud_2.142 Chr2 complement(266032..267405) [1374 bp, 457 aa] {ON}
            YBR029C (REAL)
          Length = 457

 Score = 33.1 bits (74), Expect = 4.9,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 992  ELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDE--LELTEERVRKAEES 1041
            E+K     K ++E+  D++SK +D+L E +NK   E    +T+E    A+ES
Sbjct: 6    EIKPHGTSKEVVESVTDATSKAIDKLQEELNKDASESATPVTKENTAAAKES 57

>TDEL0A04410 Chr1 (780072..789851) [9780 bp, 3259 aa] {ON} Anc_5.576
            YDR457W
          Length = 3259

 Score = 33.5 bits (75), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 55/109 (50%), Gaps = 29/109 (26%)

Query: 1175 ENFEVETVELEIHQLQDYVENAYADIEILE----EYARRLIEYKARKVDLNHAVQERDKV 1230
            E F VET +   H++ D +EN   ++ + E    +Y ++++EYK     L+ +V+E    
Sbjct: 3057 ETFSVETDDYGEHKIIDLIENG-KNVPVTEQNKQDYVKKIVEYK-----LHISVKE---- 3106

Query: 1231 RQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDP 1279
                      ++D F++GF A+  I     ++I++    ELEL+ S  P
Sbjct: 3107 ----------QMDNFLQGFYALIPI-----ELISIFDEQELELLVSGLP 3140

>Ecym_8163 Chr8 (337211..341221) [4011 bp, 1336 aa] {ON} similar to
            Ashbya gossypii ADR294C
          Length = 1336

 Score = 32.7 bits (73), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 716  LLDKLRNFNLSPIKTPENVPRLYDLVRP-NNP 746
            ++DK +NFN+S I   EN  R Y  +RP NNP
Sbjct: 1041 IMDKQKNFNISDIPLFENGSRSYSYMRPLNNP 1072

>SAKL0G06094g Chr7 (498322..508107) [9786 bp, 3261 aa] {ON} similar to
            uniprot|Q7LIK7 Saccharomyces cerevisiae YDR457W TOM1
            Temperature dependent Organization in Mitotic nucleus
          Length = 3261

 Score = 32.7 bits (73), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 61/122 (50%), Gaps = 32/122 (26%)

Query: 1162 LPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEE----YARRLIEYKARK 1217
            L N +  ++E   E F VET +   H+  D +EN + ++ + EE    Y ++++EYK   
Sbjct: 3049 LENDITDIIE---ETFSVETDDYGEHKTIDLIENGH-NVPVTEENKQDYVKKIVEYK--- 3101

Query: 1218 VDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSL 1277
              L+ +V              K ++D F++GF AI  I K+   +I++    ELEL+ S 
Sbjct: 3102 --LHTSV--------------KDQIDNFLQGFYAI--IPKD---LISIFDEQELELLISG 3140

Query: 1278 DP 1279
             P
Sbjct: 3141 LP 3142

>TBLA0H00970 Chr8 (209566..212175) [2610 bp, 869 aa] {ON} Anc_8.384
           YLR166C
          Length = 869

 Score = 32.3 bits (72), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 37/82 (45%), Gaps = 20/82 (24%)

Query: 187 LSELIHKSELHPD------LDSCHVDIFFQYVQD-------EPDGTTSIIQQKPSMV--- 230
           LSE     EL+ D      LD C+ D+F +Y+ D       E     +I+ +K S     
Sbjct: 397 LSEYFQALELNSDNNLSSTLDQCYSDLFSKYLFDRSNYFDIEKRSLEAILIEKTSNFSLK 456

Query: 231 ----IRRKAFRNNTSKYYLNGK 248
               +R KA  NN +  YLNG+
Sbjct: 457 HEKEVRSKALLNNFNNKYLNGR 478

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 135,769,751
Number of extensions: 6113684
Number of successful extensions: 44614
Number of sequences better than 10.0: 1929
Number of HSP's gapped: 40723
Number of HSP's successfully gapped: 3739
Length of query: 1396
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1274
Effective length of database: 39,492,147
Effective search space: 50312995278
Effective search space used: 50312995278
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 72 (32.3 bits)