Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.238048.261ON57857828190.0
KLTH0G13706g8.261ON58458321570.0
SAKL0H17050g8.261ON58457917820.0
AGR087C8.261ON57758017360.0
TDEL0F038808.261ON57957916900.0
Ecym_43098.261ON57756416750.0
YLR088W (GAA1)8.261ON61461716530.0
KLLA0F19118g8.261ON57857116430.0
Skud_12.1568.261ON61261516260.0
Smik_12.1478.261ON61361616160.0
Suva_10.1728.261ON61461716060.0
NCAS0B038608.261ON58358115990.0
TBLA0F030808.261ON58357215780.0
Kpol_543.378.261ON57857815700.0
ZYRO0C01672g8.261ON56956315290.0
KNAG0H032508.261ON58558915050.0
NDAI0J013908.261ON58357214900.0
CAGL0L12232g8.261ON59159214880.0
KAFR0B055508.261ON55554914140.0
TPHA0A018208.261ON58158813980.0
ZYRO0D08492g6.329ON584116820.24
CAGL0J02002g7.133ON361137751.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23804
         (578 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...  1090   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   835   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   691   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   673   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   655   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   649   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...   641   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   637   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...   630   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...   627   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...   623   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   620   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   612   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   609   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   593   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   584   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   578   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   577   0.0  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   549   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   543   0.0  
ZYRO0D08492g Chr4 complement(733481..735235) [1755 bp, 584 aa] {...    36   0.24 
CAGL0J02002g Chr10 (200829..201914) [1086 bp, 361 aa] {ON} simil...    33   1.6  

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score = 1090 bits (2819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/578 (92%), Positives = 535/578 (92%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120
           PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120

Query: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180
           LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD
Sbjct: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180

Query: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240
           DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN
Sbjct: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300
           VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR
Sbjct: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300

Query: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL
Sbjct: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 361 PXXXXXXXXXXXXXLDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420
           P             LDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP
Sbjct: 361 PAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420

Query: 421 VILISWSVMTALAPILLNRVRIQSSYAHRLKXXXXXXXXXXXXXXXXXNFALAFGIGLLA 480
           VILISWSVMTALAPILLNRVRIQSSYAHRLK                 NFALAFGIGLLA
Sbjct: 421 VILISWSVMTALAPILLNRVRIQSSYAHRLKAVAYLYLSVVLTSLLVVNFALAFGIGLLA 480

Query: 481 FPLILVKNSTTPRXXXXXXXXXXXXXPFISTCLFAYFFEPLLPGLQILEQLVQAWNEFGC 540
           FPLILVKNSTTPR             PFISTCLFAYFFEPLLPGLQILEQLVQAWNEFGC
Sbjct: 481 FPLILVKNSTTPRLLFKNSLLLLLSNPFISTCLFAYFFEPLLPGLQILEQLVQAWNEFGC 540

Query: 541 WTWCVVCIGWLPSWLLIAYSSMITDVSTLLNSAEKKSS 578
           WTWCVVCIGWLPSWLLIAYSSMITDVSTLLNSAEKKSS
Sbjct: 541 WTWCVVCIGWLPSWLLIAYSSMITDVSTLLNSAEKKSS 578

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/583 (69%), Positives = 463/583 (79%), Gaps = 6/583 (1%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           MALIE+LQR++IDLGLLPRIVRFLPKLS+LCGI+GI W+TLLLPLEGQYRHTYISENALM
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120
           PSQAYSYFRETEWNILRGYRTQIQ LE KSS ERNE++ SW QEFG KTA YED+  GNT
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120

Query: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180
           +YGVLHAPRGDGTEAMVL+APW+NGDGE+N GG AL  AL+R+FSRWPVWSKNII+VFSD
Sbjct: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180

Query: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240
           DP+ASLRSWV AYHTSLDLTGGSIESAVVLDYPG NDFFKYVEIYYAGLNGELPNLDLVN
Sbjct: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300
           VA+H+TEHEGMKVSLNG+ E+EM+ R+YF++MKTM+VG+KKMALSGVQ CYGNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGWR 300

Query: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQA+VLRARG  GPFDITTFGR+PEA FRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL
Sbjct: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 361 PXXXXXXXXXXXXXLDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420
           P             LD VL  GAS + +  + N++AV+GFTVALL SF +S+ F+ + + 
Sbjct: 361 PAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSHWQYS 420

Query: 421 VILISWSVMTALAPILLNRVRIQSSYAHRLKXXXXXXXXXXXXXXXXXNFALAFGIGLLA 480
            +LIS + + A+ P +  R  I++S++++ K                 NFALAFGIGLLA
Sbjct: 421 SLLISCNAVIAVLPAIFGRQGIEASHSYQFKSVAFLYLSVVLTSLLVINFALAFGIGLLA 480

Query: 481 FPLILVKNSTTPRXXXXXXXXXXXXXPFISTCLFAYFFEPLLPGLQILEQLVQAWNEFGC 540
           FPLILVK   T R             PFIST LF   FEP L GLQ+  +LVQAW + GC
Sbjct: 481 FPLILVKAPMTSRQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKLGC 540

Query: 541 WTWCVVCIGWLPSWLLIAYSSM------ITDVSTLLNSAEKKS 577
           WTW VVCIGWLPSWLL+A S +      +   S  L S+ KK+
Sbjct: 541 WTWSVVCIGWLPSWLLVACSGIPMPYQPVGGPSQRLGSSTKKT 583

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/579 (56%), Positives = 424/579 (73%), Gaps = 2/579 (0%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           MAL+E+L R+ ID+GLLP+ +  LP LS+ C ++G+ W+ L +P +GQ+R TYISENALM
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120
           PSQAYSYFRETEWN+LRGYRTQI+  +  S+ ERNE + SWLQ+FG KTA+Y +E  G T
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120

Query: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180
           LYG+LHAPRGDGTEAMVL+APW+N + ++N GG AL V+L+R+FSRWPVWSKNII+V S+
Sbjct: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180

Query: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240
           DP+A+LRSWV+AYHTSLDLTGGSIE+AVV+D+PG NDFFKYVEI++ GLNGELPNLDLVN
Sbjct: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240

Query: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300
           VA+H+TEHEGMKVSL+GI E+E+   D+F+RMKT+++G+K MALSG+++ +GNE FSGWR
Sbjct: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300

Query: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           I +V L+A G  GPFDITTFGR+PEA+FRSVNNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360

Query: 361 PXXXXXXXXXXXXXLDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420
           P             L+ +L    ++       N+ A++GF VAL  SF  +  F     P
Sbjct: 361 PAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420

Query: 421 VILISWSVMTALAPILLNRVRIQSSYAHRLKXXXXXXXXXXXXXXXXXNFALAFGIGLLA 480
            +L+S +V+  L PI+  RV+I++ +++RLK                 NF+LAFG+G LA
Sbjct: 421 ELLLSLNVLLLLMPIIFTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCLA 480

Query: 481 FPLILVKNST-TPRXXXXXXXXXXXXXPFISTCLFAYFFEPLLPGLQILEQLVQAWNEFG 539
           FP+ LV+ ++   R             PFI+  LFA   +  L G+Q+   L  AW + G
Sbjct: 481 FPMTLVRTTSGNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDLG 540

Query: 540 CWTWCVVCIGWLPSWLLIAYSSMITDVSTLLNSAEKKSS 578
           CWTW V+CIGWLPSWLL+AYS  I  VS ++   EK  S
Sbjct: 541 CWTWFVICIGWLPSWLLVAYSG-IDSVSIVVPQDEKTES 578

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/580 (55%), Positives = 414/580 (71%), Gaps = 5/580 (0%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           MA++E+L RKV+D+GL+P+I+  L K+S +  ++ + W+TL LP+EGQYR TYISENALM
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120
           PSQAYSYFRE+EWNILRGYR++I  +   ++ ERN I+ SW++E+G K A+Y D+  G T
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120

Query: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180
           LY VLHA RGDGTEAMVL+APW   +G++N GG AL VA+ RYFSRWPVWSKNII+V S+
Sbjct: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180

Query: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240
           DP ASLRSWVQAYHT LDLTGGSIE+A+VLDYPG ND+F++VEI Y GLNG +PNLDL+N
Sbjct: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240

Query: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300
           VA+H+TEHEGMKV+L+G P +E+    YF+RM+ ++ GIK MALSG++R  GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300

Query: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQ+V L+ARG +G FDITTFGRVPEA+FRSVNNLLEKFHQSFFFYLLLAPRYFVSI SYL
Sbjct: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360

Query: 361 PXXXXXXXXXXXXXLDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420
           P              D+VL    ++     + NI A++ F+VALL S   +  F     P
Sbjct: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLPAP 420

Query: 421 VILISWSVMTALAPILLNRVRIQSSYAHRLKXXXXXXXXXXXXXXXXXNFALAFGIGLLA 480
            +L++++V+ +  P  L + +IQ  ++HR K                 NF LAF +GLLA
Sbjct: 421 ALLLAFNVVVSFMPFALVKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLLA 480

Query: 481 FPLILVKNS--TTPRXXXXXXXXXXXXXPFISTCLFAYFFEPLLPGLQILEQLVQAWNEF 538
           FP+  V+ +   + R             PFIS C+F + FEP L G  +   L+ AWN+ 
Sbjct: 481 FPMTFVRTTVHASVRQKMKNSLLLLLSNPFISICVFVHLFEPELTGFSVFYSLIDAWNDL 540

Query: 539 GCWTWCVVCIGWLPSWLLIAYSSMITDVSTLLNSAEKKSS 578
           GCWTW V+C+GW P+W+++AYSS+    S  + +  KKSS
Sbjct: 541 GCWTWYVLCLGWYPAWIMVAYSSID---SVPIAAPAKKSS 577

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/579 (55%), Positives = 411/579 (70%), Gaps = 6/579 (1%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           M+LI +L R+VIDLGL+P+IV  LP LS+L  ++ + W+ LL PLEG+YR TYISENAL+
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALL-PLEGRYRRTYISENALL 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120
           PSQAYSYFRETEWN LRGYRTQI+ L N +S ERNE +  WL+EFGVKTA+Y+DE  G+T
Sbjct: 60  PSQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDT 119

Query: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180
           LYGVLHA RGDGTEA++L+APW N DG  N  G ++ +AL R+FSRWPVWSKNIIVV S+
Sbjct: 120 LYGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSE 179

Query: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240
           +PK S+RSWV+AYHTSLDLTGGSIE+AVVLDYPGVND+F +VEI+Y GLNGE PNLDLVN
Sbjct: 180 NPKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVN 239

Query: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300
           +AI +TEHEGMKVSL+G+  D++ + D+++R+  M+ GIK  ALSG+++  GNEAFSGWR
Sbjct: 240 IAISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWR 299

Query: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQAV L+A G  G  D+TTFGR+PEA+FRS+NNLLEKFHQSFFFY+LLAPRYFVSI+SYL
Sbjct: 300 IQAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYL 359

Query: 361 PXXXXXXXXXXXXXLDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420
           P             LD ++             N+ ++  + ++LL  F ++  F RF  P
Sbjct: 360 PCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAP 419

Query: 421 VILISWSVMTALAPILLNRVRIQSSYAHRLKXXXXXXXXXXXXXXXXXNFALAFGIGLLA 480
            ILIS+S + +  P+LL + +I    A+RLK                 NF LAF +GL A
Sbjct: 420 TILISFSALISFLPLLLKK-KIAEPLAYRLKSVAFLFFSLVLTSLLMVNFFLAFAMGLTA 478

Query: 481 FPLILVKNST----TPRXXXXXXXXXXXXXPFISTCLFAYFFEPLLPGLQILEQLVQAWN 536
           FP+ LV+ S+    + R             PFI++ +F   FEP LPG  +  +   AW 
Sbjct: 479 FPMTLVRTSSLNNYSLRIKLKNSILLLLSNPFIASYIFCQCFEPDLPGFTVFTEFATAWK 538

Query: 537 EFGCWTWCVVCIGWLPSWLLIAYSSMITDVSTLLNSAEK 575
           E GCWTW V+CIGWLPSWL++A S++ T  + L +  +K
Sbjct: 539 ELGCWTWFVICIGWLPSWLMVALSTLNTQPAQLDDRKKK 577

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/564 (53%), Positives = 396/564 (70%), Gaps = 2/564 (0%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           MA++E+L R+++D+GL+PRI+  LPK+S+ C ++ I W+TL LPLEGQYR TYISENALM
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120
           PSQAYSYFRE+EWNILRGYR +++ L++    ERN I+ SW++E+G KT++  +   G T
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120

Query: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180
           LYG++H  RGDGTEAMVL+APW   DG +N GG AL ++LARYF+RWPVWSKNIIVV S 
Sbjct: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180

Query: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240
           DP+ASLR+WV+AYHT LDLTGGSIESAVVLDYPG ND+FKY+EI Y GLNG LPNLDL+N
Sbjct: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLIN 240

Query: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300
            A+H++EHEGMKVSL+G+P  E+    Y  R+KT++ GIK M L+G++   G+EAF+GWR
Sbjct: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300

Query: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQ+V L+A G  GPFD+TTFGRVPEA+FRSVNNLLEKFHQSFFFYLLL+PR FVSI SYL
Sbjct: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYL 360

Query: 361 PXXXXXXXXXXXXXLDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420
           P              D++L    S      + NI A+  F VAL+ SF  +  FA    P
Sbjct: 361 PAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420

Query: 421 VILISWSVMTALAPILLNRVRIQSSYAHRLKXXXXXXXXXXXXXXXXXNFALAFGIGLLA 480
            +L++++V  +     + + +IQ  +++R K                 NFALA  +G+LA
Sbjct: 421 SLLLAFNVALSFISFTVIKYKIQKPFSYRFKAFAHLYFSIVLTSLLVVNFALALAVGVLA 480

Query: 481 FPLILVKNST--TPRXXXXXXXXXXXXXPFISTCLFAYFFEPLLPGLQILEQLVQAWNEF 538
           FP+ L K +T  T +             PFI++ +    FE  L G  +   L+ AW + 
Sbjct: 481 FPMSLTKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQL 540

Query: 539 GCWTWCVVCIGWLPSWLLIAYSSM 562
           GCWTW V+CIGW PSW+L+AYSS+
Sbjct: 541 GCWTWYVLCIGWYPSWILVAYSSI 564

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/617 (52%), Positives = 416/617 (67%), Gaps = 43/617 (6%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           MAL+E+L R+++D+GL+PRI+  LP +S+LC + G F    +LP++GQYR TYISENALM
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFG-FISIAILPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120
           PSQAYSYFRE+EWNILRGYR+QI+ + N +S+ERN ++GSWLQEFG KTA+YE+E  G T
Sbjct: 60  PSQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGET 119

Query: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180
           LYGV+HAPRGDGTEAMVL+ PWFN D EFN GG AL V+LAR+FSRWPVWSKNIIVVFS+
Sbjct: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSE 179

Query: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240
           +P+A+LRSWV+AYHTSLDLTGGSIE+AVVLDY    DFF+YVEI Y GLNGELPNLDLVN
Sbjct: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300
           +AI +TEHEGMKVSL+G+P D++ N ++++R+K + +GI+  ALSGV++ +GNEAFSGWR
Sbjct: 240 IAISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWR 299

Query: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQ+V L+A G+ G  DITTFGR+PEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 300 IQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PXXXXXXXXXXXXXLDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420
           P             L+  +    +        N+ A++ + V+L+ SF VS  F      
Sbjct: 359 PSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSS 418

Query: 421 VILISWSVMTALAPILLNR-VRIQSSYAHRLKXXXXXXXXXXXXXXXXXNFALAFGIGLL 479
            +L++ S+ +   P++L+R + I    ++RLK                 NFA+A  IG L
Sbjct: 419 GLLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478

Query: 480 AFPLILVKN---------------------------------STTP------RXXXXXXX 500
           AFP+  VK                                   TTP      +       
Sbjct: 479 AFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNLV 538

Query: 501 XXXXXXPFISTCLFAYFFEPLLPGLQILEQLVQAWNEFGCWTWCVVCIGWLPSWLLIAYS 560
                 PFIS  LF  FF+    G  I+ +LV AW +  CW+W V+CIGWLP WLLI  S
Sbjct: 539 LLILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILAS 598

Query: 561 SMITDVSTLLNSAEKKS 577
           S  +  S ++ S EK+S
Sbjct: 599 SFESK-SVVVRSKEKQS 614

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/571 (53%), Positives = 402/571 (70%), Gaps = 14/571 (2%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           MAL+E+L R++I +GL+P+ +  L +LS+LC +IG+ W+  +LP +GQ+R TYISENAL+
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSL-ERNEILGSWLQEFGVKTALYEDESCGN 119
           PSQAYSYFRE+EWNILRGYRTQ+   +  S+  + N  +  WLQEFGVKTA+Y+DE  G 
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 120 TLYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFS 179
           TLYG+ HAPRGDGTEAMV++APW+N + E+N GG AL ++L R+FSRWPVWSKNII+V S
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 180 DDPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLV 239
           +DPKASLRSWV AYHTSLDLTGGSIESA+VLDYPG +D F Y+EI+Y GLNGE PNLDLV
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 240 NVAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGW 299
           NVA+H+ EHEG+KVSL+G+P  E+   DY +R+KTM++GIK   LSG++ CYGNEAFSGW
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 300 RIQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASY 359
           RIQ++ L+A+G  GP DITTFGRVPEA+ RSVNNLLEKFHQSFFFYLLLAPRYF+SI +Y
Sbjct: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360

Query: 360 LPXXXXXXXXXXXXXLDNVLCQGASTSQSGILP-----NIAAVVGFTVALLFSFTVSVTF 414
           L              L+ +L      ++ G LP     NI +++ F ++L+F+F  S  F
Sbjct: 361 LATAVAVSVAFVFAALNQIL-----NNKYGELPLLSIYNIWSILTFCISLVFAFATSQLF 415

Query: 415 ARFHHPVILISWSVMTALAPIL-LNRVRIQSSYAHRLKXXXXXXXXXXXXXXXXXNFALA 473
             F  P +L+  S + ++ P+L   R+RIQ  +++R K                 NF+LA
Sbjct: 416 VYFPLPRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLA 475

Query: 474 FGIGLLAFPLILVKN--STTPRXXXXXXXXXXXXXPFISTCLFAYFFEPLLPGLQILEQL 531
             +GLLAFP+        +  R             PFI+T     F EP L G ++   L
Sbjct: 476 IVMGLLAFPMTRTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYAL 535

Query: 532 VQAWNEFGCWTWCVVCIGWLPSWLLIAYSSM 562
           ++A  + GCWTW ++C+GW PSWLL+ Y+S+
Sbjct: 536 IEASQQLGCWTWYIICLGWYPSWLLVTYASI 566

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/615 (52%), Positives = 412/615 (66%), Gaps = 41/615 (6%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           MAL+E+L R+++D+GL+PRI+  LP +S LC + G F    +LP++GQYR TYISENALM
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFG-FISIAILPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120
           PSQAYSYFRE+EWN+LRGYR+QI+ +EN +S ERN  +GSWLQEFG KTA+YE +  G T
Sbjct: 60  PSQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGET 119

Query: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180
           LYGV+HAPRGDGTEAMVL+ PWFN D EFN GG AL V+LAR+FSRWPVWSKNIIVVFS+
Sbjct: 120 LYGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSE 179

Query: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240
           +P+A+LRSWV+AYHTSLDLTGGSIE+AVVLDY    DFF+YVEI Y GLNGELPNLDLVN
Sbjct: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300
           +AI +TEHEGMKVSL+G+P D++ N D+++R+K + +GI+  ALSGV+  +GNEAFSGWR
Sbjct: 240 IAISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWR 299

Query: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQ+V L+A G HG  DITTFGR+PEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 300 IQSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PXXXXXXXXXXXXXLDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420
           P             L+  +    ++       N+ A++ + ++L+ SF +S  F      
Sbjct: 359 PSAVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSV 418

Query: 421 VILISWSVMTALAPILLN-RVRIQSSYAHRLKXXXXXXXXXXXXXXXXXNFALAFGIGLL 479
            +L++ S+ T   P++L+ +V I    ++RLK                 NFA+A  IG L
Sbjct: 419 GLLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSL 478

Query: 480 AFPL-----ILVKNST--------------------------------TPRXXXXXXXXX 502
           AFP+     I+V  ST                                  R         
Sbjct: 479 AFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEKAKKRQQLKNLLLL 538

Query: 503 XXXXPFISTCLFAYFFEPLLPGLQILEQLVQAWNEFGCWTWCVVCIGWLPSWLLIAYSSM 562
               PFIS  LFA  F+    G  I+ +L+ AW +  CW W V+CIGWLP WLLI  SS 
Sbjct: 539 VLTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSF 598

Query: 563 ITDVSTLLNSAEKKS 577
            +  S ++ S EK+S
Sbjct: 599 ESR-SVVVKSKEKQS 612

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/616 (51%), Positives = 414/616 (67%), Gaps = 42/616 (6%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           MAL+E+L R+++D+GL+PRI+  LP +S++C + G F    +LP++GQYR TYISENALM
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFG-FISIAILPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120
           PSQAYSYFRE+EWNILRGYR+QI+ + N +S+ERN I+GSWLQEFG KTA+YE+E  G T
Sbjct: 60  PSQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGET 119

Query: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180
           LYGV+HAPRGDGTEAMVL+ PWFN D +FN GG AL V+LAR+FSRWPVWSKNII+VFS+
Sbjct: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSE 179

Query: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240
           +P A+LRSWV+AYHTSLDLTGGSIE+AVV+DY    DFF+YVEI Y GLNGELPNLDLVN
Sbjct: 180 NPCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300
           VAI +TEHEGMKVSL+G+P D++   +Y++R+K + +GI+  AL+GV+  +GNEAFSGWR
Sbjct: 240 VAISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWR 299

Query: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQ+V L+A G+ G  DITTFGR+PEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 300 IQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PXXXXXXXXXXXXXLDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420
           P             L+  +    ++       N+ A++ + ++L+ SF VS  F      
Sbjct: 359 PSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSA 418

Query: 421 VILISWSVMTALAPILLN-RVRIQSSYAHRLKXXXXXXXXXXXXXXXXXNFALAFGIGLL 479
            +L++ S+++   P++L+ +V I    ++RLK                 NFA+A  IG L
Sbjct: 419 GLLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTL 478

Query: 480 AFPLILVKN------------------STTP--------------------RXXXXXXXX 501
           AFP+ LVK                    T P                    R        
Sbjct: 479 AFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQELKNLLL 538

Query: 502 XXXXXPFISTCLFAYFFEPLLPGLQILEQLVQAWNEFGCWTWCVVCIGWLPSWLLIAYSS 561
                PFIS  +F  FF+    G  ++ +LV AW +  CW+W V+CIGWLP WLL+  SS
Sbjct: 539 LVLTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASS 598

Query: 562 MITDVSTLLNSAEKKS 577
             +    +L S EK+S
Sbjct: 599 FESK-RVMLKSKEKQS 613

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/617 (51%), Positives = 407/617 (65%), Gaps = 43/617 (6%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           MAL+E+L R+V+D+GL+PR++  LP +S LC + G F    +LP++GQYR TYISENALM
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFG-FISIAILPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120
           PSQAYSYFRETEWNILRGYR+QI+   N +S ERN ++GSWLQEFG KTA+YE+E  G T
Sbjct: 60  PSQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGET 119

Query: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180
           LYGV+HAPRGDGTEAMVL+ PWFN + EFN GG +L V+LAR+FSRWPVWSKNIIVVFS+
Sbjct: 120 LYGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSE 179

Query: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240
           +P A+LRSWV+AYHTSLDLTGGSIE+AVVLDY    DFF+YVE+ Y GLNGELPNLDLVN
Sbjct: 180 NPHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVN 239

Query: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300
           VAI + EHEGMKVSL+G+P +++ + D+F+R+K + +GI+  ALSGV+  +GNEAFSGWR
Sbjct: 240 VAISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWR 299

Query: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQ+V L+A G HG  DITTFGR+PEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 300 IQSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PXXXXXXXXXXXXXLDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420
           P             L+  +    ++       N+ AV+ + +A++ SF +S  F      
Sbjct: 359 PSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPA 418

Query: 421 VILISWSVMTALAPILLN-RVRIQSSYAHRLKXXXXXXXXXXXXXXXXXNFALAFGIGLL 479
            +L++ S+     PI L+ +V I    ++RLK                 NFA+A  IG L
Sbjct: 419 GLLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478

Query: 480 AFPLILVKN-------------------STTP--------------------RXXXXXXX 500
           AFP+  +K                     T P                    R       
Sbjct: 479 AFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKNQQRQKLKNLL 538

Query: 501 XXXXXXPFISTCLFAYFFEPLLPGLQILEQLVQAWNEFGCWTWCVVCIGWLPSWLLIAYS 560
                 PFIS  +F   F+    G  I+ +LV AW +  CW+W ++C+GWLP WLLI  S
Sbjct: 539 LLILTNPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILAS 598

Query: 561 SMITDVSTLLNSAEKKS 577
           S  +  S ++ S EK+S
Sbjct: 599 SFESK-SVVVKSKEKQS 614

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/581 (54%), Positives = 404/581 (69%), Gaps = 9/581 (1%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           M L ER+QR+VI  GL+P+++  LP +S LC ++GI  +  +LP EGQYR+TYISENALM
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIV-IIGILPFEGQYRNTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120
           PSQAYSYFRE+EWNI+RGYR+QI  L N S++ERN I+  WLQ+FG KT +Y++   G+T
Sbjct: 60  PSQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDT 119

Query: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180
           LYGV HAPRGDGTE+MVL+ PWFN DGEFN  G AL VALARYFSRWPVWSKNIIVVF++
Sbjct: 120 LYGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTE 179

Query: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240
           +PKA+LRSWV+AYHTSLDLTGGSIE+A+VLD+ G  D F Y+EIYY GLNGELPNLD+VN
Sbjct: 180 NPKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVN 239

Query: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300
           + +   EHEGMKVSL+G P D+++    F+R+K ++  IK  ALSGV++ YGNEAFSGWR
Sbjct: 240 IGVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWR 299

Query: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQ+V LRARG +GPFD+T+FGRVPEA+FRS+NNLLEKFHQSFFFYL+LAPR+FVSI+SYL
Sbjct: 300 IQSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYL 359

Query: 361 PXXXXXXXXXXXXXLDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420
           P             L++       T     L  + +++ + V+L+ +F VS  F     P
Sbjct: 360 PSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFP 419

Query: 421 VILISWSVMTALAP-ILLNRVRIQSSYAHRLKXXXXXXXXXXXXXXXXXNFALAFGIGLL 479
            IL++ +++  L P IL     ++   ++RL+                 NF LAFG+GLL
Sbjct: 420 TILLAVNIIICLYPAILKGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGLL 479

Query: 480 AFPLILVK--NSTTP---RXXXXXXXXXXXXXPFISTCLFAYFFEPLLPGLQILEQLVQA 534
           +FP+  VK   S TP   R             PFI+T LF+   +    GL + E+LV A
Sbjct: 480 SFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSA 539

Query: 535 WNEFGCWTWCVVCIGWLPSWLLIAYSSMITDVSTLLNSAEK 575
             E GCWTW V+C+GW   WLL+A S++  D   L N +E 
Sbjct: 540 SRELGCWTWLVLCVGWWTPWLLVAISAL--DTVKLSNDSED 578

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/572 (51%), Positives = 400/572 (69%), Gaps = 7/572 (1%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           MAL+  + R+VID+GL+P+I++ LP +S+    IGI  + L+LP++GQYRHTYISENALM
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIV-LFLMLPMDGQYRHTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120
           PSQAYSYFRE+EWNILRGYRT+I    +  S +RN ++  WL+EFG KT++Y ++  G+T
Sbjct: 60  PSQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDT 119

Query: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180
           LYG+ +APRGDGTEA+VL+ PW+N DGEFN GG AL +AL+R+FSRWP+WSKNIIVVFS+
Sbjct: 120 LYGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSE 179

Query: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240
           +P  +LRSWV AYH SLDLTGGSIE+A+V+DYP  +DFF YVEIYY G+NGELPNLDL+N
Sbjct: 180 NPDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLN 239

Query: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300
           +AI +TEHEGM+VSL+G+P++ +   +YF+R++T+++G K   LSG++  +GNEAFSG+R
Sbjct: 240 IAIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFR 299

Query: 301 IQAVVLRAR--GDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIAS 358
           IQA+ L+A+   D+   DIT+FGR+ EA FRSVNNLLEKFHQSFFFYL+LAP+YFVSI+S
Sbjct: 300 IQAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISS 359

Query: 359 YLPXXXXXXXXXXXXXLDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFH 418
           YLP             L + +    ST       N+ A + FT+++ FSF V+     F 
Sbjct: 360 YLPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLFT 419

Query: 419 HPVILISWSVMTALAPILL-NRVRIQSSYAHRLKXXXXXXXXXXXXXXXXXNFALAFGIG 477
            P +L+  SV  ++ P LL NR  I    ++RLK                 NF+LAFGIG
Sbjct: 420 EPRLLVLGSVFLSVLPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIG 479

Query: 478 LLAFPLILVKNST---TPRXXXXXXXXXXXXXPFISTCLFAYFFEPLLPGLQILEQLVQA 534
           +L F +  VK  T   + R             PF S  LF Y F+  + G++I  + + +
Sbjct: 480 ILGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHS 539

Query: 535 WNEFGCWTWCVVCIGWLPSWLLIAYSSMITDV 566
           WN   CWTW ++C+GWLP W+L++ SS+ T+ 
Sbjct: 540 WNTLNCWTWFIICVGWLPPWILVSISSIQTNT 571

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/578 (51%), Positives = 406/578 (70%), Gaps = 6/578 (1%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           M+++E LQR++ID GLLP+ +  LPKLS+L   + +  + L LP++GQ+R TYISENALM
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVM-LMLYLPMDGQFRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120
           PSQAYSYFRETEWNILRGYR +I+ L + SS+ERN I+ SWL+EFG+KT++Y+++  G++
Sbjct: 60  PSQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDS 119

Query: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180
           LYGV +APRGDGTE+MVL+ PW+N + EFN  G AL V+LAR+ SRWPVWSKNIIVVFS+
Sbjct: 120 LYGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSE 179

Query: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240
           +P+ +LRSWV+AYHTSLDLTGGSIE+AVVLDYPGV+D+F+Y+E++Y G NG LPNLDLVN
Sbjct: 180 NPREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVN 239

Query: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300
           +AI + EHEG+KVSL+G+  DEM N DY++R+K + +G K +AL+GV+  YGNEAFSGWR
Sbjct: 240 IAISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWR 299

Query: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQA+ L+ARGD    D+TTFGRV EA+FRS+NNLLEKFHQSFFFY LLAPRYFVSI SYL
Sbjct: 300 IQALTLKARGDTN-HDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYL 358

Query: 361 PXXXXXXXXXXXXXLDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420
           P             +D+ +     +       N+ + + + V+++  F +  +F  +  P
Sbjct: 359 PAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQP 418

Query: 421 VILISWSVMTALAPILLNR-VRIQSSYAHRLKXXXXXXXXXXXXXXXXXNFALAFGIGLL 479
           ++L+  +V+ +  P+   + + I    A+RLK                 NF LAFG+GL 
Sbjct: 419 LLLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLF 478

Query: 480 AFP--LILVKNSTTPRXXXXXXXXXXXXXPFISTCLFAYFFEPLLPGLQILEQLVQAWNE 537
           A+P  L+++ N+   R             PFI+  LF    E  L G++ +  LV AWN+
Sbjct: 479 AYPMTLVMLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNK 538

Query: 538 FGCWTWCVVCIGWLPSWLLIAYSSM-ITDVSTLLNSAE 574
            G WTW + CIGW PSW+L+A S++ +  V T  NS +
Sbjct: 539 LGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKK 576

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/563 (51%), Positives = 395/563 (70%), Gaps = 12/563 (2%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           MALIE+LQR+V+++GL+P+I+  LP +S++C +I   W+  L P+EGQ+R TYISENALM
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATL-PIEGQFRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120
           PSQAYSYFRE+EWNILRGYR+QI+     S+ ERNE +  WLQEFG KT++Y +E  G++
Sbjct: 60  PSQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDS 119

Query: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180
           LYG+LHA RGDGTEA++L+ PW+N +G+ N GG +L ++L+R+FSRWPVWSKNII+VFS+
Sbjct: 120 LYGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSE 179

Query: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240
           +P  +LRSWVQAYHTSLDLTGGSIE+A+VLDYPG ND+F Y EI Y GLNGELPNLDLVN
Sbjct: 180 NPNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVN 239

Query: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300
           +A+ +TEHEG+ VSL+G+  + + +  Y++R+K ++ GI + A +G++   GNEAFSGWR
Sbjct: 240 IAVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWR 299

Query: 301 IQAVVLRARG-DHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASY 359
           IQ+V ++A G + G  DITTFGR+PEA+FRS+NNLLEKFHQS+FFY+L+APRYFVSI+SY
Sbjct: 300 IQSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSY 359

Query: 360 LPXXXXXXXXXXXXXLDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHH 419
           LP             L+++L    S        N+ A++ + V++L SF  S  F     
Sbjct: 360 LPATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLYVPS 419

Query: 420 PVILISWSVMTALAPILLNRV-RIQSSYAHRLKXXXXXXXXXXXXXXXXXNFALAFGIGL 478
            ++L+++ V+  L P+   R+  I    +HRL+                 NF LAF +G+
Sbjct: 420 TILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGI 479

Query: 479 LAFPLILVKNSTTPRXXXXXXXXXXXXXPFISTCLFAYFFEPLLPGLQILEQLVQAWNEF 538
           LAFP+  V    T R               IS  L ++F   + P  Q+L++L+ AW + 
Sbjct: 480 LAFPMTAVG---TQRSLTFKKYALL----IISNPLVSFFI--VKPHPQLLQKLISAWQDL 530

Query: 539 GCWTWCVVCIGWLPSWLLIAYSS 561
           GCWTW V+C+GWLPSW LIA S+
Sbjct: 531 GCWTWFVLCLGWLPSWTLIALSA 553

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/589 (51%), Positives = 402/589 (68%), Gaps = 15/589 (2%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           M L E LQRK + LGLLP+++  LP LS L  ++ +  + L++P+ GQYR+TYISENALM
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVVMI-LIIPMNGQYRNTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENK--SSLERNEILGSWLQEFGVKTALYEDESCG 118
           PSQAYSYFRETEWNILRGYRT+I+ L ++  S+ +R +I+  WL EFG KTA+Y +E  G
Sbjct: 60  PSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMG 119

Query: 119 NTLYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVF 178
           +TLYGVLHAPRGDGTEAMVL APW N +GEFN GG+AL +AL+RYFSRWPVWSKNIIVVF
Sbjct: 120 DTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVF 179

Query: 179 SDDPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDL 238
           SD+P  +LRSWV+AYHTSLDLTGGSIE+AV+LDYP  ND+F Y EI++ GLNGELPNLDL
Sbjct: 180 SDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDL 239

Query: 239 VNVAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSG 298
           VNVA+H+T+HEGMKVSL+G+P  E++  +Y++R+K + +G+K   L+G+++ +GNE FSG
Sbjct: 240 VNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSG 299

Query: 299 WRIQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIAS 358
           WRIQAV L+ARG+ G  DITTFGR+PEA+FRS+NNLLEKFHQSFFFY LL+P  FVSI+S
Sbjct: 300 WRIQAVTLKARGE-GQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISS 358

Query: 359 YLPXXXXXXXXXXXXXLDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFA-RF 417
           YLP             +D  +   A  S   I   + A +   ++LL SF V+  F    
Sbjct: 359 YLPSAVLLSITFAIAAVDATV-NNAYASALHITYTLLAALASVISLLVSFLVAHWFLYST 417

Query: 418 HHPVILISWSVMTALAPILLNRVR--IQSSYAHRLKXXXXXXXXXXXXXXXXXNFALAFG 475
             P+ LI  SV+ A++P++++R    ++    +R++                 NF LAF 
Sbjct: 418 TSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRTLGYIYYSLILTSLLMLNFPLAFS 477

Query: 476 IGLLAFPLILVK-----NSTTPRXXXXXXXXXXXXXPFISTCLFAYFFE-PLLPGLQILE 529
           IGL  +P+ LVK     + +                PF++T L     E    P L +  
Sbjct: 478 IGLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVENSEFPNLDVFA 537

Query: 530 QLVQAWNEFGCWTWCVVCIGWLPSWLLIAYSSMITDVSTLLNSAEKKSS 578
            L  AW +  CWTW V+C+GWLP+WLL+ +SS  T +     + EKKS+
Sbjct: 538 ALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSF-TSIPAAETTIEKKSN 585

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/572 (50%), Positives = 398/572 (69%), Gaps = 18/572 (3%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           M L+ER+QR ++  GL+P+I+  LPK+S++   I I  + +L P++GQYR+TYISENALM
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAIL-PMDGQYRNTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120
           PSQAYSYFRETEWNI+RGYR ++  +EN +S ERN+I+ SWL EFGVKT +YE+      
Sbjct: 60  PSQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEV 118

Query: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180
           LYGV HAPRGDGTEA+VL+ PWFN DGEFN  G A+ VALARYFSRWPVWSKNIIVVFS+
Sbjct: 119 LYGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSE 178

Query: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240
           +P ++LRSWV+AY+TSLDLTGGSIE+A+VLD PG ND+F Y+E+YY GLNGELPNLDLVN
Sbjct: 179 NPDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVN 238

Query: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300
           + I++ EHEGM+VSL+G P D+++  +Y+ R+K +V  I+  A SG+ + +GNEAFSGWR
Sbjct: 239 IGIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWR 298

Query: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQ++ L+ +G+ GP DIT FGRVPEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 299 IQSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PXXXXXXXXXXXXXLDNVLCQGAST----SQSGILPNIAAVVGFTVALLFSFTVSVTFAR 416
           P             +D+ +   +      S   ++P I     +TV L+  F ++  F  
Sbjct: 359 PSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIV----WTVTLVACFILAQLFLI 414

Query: 417 FHHPVILISWSVMTALAPILL-NRVRIQSSYAHRLKXXXXXXXXXXXXXXXXXNFALAFG 475
              P +L+  +++ +++ I++ N+   + + ++RL+                 NF L+F 
Sbjct: 415 LPIPSLLLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFM 474

Query: 476 IGLLAFPLILVKN---STTPRXXXXXXXXXXXXXPFISTCLFAYFFEPL----LPGLQIL 528
           IGL+AFP+  V++   +T P+             PFI+  ++           L GL+++
Sbjct: 475 IGLMAFPMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVI 534

Query: 529 EQLVQAWNEFGCWTWCVVCIGWLPSWLLIAYS 560
            +L+ AW +  CWTW V+C+GWLPSW+++A S
Sbjct: 535 NRLISAWKDMRCWTWFVLCLGWLPSWIMVAIS 566

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/592 (50%), Positives = 395/592 (66%), Gaps = 17/592 (2%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           M+L++++ R++ + G + ++++ LP++S L  ++ I  +  +LPL+GQYR TYISENALM
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIV-LLAILPLDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120
           PSQAYSYFRETEWNILRGYR+QI+TLE+ S  +RNE++  WLQE G+KTALYE E  G T
Sbjct: 60  PSQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKT 119

Query: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180
           LYGVLHA RGDGTEAMVL+ PW N D +FN GG AL V+L+++F RWPVWSKNIIVVFS+
Sbjct: 120 LYGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSE 179

Query: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240
           D  A+LR+WV AYHTSLDLT GSIE+AVVLDYP  +DFF+YVEI Y GLNGELPNLDLVN
Sbjct: 180 DSGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300
           +A+ +TEHEGMKVSL+G+P +EM N DYFAR+K M VGIK  ALSGV+R +GNEAFSGWR
Sbjct: 240 IAVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWR 299

Query: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQ+V LRA G+ G  DIT FGR+PEA+FRSVNNLLEKFHQS+FFYLLLAPR FVSI++YL
Sbjct: 300 IQSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYL 359

Query: 361 PXXXXXXXXXXXXXLDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420
           P             LD+ +     +     +  +   +  + ++  SF +S         
Sbjct: 360 PSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIV 419

Query: 421 VILISWSVMTALAPILLNRVRIQ---SSYAHRLKXXXXXXXXXXXXXXXXXNFALAFGIG 477
             L+  SV     P+++++  I     + A+RLK                 NFAL F IG
Sbjct: 420 ESLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMIG 479

Query: 478 LLAFPLILVKNSTTP-------RXXXXXXXXXXXXXPFISTCLFAYFFEPLLPG--LQIL 528
           LLAFPL  +   +T        +             PFIS  LF    +    G    I 
Sbjct: 480 LLAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIY 539

Query: 529 EQLVQAWNEFGCWTWCVVCIGWLPSWLLIAYSSM----ITDVSTLLNSAEKK 576
            +++ +W+  GCWTW ++C+GWLP WL+   SS+    I + +++L+  ++ 
Sbjct: 540 NRMITSWDTLGCWTWFIICLGWLPYWLISVISSIPSQPIVERTSILDDKKEN 591

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/549 (50%), Positives = 376/549 (68%), Gaps = 12/549 (2%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60
           M L+ER++R+V  +GL+P++ ++LP  S +  +I +     +LP++GQYR+TYISENALM
Sbjct: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLI-SIAILPIDGQYRNTYISENALM 59

Query: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120
           PSQAYSYFRETEWNILRGYRTQ++ + +    ERN+I+ +WL + G KT    D    +T
Sbjct: 60  PSQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKT----DTHNNST 115

Query: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180
           +YG+ H+PRGDGTEA+VL+ PW N +G+FN GG AL V+LAR+F RWP+WSKNIIVVFS+
Sbjct: 116 IYGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSE 175

Query: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240
           D  ASLRSWV+AYHTSLDLTGGSIE+AV+LDY   +DFF YVEI+Y GLNGELPNLDLVN
Sbjct: 176 DTGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVN 235

Query: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300
           +A+ +TEHEGMKVSL+G+P +E++ R  ++R K ++  IK  +L+G+++ +GNEAFSGWR
Sbjct: 236 IAVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSGWR 295

Query: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360
           IQA+ L+A G+ G  DITTFGR+PEA+FRS+NNLLEKFHQSFF+YLLLAPR FVSI+SYL
Sbjct: 296 IQALTLKACGEGG-IDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYL 354

Query: 361 PXXXXXXXXXXXXXLDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420
           P             L   +     +        + A++ + +++ FSF  ++T+ ++  P
Sbjct: 355 PAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFP 414

Query: 421 VILISWSVMTALAPIL---LNRVRIQSSYAHRLKXXXXXXXXXXXXXXXXXNFALAFGIG 477
           V+L+   ++ +  P++   L     + + AHR+K                 NF LA  IG
Sbjct: 415 VMLMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIG 474

Query: 478 LLAFPLILVKNST---TPRXXXXXXXXXXXXXPFISTCLFAYFFEPLLPGLQILEQLVQA 534
           +LAFP+ LVK S    T               P+IS C F+  F+  L GL  L++L+ A
Sbjct: 475 VLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLIPA 534

Query: 535 WNEFGCWTW 543
           WN+  CWTW
Sbjct: 535 WNDMNCWTW 543

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/588 (47%), Positives = 384/588 (65%), Gaps = 20/588 (3%)

Query: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLL--PLEGQYRHTYISENA 58
           MALIE L R+   LGLLP+++    KLS++  I+ +  + L+L  PL+GQYR TYISENA
Sbjct: 1   MALIEVLHRRATKLGLLPKVI---GKLSIVSNILVLISIGLILCLPLDGQYRRTYISENA 57

Query: 59  LMPSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCG 118
           L+PSQAYSYFRE+EWNILRGYRT I+ L +K +  RNE++ SWL +FG+K A+Y++ + G
Sbjct: 58  LLPSQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADG 117

Query: 119 NTLYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVF 178
           +TLYGV ++ RGDGTEA+VL+ PW+N D E N GG AL ++L+RYFSRWP+WSKNII+V 
Sbjct: 118 DTLYGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVI 177

Query: 179 SDDPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDL 238
           S++P  +++SWV AYH SLDLTGGS+E+A+VLD+P  +++F++VE+Y+ G+NGELPNLD+
Sbjct: 178 SENPHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDI 237

Query: 239 VNVAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSG 298
           VNVAI V EHEG+KVSL G+   EM    YF R+KT++ G+K  ALSG ++ YGNEAFSG
Sbjct: 238 VNVAISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSG 297

Query: 299 WRIQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIAS 358
            RIQA+ L+A G  G  DITTFGR+PEA+FRSVNNLLEKFHQSFFFY L+APR+FVSI S
Sbjct: 298 RRIQALTLKACGTEG-HDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGS 356

Query: 359 YLPXXXXXX----XXXXXXXLDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTF 414
           YLP                 ++N       +  S IL  I       ++ +F   ++ TF
Sbjct: 357 YLPSAVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIF-LQINETF 415

Query: 415 ARFHHPV---ILISWSVMTALAPILLNRVRIQSSYAHRLKXXXXXXXXXXXXXXXXXNFA 471
            + H  +   +LIS+  +T +   L   + IQ   ++RLK                 NFA
Sbjct: 416 LQPHLMILAFLLISFLPLTNIPQPL---ITIQPCLSYRLKSFAFIYISLVLTSLLVMNFA 472

Query: 472 LAFGIGLLAFPLILVKNST---TPRXXXXXXXXXXXXXPFISTCLFAYFFEPLLPGLQIL 528
           LAFG+GLLAFPL   K+ +   T +             PFI+  +F   FE  +   ++ 
Sbjct: 473 LAFGMGLLAFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVF 532

Query: 529 EQLVQAWNEFGCWTWCVVCIGWLPSWLLIAYSSMITDVSTLLNSAEKK 576
             L+ ++   G WTW + CIGW  +W ++  +++ T  S L    +K 
Sbjct: 533 SDLISSFKYMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTKKN 580

>ZYRO0D08492g Chr4 complement(733481..735235) [1755 bp, 584 aa] {ON}
           similar to gnl|GLV|CAGL0K09218g Candida glabrata
           CAGL0K09218g and some similarites with YCR061W
           uniprot|P25639 Saccharomyces cerevisiae YCR061W Protein
           of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 584

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 51/116 (43%), Gaps = 10/116 (8%)

Query: 130 GDGTEAMVLSAPWFNGDGEFNKGGTALVVALARY--FSRWPVWSKNIIVVFSDDPKASLR 187
           G G     L A W  G   F  G    +V+LARY    +   W+ N I+V  D  ++   
Sbjct: 296 GKGARIFNLLAHWIKGGVFFVLG----LVSLARYCGVGKGHGWAWNKIIVKRDPLRSRSS 351

Query: 188 SWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVNVAI 243
           +W + +     +T   IES ++  Y   N F +++    AG  G     DL +V+I
Sbjct: 352 AWKRFFSPRGTITMEGIESFLIFFYGSTNVFLEHL----AGAGGAWTAKDLQHVSI 403

>CAGL0J02002g Chr10 (200829..201914) [1086 bp, 361 aa] {ON} similar
           to uniprot|P40556 Saccharomyces cerevisiae YIL006w or
           uniprot|P39953 Saccharomyces cerevisiae YEL006w
          Length = 361

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 54/137 (39%), Gaps = 29/137 (21%)

Query: 155 ALVVALARYFSRWPVWSKNIIVVFSDDPKASLRSWVQAYHTSLDLTGGSIESAVV----- 209
            LV  +  YF  W ++  ++     D+ + +  +W    H+   +T G++ + V      
Sbjct: 133 GLVPIIMGYFPTWMIYF-SVYEFCKDNLRTNSSNWSFVSHSFSAITAGAVSTVVTNPIWV 191

Query: 210 ---------------LDYPGVNDFFKY------VEIYYAGLNGELPNLDLVNVAIHVTEH 248
                            Y G  D FK       V+  YAGL   L  L L++VAIH   +
Sbjct: 192 VKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSL--LGLLHVAIHFPVY 249

Query: 249 EGMKVSLNGIPEDEMQN 265
           E +KVS      DE  N
Sbjct: 250 ERLKVSFKCYQRDESSN 266

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,620,877
Number of extensions: 2201382
Number of successful extensions: 6076
Number of sequences better than 10.0: 24
Number of HSP's gapped: 6116
Number of HSP's successfully gapped: 28
Length of query: 578
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 463
Effective length of database: 40,294,809
Effective search space: 18656496567
Effective search space used: 18656496567
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)