Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.237998.262ON48848825590.0
KLTH0G13684g8.262ON50842817630.0
SAKL0H17028g8.262ON55041811641e-154
Ecym_43088.262ON5294369061e-116
TDEL0F038908.262ON4763788581e-109
KLLA0F19140g8.262ON5274298611e-109
KAFR0B055408.262ON5193818211e-103
AGR086C8.262ON5344128221e-103
Kpol_392.68.262ON4573917647e-96
ZYRO0C01650g8.262ON5863887642e-94
NDAI0J013808.262ON6244097631e-93
Skud_4.3718.262ON5803677232e-88
Suva_2.2708.262ON6323677248e-88
Smik_4.3568.262ON5763677172e-87
YDR110W (FOB1)8.262ON5663677128e-87
NCAS0B038508.262ON5883936973e-84
CAGL0B01771g8.262ON5363886863e-83
Kpol_543.388.262ON4423766341e-76
TBLA0E044308.262ON4813785532e-64
KNAG0H032408.262ON5193985335e-61
TPHA0J007408.262ON4083514898e-56
TPHA0A018108.262ON4573784263e-46
TBLA0F030708.262ON4453964202e-45
SAKL0F06809g2singletonON175561850.096
SAKL0C11913g1singletonON175561850.10
SAKL0B11583g2singletonON175561850.10
NDAI0D03010na 1ON778159840.11
Smik_49.2singletonON55056780.50
Kpol_1037.34singletonON129551780.64
NCAS0G02330singletonON65771770.80
Skud_12.300singletonON39852741.7
Suva_8.705.602ON29848732.1
KLLA0F15334g5.190ON194550705.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23799
         (488 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   990   0.0  
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   683   0.0  
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   452   e-154
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   353   e-116
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   335   e-109
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   336   e-109
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   320   e-103
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   321   e-103
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   298   7e-96
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   298   2e-94
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   298   1e-93
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   283   2e-88
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   283   8e-88
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   280   2e-87
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   278   8e-87
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   273   3e-84
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   268   3e-83
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   248   1e-76
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   217   2e-64
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   209   5e-61
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   192   8e-56
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   168   3e-46
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   166   2e-45
SAKL0F06809g2 Chr6 (518357..519658,519660..523625) [5268 bp, 175...    37   0.096
SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)...    37   0.10 
SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 17...    37   0.10 
NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {O...    37   0.11 
Smik_49.2 Chr49 (115..1764) [1650 bp, 550 aa] {ON} YNL054W-B (RE...    35   0.50 
Kpol_1037.34 s1037 (80237..84124) [3888 bp, 1295 aa] {ON} (80237...    35   0.64 
NCAS0G02330 Chr7 complement(413199..415172) [1974 bp, 657 aa] {O...    34   0.80 
Skud_12.300 Chr12 complement(546310..547503) [1194 bp, 398 aa] {...    33   1.7  
Suva_8.70 Chr8 (127773..128669) [897 bp, 298 aa] {ON} YHR014W (R...    33   2.1  
KLLA0F15334g Chr6 complement(1410456..1416293) [5838 bp, 1945 aa...    32   5.5  

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  990 bits (2559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/488 (97%), Positives = 477/488 (97%)

Query: 1   MDKQVGSKVDGRRKDGVKFRMPKVGETLEKYGNGLNDELLARGRLDFIKYQESVKGQLTQ 60
           MDKQVGSKVDGRRKDGVKFRMPKVGETLEKYGNGLNDELLARGRLDFIKYQESVKGQLTQ
Sbjct: 1   MDKQVGSKVDGRRKDGVKFRMPKVGETLEKYGNGLNDELLARGRLDFIKYQESVKGQLTQ 60

Query: 61  EQFDLVRSSALTAENLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEP 120
           EQFDLVRSSALTAENLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEP
Sbjct: 61  EQFDLVRSSALTAENLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEP 120

Query: 121 ESLFDLIMCGHLKNGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKF 180
           ESLFDLIMCGHLKNGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKF
Sbjct: 121 ESLFDLIMCGHLKNGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKF 180

Query: 181 RHTNIYSGLLPLERVHVEIIAPFPKLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITK 240
           RHTNIYSGLLPLERVHVEIIAPFPKLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITK
Sbjct: 181 RHTNIYSGLLPLERVHVEIIAPFPKLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITK 240

Query: 241 AFLTFLLSLPRVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLR 300
           AFLTFLLSLPRVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLR
Sbjct: 241 AFLTFLLSLPRVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLR 300

Query: 301 YLLQQNEEPCLKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELI 360
           YLLQQNEEPCLKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELI
Sbjct: 301 YLLQQNEEPCLKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELI 360

Query: 361 EKLFASNVVELRNEGRRRGMIYLEDESSAFKMPDEEYISAENETENEGFDYGPMVGLTPL 420
           EKLFASNVVELRNEGRRRGMIYLEDESSAFKMPDEEYISAENETENEGFDYGPMVGLTPL
Sbjct: 361 EKLFASNVVELRNEGRRRGMIYLEDESSAFKMPDEEYISAENETENEGFDYGPMVGLTPL 420

Query: 421 TSPSRHDITRDTXXXXXXXXXXXAFEGRPSQTPDTLNMSREISGPPSFMLKGADHDQTAF 480
           TSPSRHDITRDT           AFEGRPSQTPDTLNMSREISGPPSFMLKGADHDQTAF
Sbjct: 421 TSPSRHDITRDTSISPSFSPSSPAFEGRPSQTPDTLNMSREISGPPSFMLKGADHDQTAF 480

Query: 481 VNGTSMEL 488
           VNGTSMEL
Sbjct: 481 VNGTSMEL 488

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/428 (75%), Positives = 371/428 (86%), Gaps = 3/428 (0%)

Query: 1   MDKQVGSKVDGRRKDGVKFRMPKVGETLEKYGNGLNDELLARGRLDFIKYQESVKGQLTQ 60
           M K   S+VD RR+D V+F MP VGE +EKY NGLN ELL RGRLDFIKYQESVKGQLTQ
Sbjct: 1   MTKLEKSRVDKRRRDKVEFDMPAVGEPIEKYHNGLNLELLERGRLDFIKYQESVKGQLTQ 60

Query: 61  EQFDLVRSSALTAENLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEP 120
           +QFDLVRS +LT +NLM+TSDKLH+GN+ETKFLLLKRR+YVDADG VRD+KC DTVVCEP
Sbjct: 61  DQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEP 120

Query: 121 ESLFDLIMCGHLKNGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKF 180
           E +FDLIMCGHLKNGH+HWRRLH YLR  YANTTRAFAQICV+YCS+CNPEE LRPY+KF
Sbjct: 121 ELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKF 180

Query: 181 RHTNIYSGLLPLERVHVEIIAPFPKLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITK 240
           RHTNIYSGLLPLERVHVEII+PF + IEG YSHVL+ RDYYSRFVWMQPL  + V +ITK
Sbjct: 181 RHTNIYSGLLPLERVHVEIISPFSEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITK 240

Query: 241 AFLTFLLSLPRVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLR 300
             L  LL LPR+PIF+ETST+ RQDLFE CE++A QY L IGLGMS+S+TFQ+NGVERLR
Sbjct: 241 GLLATLLLLPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLR 300

Query: 301 YLLQQNEEPCLKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELI 360
           YLLQ+NEE CL+SW+MCLK+G TNHN+ YNAR+LG+PGNLLHSTV DYGRQFELKRE+LI
Sbjct: 301 YLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLI 360

Query: 361 EKLFASNVVELRNEGRRRGMIYLEDESSAFKMPDEEYISAENETE--NEGFDYGPMVGL- 417
           EKLFA NVVE++  GRRRG+IYLEDE+SAFKMPDEEYISAENET+  ++   +G    L 
Sbjct: 361 EKLFARNVVEIKVSGRRRGIIYLEDETSAFKMPDEEYISAENETDMNDDDLGFGSATRLT 420

Query: 418 TPLTSPSR 425
           TPLTSP R
Sbjct: 421 TPLTSPGR 428

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  452 bits (1164), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 218/418 (52%), Positives = 295/418 (70%), Gaps = 19/418 (4%)

Query: 19  FRMPKVGETLEKYGNGLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMS 78
           +  PK+GE+   Y   LN ELL RG  DFIKY ESVKGQLTQ Q++L+++  LT E L++
Sbjct: 26  YVTPKLGESQVTYSTDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLLA 85

Query: 79  TSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHIH 138
            +D L   N E K+L LKRR+YVD+D  VRD K DDT+VCEPE +++LI+ GHL N H+H
Sbjct: 86  VTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHLH 145

Query: 139 WRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHVE 198
           WR+LH +L+ +Y+N TR F Q+C RYCSECNP+E ++P+ KF+HTN Y GLLPLER+HVE
Sbjct: 146 WRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHVE 205

Query: 199 IIAPF--PKLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFV 256
           I  PF   +LIE  YSHVLY RDY+SRFVW+ PL      E+      FLLSLPR+PIF+
Sbjct: 206 IFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIFL 265

Query: 257 ETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSWHM 316
           ET+TL RQD+F++CE IA +Y L+IGLG++ S+ F +NG+ER++YLLQ N++ C K W M
Sbjct: 266 ETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWGM 325

Query: 317 CLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVELRNEGR 376
           CLK+G  ++N  YN R++G   +LL + VS  G++F+LKRE++I +LFA NVV L++ G 
Sbjct: 326 CLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTG- 384

Query: 377 RRGMIYLEDESSAFKMPDEEYISAENETENEG--------------FDYGPMVGLTPL 420
             GM+Y+E+E+S F M DE+ IS   +++  G               D  P +GLTPL
Sbjct: 385 --GMVYVENENSVFIMEDEDLISVNQDSQESGTPMATSGGQGVEQEMDEMPSMGLTPL 440

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  353 bits (906), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 183/436 (41%), Positives = 272/436 (62%), Gaps = 32/436 (7%)

Query: 2   DKQVGSKVDGRRKDGV-------KFRMPKVGETLEKYGNGLNDELLARGRLDFIKYQESV 54
           D QVGS  DG     V        F++P+    + +    L+ + L  GR + IK   +V
Sbjct: 13  DAQVGS--DGSESFFVFQKITEEGFKVPRFDLNVYQLAPELDHDWLDTGRNELIKLINTV 70

Query: 55  KGQLTQEQFDLVRSSALTAENLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDD 114
           KGQLTQ+ ++L+ S+ L+ + L+   DK+ +G +E KF+LLKRR+ +   G V D K +D
Sbjct: 71  KGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRYSI-LQGNVVDHKRED 129

Query: 115 TVVCEPESLFDLIMCGHLKNGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVL 174
             V EP+ +FD+IM  HL NGH+ WR++H +L+  YAN TR F  +   YCS CN +  +
Sbjct: 130 LPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCNTDRNM 189

Query: 175 RPYRKFRHTNIYSGLLPLERVHVEIIAPFP----KLIEGLYSHVLYLRDYYSRFVWMQPL 230
           + + +++H N+Y  ++PLER HVEI APF     + IE  YSHVLY RDY+SRFVWM PL
Sbjct: 190 KRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWMLPL 249

Query: 231 ASERVSEITKAFLTFLLSLPRVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTT 290
                 ++  A    L S+ R+PIF+ET+TL RQD+F+VCE IA +Y L IGLG++  T 
Sbjct: 250 EGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGLNSGTD 309

Query: 291 FQRNGVERLRYLLQQNEEPCLKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGR 350
           FQRNGV R++ L  +++E C+K W+MCL+  +T  N  Y+ RV G+P +LL + +S+   
Sbjct: 310 FQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEISNIAH 369

Query: 351 QFELKREELIEKLFASNVVELRNEGRRRGMIYLEDESSAFKMPDEEYISAENETENEGFD 410
           +F+LK+ ++I++L+A +VV+ R  G   GMIYLED++SAF + ++E              
Sbjct: 370 KFKLKQRKIIDELYAHHVVQFREAG---GMIYLEDDNSAFVVDEDE-------------- 412

Query: 411 YGPMVGLTPLT-SPSR 425
           +GP     P+T SPS+
Sbjct: 413 HGPENDNVPVTESPSK 428

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  335 bits (858), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 163/378 (43%), Positives = 246/378 (65%), Gaps = 10/378 (2%)

Query: 15  DGVK--FRMPKVGETLEKYGNG-LNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSAL 71
           +GVK  F  P +GE+ ++Y N  +N ELL RG  D +KYQES+ GQ+    ++L+R+++L
Sbjct: 33  NGVKSQFLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSL 92

Query: 72  TAENLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGH 131
           T E L S SDK    + E+K++ L RR+Y + +G VRD +  D +VCEP  +FDLIMC H
Sbjct: 93  TPETLASNSDKWDKDSAESKYMFLMRRYYAE-NGIVRDRRKGDKIVCEPLCIFDLIMCAH 151

Query: 132 LKNGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLP 191
           L N H+ +R ++  L + Y+N TR F Q+ VRYCS CNP+   RP  K+RH NI+ GLLP
Sbjct: 152 LMNDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLP 211

Query: 192 LERVHVEIIAPFP-KLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLP 250
           LERVH+EI   F  + I   +++VLY RDY++RFVW+ PL + +   +  A  T LL + 
Sbjct: 212 LERVHIEIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMT 271

Query: 251 RVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPC 310
            VPIF+E+STL +QDLF++CE +  +Y + +GLG + S+ F  NG++R++ LL   +  C
Sbjct: 272 YVPIFMESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDC 331

Query: 311 LKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVE 370
           +  W+MCL++G  + N  +N    G+P +LL+ +     + F  K+E +I++L A NVV 
Sbjct: 332 ISDWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVH 391

Query: 371 LRNEGRRRGMIYLEDESS 388
           +      +G++YLEDE+S
Sbjct: 392 V-----NKGLLYLEDENS 404

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  336 bits (861), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 182/429 (42%), Positives = 259/429 (60%), Gaps = 19/429 (4%)

Query: 18  KFRMPKVGETLEKYGNGLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLM 77
           KF +P  G  L  +   L+ ++L  GRL   K   +VKGQLTQ  +DL+ S ALT ENL+
Sbjct: 56  KFVLPVKGFDLGSFCGELDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLL 115

Query: 78  STSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHI 137
             SDK+ +  +E KF+LLKRR+YV  +  + D K  D VV EP  LFDLIM  H+ N H+
Sbjct: 116 RASDKVTNSTVENKFVLLKRRYYV-QENLLHDVKRKDLVVYEPNELFDLIMSVHVLNSHV 174

Query: 138 HWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHV 197
             + +++ L   YAN T++F ++   +CS+CN       Y+KF+H NI++ L+PL R HV
Sbjct: 175 SSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHV 234

Query: 198 EIIAPFPKL-----------IEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFL 246
           EI APF              IEG Y  VLY RDYYSR+VW++PL S  +S++       L
Sbjct: 235 EIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLL 294

Query: 247 LSLPRVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQN 306
            S+ R+PIF++T TL RQD+F+VCENIA  Y + IGLGM+ ST+FQ+ G++R++ L  Q+
Sbjct: 295 FSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQH 354

Query: 307 EEPCLKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFAS 366
           +E CL  W+MCLK  V+  N  Y+ RV G+P +LL ST  D  ++F   +  +I +L   
Sbjct: 355 KEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLGH 414

Query: 367 NVVELRNEGRRRGMIYLEDESSAFKMPDEEYISAENETENEGFD-YGPMVGLTPLT---S 422
           +VV+    G   GMIYLEDE+S   +   +  S E+E ++E FD        TP++   S
Sbjct: 415 HVVQFEEAG---GMIYLEDENSPNLLLSGDDNSEESEHDSEIFDELASSRDGTPISEQPS 471

Query: 423 PSRHDITRD 431
           P R ++  D
Sbjct: 472 PHRTNMNYD 480

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  320 bits (821), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 155/381 (40%), Positives = 239/381 (62%), Gaps = 7/381 (1%)

Query: 19  FRMPKVGETLEKYGNG-LNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLM 77
           + +P++GE+   Y +  +N ELL RG  +  K+Q+S+ G LT+E +DL+R+ +LT E L 
Sbjct: 47  YIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLA 106

Query: 78  STSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHI 137
           ST+ K      E ++L LKRR+Y D +G + D    D +VCEP  +FD+IM  HL N H 
Sbjct: 107 STNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHG 166

Query: 138 HWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHV 197
             +++HH L   Y+N TR      +++CS CNPE+ +    KF+H NIY+ L+PLERVH+
Sbjct: 167 FVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHI 226

Query: 198 EIIAPFP-KLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFV 256
           EI  PFP + IE  YSH+LY RDY+SR++WM PL + +   +     +  LS  R PIF+
Sbjct: 227 EIFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFI 286

Query: 257 ETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSWHM 316
           ET++L  QD+F++CE IA +Y L IGLG S+  TF   G+ +++  L+ + E CL SW++
Sbjct: 287 ETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNL 346

Query: 317 CLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVELRNEGR 376
           CLK+G  +HN+ +N R  G+PG+LL S + +   +F+ K  +++E   + +V+ + N   
Sbjct: 347 CLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRVDN--- 403

Query: 377 RRGMIYLEDESSAFKMPDEEY 397
             G+I+LE +    +  DE Y
Sbjct: 404 --GLIFLEVDEPHDEPHDEPY 422

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  321 bits (822), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 168/412 (40%), Positives = 255/412 (61%), Gaps = 13/412 (3%)

Query: 19  FRMPKVGETLEKYGNGLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMS 78
           F++P+    L +    L  E + RGR +  K  ++VKGQLTQE +DL+ S  L+ + L+ 
Sbjct: 29  FKVPQTDLNLYQLDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLE 88

Query: 79  TSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHIH 138
             DK+    +E K++LLKRR YV   G V D K  D  V EP+SLFD+IM  HL N H+ 
Sbjct: 89  CCDKVTPNTVENKYVLLKRR-YVAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMP 147

Query: 139 WRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHVE 198
           WR+++ +++  YAN TR    +   YCS CN +  +R + +++H N++  L+PLER HVE
Sbjct: 148 WRKVYQHMKGLYANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVE 207

Query: 199 IIAPFP----KLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPI 254
           + APF     + I+G YSH LY RDY+SRF+W+ PL       +  A    L ++ RVPI
Sbjct: 208 VFAPFDDEGVEKIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPI 267

Query: 255 FVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSW 314
           F+ET+TL RQD+F++CE IA +Y   IGLG++  T FQ+NG++R++ LL + +E C   W
Sbjct: 268 FLETATLDRQDMFDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDW 327

Query: 315 HMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVELRNE 374
           +MCL+  ++  N TY  RV G+P +LL + + +   +F+ K++++I++L+A +VV  +  
Sbjct: 328 NMCLRLVLSRVNQTYADRVRGIPSDLLCNEIPNISMKFKQKQKKIIDQLYAHHVVHFKEA 387

Query: 375 GRRRGMIYLEDESSAFKM--PDEEY--ISAENETENEGFDYGPMVGLTPLTS 422
           G   GMIYLEDE SAF M  PD++   +  E    ++       + LTP+TS
Sbjct: 388 G---GMIYLEDEESAFVMDDPDDDCTPVPEEPPVASDSIQNSATI-LTPITS 435

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  298 bits (764), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 153/391 (39%), Positives = 237/391 (60%), Gaps = 16/391 (4%)

Query: 34  GLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMSTSDKLHSGNIETKFL 93
           GLN EL  RG  D  K+Q ++ G L+Q  +DL+ +  LT + +     K  + + E K+ 
Sbjct: 76  GLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSREKVKWANKSNE-KYY 134

Query: 94  LLKRRFYVDADGT-VRDFKCDDTVVCEPESLFDLIMCGHLKNGHIHWRRLHHYLRRKYAN 152
            LK R+YV   GT VRD + DD ++C P  + ++++C HL N H   + +H  L ++YAN
Sbjct: 135 FLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKRYAN 194

Query: 153 TTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHVEIIAPF--PKLIEGL 210
            +R   +I + YCS CNP E ++P +K +   +Y GLLP ER+H+EI  PF   KLIEG 
Sbjct: 195 ISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLIEGT 254

Query: 211 YSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFVETSTLKRQDLFEVC 270
           YSH+LY+RDYYSR+VW+ PL      E+T+  +T+  ++ + PI++E+ST+ R DL  + 
Sbjct: 255 YSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLIAMV 314

Query: 271 ENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSWHMCLKFGVTNHNMTYN 330
           + IA +Y L IG+G+  S+ F  NG+E ++ LL  +E+ CL  W MCLK+G   HN   N
Sbjct: 315 QKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNNLKN 374

Query: 331 ARVLGLPGN-LLHSTVSDYGRQFELKREELIEKLFASNVVELRNEGRRRGMIYLEDESSA 389
            +VLG+P N LL+S +S+   +++ K+  +I++ F  N++ L N    +  IYLED  ++
Sbjct: 375 RKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNG---KSEIYLEDNLTS 431

Query: 390 FKMPDEEYISAENETENEGFDY--GPMVGLT 418
             + DE+ I      E  G++Y   P+  LT
Sbjct: 432 TPVIDEKNI------EPVGYEYYENPINTLT 456

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  298 bits (764), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 153/388 (39%), Positives = 237/388 (61%), Gaps = 22/388 (5%)

Query: 34  GLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMSTSDKLHSGNIETKFL 93
           G+N  LL +G  + +++Q +V GQLTQ+ ++L+RS  L+  NL     K    + E ++ 
Sbjct: 54  GMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANL-ERCHKWKGESSEIEYY 112

Query: 94  LLKRRFYV-DADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHIHWRRLHHYLRRKYAN 152
            L+ R++V + +G V D K DD +VCEP S+F L+MC HL+N H+    +H  L + YAN
Sbjct: 113 YLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYAN 172

Query: 153 TTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHVEIIAPFP-KLIEGLY 211
            TR +    + YCS+CNP+   +P++K RH N+Y  LLPLERVH+E+  PF  + I+G +
Sbjct: 173 ITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPLERVHIEVFEPFDGEKIQGRF 232

Query: 212 SHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFVETSTLKRQDLFEVCE 271
           SH+LY RDY+SR+VW+ PL +++   + +A  +FLL LPR+PIF+E++T+ R+ LF++C 
Sbjct: 233 SHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIFLESTTIDREHLFDLCG 292

Query: 272 NIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSWHMCLKFGVTNHNMTYNA 331
            IA  Y L +GLG+  S  F  NG++ ++ LL  ++E CL+ W++CLK+G  + N   N 
Sbjct: 293 QIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWNLCLKYGPFHINQNINV 352

Query: 332 RVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVELRNEGRRRGMIYLEDESSAFK 391
              G PG+LL ++V D  R+F  KR ++I    +  VV L       G+++LE+     K
Sbjct: 353 SSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQVVHL-----GEGVLFLENNKEEHK 407

Query: 392 M------------PDEEYISAENETENE 407
                        PDEE   AEN+  N+
Sbjct: 408 TVEAVKENITHSDPDEE--RAENDNTND 433

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  298 bits (763), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 157/409 (38%), Positives = 238/409 (58%), Gaps = 16/409 (3%)

Query: 10  DGRRKDGVKFRMPKVGETLEKYGNGLND-ELLARGRLDFIKYQESVKGQLTQEQFDLVRS 68
           D +R+    + +P VGE+   Y +   D +LL RG + F+ +Q S+ GQL +  ++L+R+
Sbjct: 82  DPKRRHYGSYLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRT 141

Query: 69  SALTAENLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIM 128
            +LT E L +     H+    T+  L KRR+  D +G VRD    + +VC+P  L++++M
Sbjct: 142 KSLTEETLAANFPHFHA---PTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMM 198

Query: 129 CGHLKNGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSG 188
             HL N H  +RR H  L   YAN TR F    V++CS CNP +++ P  KF+H N Y G
Sbjct: 199 TCHLMNDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKG 258

Query: 189 LLPLERVHVEIIAPFP-KLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLL 247
           +LPLERVH+EI  PF  K IEG YSHV+Y RDY SR++ ++PL + +   +  A    L 
Sbjct: 259 MLPLERVHIEIFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLF 318

Query: 248 SLPRVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNE 307
           +LPR+PIF+ET +L  QD F++ E I  +Y +++GLGM  +  F   GV++++ LL+ + 
Sbjct: 319 NLPRIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHR 378

Query: 308 EPCLKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASN 367
           + CL  W MCLK+G  N+N  +N R  G+P +LL   V D   +   K E++I  L   N
Sbjct: 379 KECLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDN 438

Query: 368 VVELRNEGRRRGMIYLEDE------SSAFKMPDEEYISAENETENEGFD 410
           +V++ N     G IYLE++       +   M  EEY S + +  N+  D
Sbjct: 439 IVQIGN-----GSIYLEEKVKDPNIDNYDAMLGEEYDSEQEDNNNKNTD 482

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  283 bits (723), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 142/367 (38%), Positives = 220/367 (59%), Gaps = 5/367 (1%)

Query: 21  MPKVGETLEKYGNG-LNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMST 79
           +P +GE+   Y +  LN ELL RG  +   + ES+  QLTQ+ ++L+++ +LTA+ L   
Sbjct: 51  LPSMGESYTAYVDSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTADTLQQI 110

Query: 80  SDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHIHW 139
           SDK      E K L L+R++YVD +G VRD + +D + CEP+ ++D++M  HL N H+  
Sbjct: 111 SDKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRG 170

Query: 140 RRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHVEI 199
           + LH +L   +ANT+ A      ++CS+CN +  ++P ++++  ++Y  LLP+ER+H+E+
Sbjct: 171 KTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEV 230

Query: 200 IAPFP-KLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFVET 258
             PF    IEG Y +VL  RDY S F+W+ PL S +   +     +  LS  RVPIFV +
Sbjct: 231 FEPFTGGAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTS 290

Query: 259 STLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSWHMCL 318
           STL + DL+++CE IAS+YGL IGLG+  S  F   G+  ++Y L   +E CL  W  CL
Sbjct: 291 STLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCL 350

Query: 319 KFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVELRNEGRRR 378
           ++G    N   N R    P  +L S V  +  +FE KRE +IE  ++ N+ ++      +
Sbjct: 351 RYGPYRFNRRRNKRTKRKPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKM---AGGK 407

Query: 379 GMIYLED 385
           G+IYLED
Sbjct: 408 GLIYLED 414

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  283 bits (724), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 143/367 (38%), Positives = 221/367 (60%), Gaps = 5/367 (1%)

Query: 21  MPKVGETLEKYGNG-LNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMST 79
           +P +GE+  +Y +  LN ELL RG  +   + ES+  QLTQ+ ++L+++ +LTAE L   
Sbjct: 101 LPLMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQI 160

Query: 80  SDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHIHW 139
           SDK      E K L L+R++YVD +G VRD + +D + CEP+ ++D++M  HL N H+  
Sbjct: 161 SDKYDGVAAENKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRG 220

Query: 140 RRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHVEI 199
           + LH +L   +ANT+ A      ++CS+CN +  ++P ++++  ++Y  LLP+ER+H+E+
Sbjct: 221 KTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEV 280

Query: 200 IAPF-PKLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFVET 258
             P+  K IEG Y +VL  RDY S F+W+ PL S +   +     +  LS  R+PIFV +
Sbjct: 281 FEPYGGKAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTS 340

Query: 259 STLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSWHMCL 318
           STL + DL+++CE IAS+YGL IGLG+  S  F   G+  ++Y L   +E CL  W  CL
Sbjct: 341 STLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCL 400

Query: 319 KFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVELRNEGRRR 378
           ++G    N   N R    P  +L S V  +  +FE KRE +IE  +A N+  +      +
Sbjct: 401 RYGPYRFNRRRNKRTKRKPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTM---AGGK 457

Query: 379 GMIYLED 385
           G+IYLED
Sbjct: 458 GLIYLED 464

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  280 bits (717), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 141/367 (38%), Positives = 219/367 (59%), Gaps = 5/367 (1%)

Query: 21  MPKVGETLEKYGNG-LNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMST 79
           +P +GE+  +Y +  LN ELL RG  +   + ES+  QLTQ+ ++L+++ +LTA+ L   
Sbjct: 50  LPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQI 109

Query: 80  SDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHIHW 139
           SDK      E K L L+R++YVD +G VRD + +D + CEP  ++D++M  HL N H+  
Sbjct: 110 SDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLRG 169

Query: 140 RRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHVEI 199
           + LH +L   +AN + A      ++CS+CN +  ++P ++++  ++Y  LLP+ER+H+E+
Sbjct: 170 KTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEV 229

Query: 200 IAPFP-KLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFVET 258
             PF  + IEG YS+VL  RDY S F+W+ PL S +   +     +  LS  RVPIFV +
Sbjct: 230 FEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTS 289

Query: 259 STLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSWHMCL 318
           STL + DL+++CE IAS+YGL IGLG+  S  F   G+  + Y L   +E CL  W  CL
Sbjct: 290 STLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKCL 349

Query: 319 KFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVELRNEGRRR 378
           ++G    N   N R    P  +L S +  +  +FE KRE +IE  ++ N+ +       +
Sbjct: 350 RYGPYRFNRRRNKRTKRKPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKT---AGGK 406

Query: 379 GMIYLED 385
           G+IYLED
Sbjct: 407 GLIYLED 413

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  278 bits (712), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 140/367 (38%), Positives = 222/367 (60%), Gaps = 5/367 (1%)

Query: 21  MPKVGETLEKYGNG-LNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMST 79
           +P +GE+  +Y +  LN ELL RG  +   + ES+  QLTQ+ ++L+++ +LTA+ L   
Sbjct: 48  LPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQI 107

Query: 80  SDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHIHW 139
           SDK      E K L L+R++YVD +G VRD + +D + CEP+ ++D++M  HL N H+  
Sbjct: 108 SDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLRG 167

Query: 140 RRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHVEI 199
           + LH +L   +AN + A      ++CS+CN +  ++P ++++  ++Y  LLP+ER+H+E+
Sbjct: 168 KTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEV 227

Query: 200 IAPFP-KLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFVET 258
             PF  + IEG YS+VL  RDY S F+W+ PL S +   +     +  L+  RVPIFV +
Sbjct: 228 FEPFNGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTS 287

Query: 259 STLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSWHMCL 318
           STL + DL+++CE IAS+YGL IGLG+  S  F   G+  ++Y L   ++ CL  W  CL
Sbjct: 288 STLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCL 347

Query: 319 KFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVELRNEGRRR 378
           ++G    N   N R    P  +L S V  +  +FE KRE +IE  ++ N+ ++      +
Sbjct: 348 RYGPYRFNRRRNKRTKRKPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKM---AGGK 404

Query: 379 GMIYLED 385
           G+IYLED
Sbjct: 405 GLIYLED 411

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  273 bits (697), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 140/393 (35%), Positives = 231/393 (58%), Gaps = 12/393 (3%)

Query: 19  FRMPKVGETLEKY-GNGLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLM 77
           + +P +GE  + Y    ++   + RG  +F ++Q+++ GQL +  ++L+++++LT E L 
Sbjct: 82  YLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLS 141

Query: 78  STSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHI 137
           +T+ K+      ++ + L RR+ +D  G VRD    + +VCEP  ++D+IM  HL N H 
Sbjct: 142 ATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHG 201

Query: 138 HWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHV 197
             R+ H  L   Y+N TR F +   ++CS CNP +   P++K++H N + GLLPLERV V
Sbjct: 202 RPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQV 261

Query: 198 EIIAPFP-KLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFV 256
           E+  PFP + + G Y  +LY RDY SRF+WM PL + +   +       + S+ R+PIF 
Sbjct: 262 EVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFF 321

Query: 257 ETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSWHM 316
           ET+T++ QD F++ E I  +Y ++IGLG         NG+ ++R LL  ++E CL  W M
Sbjct: 322 ETTTIENQDFFDIFEKIVEKYQINIGLGTKLGGKRLTNGLPQIRKLLGPHKEECLADWIM 381

Query: 317 CLKFGVTNHNMTYNARVLGLPGNLLHSTVSD-YGRQFELKREELIEKLFASNVVELRNEG 375
           CLK+G    N   N R  G+PG+LL   + D Y + ++ K E++++ L   N+V++    
Sbjct: 382 CLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYD-KIEQILQDLPTENIVKI---- 436

Query: 376 RRRGMIYLEDESSAFKMPDEEY-ISAENETENE 407
             RG IYLED +   + P+ EY  + ++E++ E
Sbjct: 437 -GRGCIYLEDRNP--EDPEAEYEANTDDESDTE 466

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  268 bits (686), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 150/388 (38%), Positives = 213/388 (54%), Gaps = 25/388 (6%)

Query: 18  KFRMPKVGETLEKYGNG----LNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTA 73
           KF MP + ET E Y  G    ++ + L RG  D  ++ E + G+LTQE + L+ ++ LT 
Sbjct: 59  KFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTM 118

Query: 74  ENLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLK 133
           E +M   +       ETK+  L +RFY D +G +RD K D+ +V EP+ LF+LI+  HLK
Sbjct: 119 ETVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLK 178

Query: 134 NGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLE 193
           NGH+    L   LR  YAN TR F Q  + YC+ CNP+  ++P  K RH NI   LLPLE
Sbjct: 179 NGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLE 238

Query: 194 RVHVEIIAPFPK---------------LIEGLYSHVLYLRDYYSRFVWMQPLASERVSEI 238
           RVH+E+ APF K                IEG YSHV Y RD+ +R+VW  PL + +   +
Sbjct: 239 RVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTL 298

Query: 239 TKAFLTFLLS-LPRVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVE 297
                TF ++ L   PIFVE+ST+ R DL E+ E +AS+YGL +GLG +  T F   G++
Sbjct: 299 VDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIK 358

Query: 298 RLRYLLQQNEEPCLKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTV-SDYGRQFELKR 356
           R +  L + +  C   W MCLK G  + N     R LG   N+L + +   + R    K+
Sbjct: 359 RFKTHLHRAKSECADDWLMCLKQGTYSANRVI-ERQLGKASNILFTELMGQFERDMRKKK 417

Query: 357 EELIEKLFASNVVELRNEGRRRGMIYLE 384
            + IE+ F+ N+      G   G I++E
Sbjct: 418 LKYIEQSFSENIKTYPKSG---GCIFIE 442

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  248 bits (634), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 132/376 (35%), Positives = 211/376 (56%), Gaps = 6/376 (1%)

Query: 13  RKDGVKFRMPKVGETLEKY-GNGLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSAL 71
           R   V F  PKVG TL +Y  +  +   L  GR    +Y +S+ G L+Q  ++L+R   L
Sbjct: 37  RYGKVVFDYPKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLL 96

Query: 72  TAENLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGH 131
             + L S   +    N   K L LKRR+ +   GTV D   ++ +V EP+  +D I+  H
Sbjct: 97  DVDTL-SEKTRWSRINANAKCLYLKRRYKLTKKGTVIDLTRENKIVYEPDLRYDYIISTH 155

Query: 132 LKNGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLP 191
           + N H+ ++ +H  L+  Y+N +R + ++ + +CS CNP++V+    K  H NIY   LP
Sbjct: 156 ILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLP 215

Query: 192 LERVHVEIIAPFP-KLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLP 250
           LERV ++I  PF  + I+  YSH++Y+RDY SRFVW+ PL + +   +       LL LP
Sbjct: 216 LERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLP 275

Query: 251 RVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPC 310
           R+PI+++T+T++R+D+  +C+ IA +Y +S+G+G    ++F   G+ RL+ LL +N++ C
Sbjct: 276 RIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKC 335

Query: 311 LKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVE 370
           LK W+MCLK G   +N        G+P  L    +      FE KR E+I  L   N  +
Sbjct: 336 LKDWNMCLKLGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYK 395

Query: 371 LRNEGRRRGMIYLEDE 386
                  +G++Y +DE
Sbjct: 396 ---TSTNKGLVYAQDE 408

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  217 bits (553), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/378 (31%), Positives = 211/378 (55%), Gaps = 22/378 (5%)

Query: 28  LEKYGNGLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMSTSDKL--HS 85
           L++  + +N ELL +G  D  +Y       LTQE  D++ +  L+ EN++    KL  HS
Sbjct: 43  LDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHS 102

Query: 86  GNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHIHWR-RLHH 144
             +E K+    RR+Y++ D  + D +    ++CEP+ ++D+++  HLK   +H    +  
Sbjct: 103 KALE-KYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHLK---LHSSYAVSE 158

Query: 145 YLRRKYANTTRAFAQICVRYCSECNPEEVLR--------PYRKFRHTNIYSGLLPLERVH 196
            L++ ++N  R +   C +YCS+C P+E            ++  R+  I   L P+ER+H
Sbjct: 159 RLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIH 218

Query: 197 VEIIAPFPKL-IEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLP-RVPI 254
           +EI  PF  L IE  Y  +LY+RDY +R++W   L   ++  IT     F LS+   VPI
Sbjct: 219 IEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPI 278

Query: 255 FVETSTLKRQDLFEVCENIASQYGLSIGLGM-SRSTTFQRNGVERLRYLLQQNEEPCLKS 313
           F+++ST+   DLF++CE I+ +Y +S+GLG  ++   F  +G+E  + L+  N+  CLKS
Sbjct: 279 FLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKS 338

Query: 314 WHMCLKFGVTNHNMTYNARVLGLPGNLLH-STVSDYGRQFELKREELIEKLFASNVVELR 372
           W   L FG   HN  +N+R+L  P ++++ + ++   ++F  +R  +I++    N V+L 
Sbjct: 339 WSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKL- 397

Query: 373 NEGRRRGMIYLEDESSAF 390
             G    +I++EDE+++ 
Sbjct: 398 --GNVASIIFIEDEATSI 413

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  209 bits (533), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 127/398 (31%), Positives = 210/398 (52%), Gaps = 18/398 (4%)

Query: 21  MPKVGETLEKYGN-GLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMST 79
           +P +G+    Y +  L+ E   RG  D   Y  +  G+++QE + L ++  +T EN+   
Sbjct: 36  VPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIARL 95

Query: 80  SDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHIHW 139
                SG+   K + + RR+Y DA+G +RD   ++ +V +P   FD+IM  HL N H+  
Sbjct: 96  YPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGS 155

Query: 140 RRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHVEI 199
            R++  LR  YAN      +  + YCS CNP   L P  + +   ++   LPLER+ +EI
Sbjct: 156 ERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPK-PYLFEKALPLERITIEI 214

Query: 200 IAPFP-KLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFVET 258
           I PFP + +EG YS+++ ++D+  RF W++PL + +   I       +LS PRVPI+VE+
Sbjct: 215 IEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVES 274

Query: 259 STLKRQDLFEVCENIASQYGLSIGLG-MSRSTTFQRNGVERLRYLLQQNEEPCLKSWHMC 317
           +TL   DLF++ E I ++YG+ IGLG  +RS+  Q     R+   L  + + CL  ++ C
Sbjct: 275 NTLDWSDLFDIFEMIVTKYGIKIGLGCTTRSSAAQ--ATARINRDLNDHHDECLFDFNNC 332

Query: 318 LKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVELRNEGRR 377
           LK+G T +N          P +++  + +    +F  KR  +++   +S V+      R 
Sbjct: 333 LKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSPSSCVM-----NRG 387

Query: 378 RGMIYLED-----ESSAFKMPDEEYISAENETENEGFD 410
            G +YLE      E +A    DE  +S+  + E+E  D
Sbjct: 388 MGTLYLESPNGIQEDAAASSADE--LSSAKDAEDEERD 423

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  192 bits (489), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 104/351 (29%), Positives = 184/351 (52%), Gaps = 11/351 (3%)

Query: 32  GNGLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMS------TSDKLHS 85
           G+ ++ E +  GR D ++ +      LTQ+ + L+R      E          T    + 
Sbjct: 36  GSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEEAMKSHYTDSGKYM 95

Query: 86  GNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHIHWRRLHHY 145
           G    KF+L++ R+ ++  G + D + D  ++  P  ++DLIM  H  N H+   ++HH 
Sbjct: 96  GTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHS 155

Query: 146 LRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHVEIIAPFPK 205
           LR KY+N +RA  ++ ++ CS CNP+   +     RH +        E++HVEI  PF  
Sbjct: 156 LREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSCDKNF-AFEKIHVEIFQPFED 214

Query: 206 L--IEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFVETSTLKR 263
           +      +SHV+Y+RDY++R+VW+ PL    V E+     T LL   R+PI++E+ TL  
Sbjct: 215 VDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLLSLRIPIYIESLTLDE 274

Query: 264 QDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSWHMCLKFGVT 323
            +L ++ + I+    L +G+G ++   FQ +G+  ++ L  QN E C  +W+  +     
Sbjct: 275 SNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQNREYCGNNWNKYVIRCQN 334

Query: 324 NHNMTYNARVLGLPGNLL-HSTVSDYGRQFELKREELIEKLFASNVVELRN 373
           ++N TYN  + G+P NL+   T++D  + ++ KR+  I    + N + L+N
Sbjct: 335 HYNTTYNKWIYGIPLNLMAQETLAD-NKTYKKKRQRTILLTLSKNTILLKN 384

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  168 bits (426), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 110/378 (29%), Positives = 202/378 (53%), Gaps = 16/378 (4%)

Query: 16  GVKFRMPKVGETLEKYGNGLND-ELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAE 74
            +K+ +P++G+  +     L D +LL +G    I    S    L++E +DLV++  LT +
Sbjct: 28  NIKYIIPRIGQKYDSLITPLLDKQLLQKGE---IAVANSKTNYLSKELYDLVKNDDLTRK 84

Query: 75  NLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKN 134
           N+ + +  L   N  T+ + LK R+Y D+   V D    + +V +P   F ++M  HL N
Sbjct: 85  NV-AVALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLN 143

Query: 135 GHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLER 194
            H+    ++  L + +AN +  F +  + YCS CN  +     +K    +    +L  ER
Sbjct: 144 DHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYER 203

Query: 195 VHVEIIAPF-PKLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVP 253
           + ++++APF  K I+  Y+H+L + D++++F+W  PL + ++  I      F+++LP  P
Sbjct: 204 LILDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKP 263

Query: 254 IFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKS 313
           +F+ + TL   D+FE+C  +A +Y +SIGLG +R+     +    +  +L  ++  CLKS
Sbjct: 264 VFISSFTLSLNDIFELCCYLAREYNISIGLG-TRNMQKAYSKNPYVTRILNSHKTECLKS 322

Query: 314 WHMCLKFGVTNHNMTYNARVLGLPGNL---LHSTVSDYGRQFELKREELIEKLFASNVVE 370
           W MCLK+     +   N++    P N    L S ++D+ +++E + + +I +L + N + 
Sbjct: 323 WFMCLKWLADRQS---NSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGRLPSENFIN 379

Query: 371 LRNEGRRRGMIYLEDESS 388
           + +EG     IY EDE S
Sbjct: 380 I-DEGSH--FIYSEDEFS 394

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  166 bits (420), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 107/396 (27%), Positives = 201/396 (50%), Gaps = 18/396 (4%)

Query: 19  FRMPKVGETLEKYGNG-LNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENL- 76
           F  P +G+  E Y +  ++ ++L RG  + ++++ ++K  +T + +  +R  +L  ++  
Sbjct: 28  FFCPPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAP 87

Query: 77  MSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGH 136
           +  S K+ +    +K + L+ R+  ++DG + + K +  ++CEP+ ++ L M  H  N H
Sbjct: 88  IPASLKIKT----SKKMYLQIRYSKNSDGDLIETKTN-KLLCEPKYIYKLTMKAHFMNNH 142

Query: 137 IHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYR-KFRHTNIYSGLLPLERV 195
           +   +L+  L  KY N       + ++YCS CN    +R  R  +   N Y   LPLER+
Sbjct: 143 MRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERL 202

Query: 196 HVEIIAPFPK---LIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRV 252
            ++I  PF      I   YSH+L +RDY+SR+ W+ PL S  +  I+     FL++LPR 
Sbjct: 203 QIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRT 262

Query: 253 PIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTT--FQRNGVERLRYL--LQQNEE 308
           PIF+ +  +    L ++   I  +Y + I +G+       F R G+ RL YL  L++N+E
Sbjct: 263 PIFLHSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVYLLNLKENKE 322

Query: 309 PCLKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNV 368
            C   W+ C++      N  ++         L+    ++  + FE KR+ L+  L   NV
Sbjct: 323 KCKSDWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENV 382

Query: 369 VELRNEGRRRGMIYLEDESSAFKMPDEEYISAENET 404
           +++   G    +IY ++ +S  ++ +++     NE 
Sbjct: 383 LKI---GECGSIIYFDNNNSGKELDEKDVNGGVNEN 415

>SAKL0F06809g2 Chr6 (518357..519658,519660..523625) [5268 bp, 1755
           aa] {ON} Retrotransposon Gag and Pol genes
          Length = 1755

 Score = 37.4 bits (85), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 28/61 (45%)

Query: 191 PLERVHVEIIAPFPKLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLP 250
           P + +H +I  P   L +   S+ +   D  +RF W+ PL   R   I + F T L  + 
Sbjct: 664 PFQYLHTDIFGPVHNLPKSAPSYFITFTDEKTRFQWVYPLHDRREQSILEVFTTILAFIE 723

Query: 251 R 251
           R
Sbjct: 724 R 724

>SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)
           [5268 bp, 1755 aa] {ON} Retrotransposon Gag and Pol
           genes
          Length = 1755

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 28/61 (45%)

Query: 191 PLERVHVEIIAPFPKLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLP 250
           P + +H +I  P   L +   S+ +   D  +RF W+ PL   R   I + F T L  + 
Sbjct: 664 PFQYLHTDIFGPVHNLPKSAPSYFITFTDEKTRFQWVYPLHDRREQSILEVFTTILAFIE 723

Query: 251 R 251
           R
Sbjct: 724 R 724

>SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 1755
           aa] {ON} Retrotransposon Gag and Pol genes
          Length = 1755

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 28/61 (45%)

Query: 191 PLERVHVEIIAPFPKLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLP 250
           P + +H +I  P   L +   S+ +   D  +RF W+ PL   R   I + F T L  + 
Sbjct: 664 PFQYLHTDIFGPVHNLPKSAPSYFITFTDEKTRFQWVYPLHDRREQSILEVFTTILAFIE 723

Query: 251 R 251
           R
Sbjct: 724 R 724

>NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {ON} 
          Length = 778

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 63/159 (39%), Gaps = 30/159 (18%)

Query: 116 VVCEPESLFDLIMCGHLK--------NGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSE 167
           + C P  L  +I C H            H     +   L  KY N ++      V  C +
Sbjct: 154 IWCPPTLLHYVIACVHENWDCDDYTLRKHRDENEIQSILAAKYHNISKFLIHDVVAACPD 213

Query: 168 CNPEEVLRPYRKFRHTNIYSGLLPL-----ERVHVEIIAPF------PKLIEGLYSHVLY 216
           C P       +KF  T +   +LPL     +R+ V+I++        PK      + +LY
Sbjct: 214 CKPLS----SKKFNITRV--NVLPLTRYSFQRLQVKILSAADYSCVCPK-DNCTKNAILY 266

Query: 217 LRDYYSRFVWMQPLASERVSE----ITKAFLTFLLSLPR 251
           + DY+S  VW+  L  E  +     + + FL  +L  P+
Sbjct: 267 IGDYHSGAVWLFALDGEEDATDILLVLEMFLNVVLITPK 305

>Smik_49.2 Chr49 (115..1764) [1650 bp, 550 aa] {ON} YNL054W-B
           (REPEAT)
          Length = 550

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 25/56 (44%)

Query: 191 PLERVHVEIIAPFPKLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFL 246
           P + +H +I  P   L +   S+ +   D  +RF W+ PL   R   I   F + L
Sbjct: 236 PFQYLHTDIFGPVHHLPKSAPSYFISFTDEKTRFQWVYPLHDRREESILNVFTSLL 291

>Kpol_1037.34 s1037 (80237..84124) [3888 bp, 1295 aa] {ON}
           (80237..84124) [3888 nt, 1296 aa]
          Length = 1295

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%)

Query: 192 LERVHVEIIAPFPKLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAF 242
            E +H ++  P P +     ++ +   D  SRF W+ PL S+  S +T  F
Sbjct: 226 FEFLHTDLFGPVPNMPTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVF 276

>NCAS0G02330 Chr7 complement(413199..415172) [1974 bp, 657 aa] {ON} 
            retrotransposon
          Length = 657

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 192 LERVHVEIIAPFPKLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPR 251
             R H++   P PK  + +Y H L   DY S FV +QP A    ++  K  +  +LS+  
Sbjct: 332 FSRWHLDFAGPLPK--DNIYRHFLIAVDYTSNFVVVQP-ARAADADTVKDMILHILSMFG 388

Query: 252 VPIFVETSTLK 262
            P  + T   K
Sbjct: 389 KPDTIVTDNAK 399

>Skud_12.300 Chr12 complement(546310..547503) [1194 bp, 398 aa] {ON}
           YNL054W-B (REPEAT)
          Length = 398

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 24/52 (46%)

Query: 191 PLERVHVEIIAPFPKLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAF 242
           P + +H +I  P   L +   S+ +   D  +RF W+ PL + R   I   F
Sbjct: 232 PFQYLHTDIFGPVHHLPKSAPSYFISFTDEKTRFKWVYPLLNRREQSILDVF 283

>Suva_8.70 Chr8 (127773..128669) [897 bp, 298 aa] {ON} YHR014W
           (REAL)
          Length = 298

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%)

Query: 351 QFELKREELIEKLFASNVVELRNEGRRRGMIYLEDESSAFKMPDEEYI 398
           + E  R+ + E +F S  V+LR E  R+G+ ++ D  +  K PD  Y+
Sbjct: 54  KVEKTRKVISENIFNSKHVDLRLETPRQGLKFVSDSQNGSKAPDVRYL 101

>KLLA0F15334g Chr6 complement(1410456..1416293) [5838 bp, 1945 aa]
            {ON} uniprot|O60014 Kluyveromyces lactis UBR1 N-END-
            RECOGNIZING PROTEIN (UBIQUITIN-PROTEIN LIGASE E3
            COMPONENT) (N-RECOGNIN)
          Length = 1945

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 4/50 (8%)

Query: 126  LIMCGHLKNGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLR 175
            L+ C H     +H+R   HY+ +K  +T      +C  YC+   P + ++
Sbjct: 1268 LVSCNHA----VHYRCFKHYIDKKRYSTDLFICPLCQTYCNSVIPVDTVK 1313

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,320,675
Number of extensions: 2246068
Number of successful extensions: 5692
Number of sequences better than 10.0: 33
Number of HSP's gapped: 5799
Number of HSP's successfully gapped: 33
Length of query: 488
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 374
Effective length of database: 40,409,475
Effective search space: 15113143650
Effective search space used: 15113143650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)