Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.237918.263ON51851827750.0
KLTH0G13662g8.263ON51951823850.0
SAKL0H17006g8.263ON53151419430.0
KLLA0F19162g8.263ON52851918080.0
TDEL0F039008.263ON55950618020.0
CAGL0L12254g8.263ON57447817820.0
NCAS0B050208.263ON56848117760.0
YLR089C (ALT1)8.263ON59250617710.0
Suva_10.1738.263ON59250717670.0
KNAG0G020408.263ON59148217670.0
Skud_12.1578.263ON59250617630.0
Smik_12.1488.263ON59250617570.0
NDAI0B019908.263ON58850417470.0
ZYRO0C01628g8.263ON53448317380.0
Kpol_392.58.263ON51250617240.0
TPHA0J007508.263ON52251217000.0
NCAS0B038408.263ON49748216640.0
KAFR0B027308.263ON53948616620.0
Skud_4.3728.263ON50749516560.0
AGR085W8.263ON52149116510.0
Ecym_43078.263ON53451316510.0
YDR111C (ALT2)8.263ON50749616420.0
Smik_4.3578.263ON50749616250.0
KNAG0M012108.263ON52147816230.0
Suva_2.2718.263ON50749316130.0
KAFR0B05520singletonON51048315990.0
KAFR0B055308.263ON51450015890.0
Kpol_543.398.263ON49248215850.0
TBLA0E044408.263ON56247715890.0
NDAI0J013608.263ON50147915380.0
TPHA0A018008.263ON49848515360.0
TBLA0F030608.263ON50048815250.0
TBLA0G01630singletonON50050014820.0
Suva_6.1361.321ON4441881402e-08
YIL116W (HIS5)2.252ON3851841302e-07
Kwal_34.160181.472ON3791591302e-07
NDAI0B037302.252ON3861841293e-07
TDEL0D019001.321ON4433611285e-07
YJL060W (BNA3)1.321ON4441881285e-07
NDAI0G057601.321ON4481871276e-07
KLTH0G19646g1.472ON3791511276e-07
SAKL0E08492g2.252ON3841461267e-07
KNAG0E018502.252ON3841681269e-07
KNAG0B053201.321ON4331681251e-06
TDEL0C040902.252ON3831841241e-06
Skud_10.1561.321ON4601881242e-06
SAKL0D11528g1.472ON3831521232e-06
KLLA0F03509g2.252ON3871951232e-06
Smik_10.1801.321ON4441731232e-06
KLLA0F10021g3.511ON4971251223e-06
Ecym_32902.252ON3861971204e-06
Kwal_47.189823.511ON4961831196e-06
ZYRO0A01672g2.252ON3861901187e-06
KNAG0B006603.511ON4961281189e-06
ADL249W2.252ON3871981171e-05
KLTH0G09614g2.252ON3891521171e-05
Kwal_23.48882.252ON3891531142e-05
Smik_9.532.252ON3881481143e-05
Kpol_1039.222.252ON3861931133e-05
TPHA0O014501.321ON4433551134e-05
CAGL0J05126g1.321ON4333601125e-05
CAGL0G01254g3.511ON5041251125e-05
TPHA0D033703.511ON4971281116e-05
Ecym_7228na 1ON4881541116e-05
KLTH0G02002g3.511ON4963311116e-05
Kpol_278.23.511ON4981281091e-04
KLLA0F01617g1.321ON4441771081e-04
SAKL0F02156g3.511ON4982491081e-04
Smik_7.693.511ON5001491081e-04
NCAS0A092001.321ON4451781082e-04
KAFR0J015802.252ON3831841072e-04
NCAS0B064402.252ON3851681062e-04
AFR548C3.511ON4971801062e-04
ZYRO0G20636g1.321ON4531851062e-04
YGL202W (ARO8)3.511ON5003401053e-04
Kwal_47.17462na 1ON4921541053e-04
Skud_9.552.252ON3851851044e-04
TDEL0A016008.204ON4751841044e-04
NCAS0G040501.472ON3841281035e-04
NCAS0E006703.511ON4972581036e-04
Suva_9.782.252ON3861861010.001
SAKL0H21824gna 1ON4991571000.001
Kpol_1032.398.204ON4531871000.001
Suva_7.613.511ON5001491000.002
NDAI0I028303.511ON500125990.002
KAFR0A017101.321ON435171980.002
KAFR0B023808.204ON443181970.003
Ecym_62921.321ON430331970.003
NDAI0B045502.102ON565162970.003
KLLA0A04906gna 1ON480166970.003
KLTH0G19624gsingletonON468183960.004
Smik_5.3198.204ON443178960.004
TPHA0F012602.252ON392177940.006
AGR167Wna 1ON512159940.007
Ecym_6319singletonON354336940.007
TDEL0D057903.511ON497127940.007
Skud_7.693.511ON500146940.008
KAFR0D014203.511ON492154940.008
Kwal_14.25741.321ON443186930.008
ZYRO0C06028g3.511ON496122930.009
Kpol_480.11.472ON380160930.009
Kpol_1035.231.321ON444170920.011
KLTH0E07678gna 1ON492160920.011
Skud_5.2908.204ON443178910.018
ZYRO0B11088g8.204ON45062900.022
KLTH0H10648g1.321ON443183890.026
Suva_5.2818.204ON450185890.032
ABL038W2.475ON443243880.039
AEL170C1.321ON458194870.046
Kwal_8.5858.204ON446192850.074
KNAG0G016808.204ON45260850.077
TBLA0B009902.102ON546163850.087
AGR141C8.204ON438172840.096
KLTH0B00176g8.204ON448183840.11
NCAS0A038308.204ON446179840.12
SAKL0H18612g8.204ON445181840.12
YER152C8.204ON443179830.15
TBLA0B080808.204ON444182830.17
SAKL0C10142g3.117ON28292810.20
CAGL0C01243g2.252ON383179810.24
TPHA0A020808.204ON458205800.36
KNAG0G005501.472ON387129790.38
CAGL0I06578g8.204ON436174790.43
KLLA0E00969g8.204ON445189780.53
SAKL0D06886g1.321ON44776780.65
Kpol_431.132.475ON443321751.3
AER397C7.401ON142879751.9
NDAI0C059608.204ON478191714.4
TDEL0A019402.420ON420192696.5
Smik_11.1352.475ON451171697.5
Ecym_55428.204ON44647697.9
Ecym_56232.353ON75059689.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23791
         (518 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...  1073   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   923   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   753   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   701   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   698   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   691   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   688   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   686   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   685   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   685   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   683   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   681   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   677   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   674   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   668   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   659   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   645   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   644   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   642   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   640   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   640   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   637   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   630   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   629   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   625   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   620   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            616   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   615   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   616   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   597   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   596   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   592   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              575   0.0  
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    59   2e-08
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    55   2e-07
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    55   2e-07
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    54   3e-07
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    54   5e-07
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    54   5e-07
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    54   6e-07
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    54   6e-07
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    53   7e-07
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    53   9e-07
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    53   1e-06
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    52   1e-06
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    52   2e-06
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    52   2e-06
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    52   2e-06
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    52   2e-06
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    52   3e-06
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    51   4e-06
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    50   6e-06
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    50   7e-06
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    50   9e-06
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    50   1e-05
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    50   1e-05
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    49   2e-05
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    49   3e-05
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    48   3e-05
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    48   4e-05
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    48   5e-05
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    48   5e-05
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    47   6e-05
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    47   6e-05
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    47   6e-05
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    47   1e-04
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    46   1e-04
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    46   1e-04
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    46   1e-04
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    46   2e-04
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    46   2e-04
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    45   2e-04
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    45   2e-04
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    45   2e-04
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    45   3e-04
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    45   3e-04
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    45   4e-04
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    45   4e-04
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    44   5e-04
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     44   6e-04
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    44   0.001
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    43   0.001
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    43   0.001
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    43   0.002
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    43   0.002
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    42   0.002
KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {O...    42   0.003
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    42   0.003
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    42   0.003
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    42   0.003
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    42   0.004
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    42   0.004
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    41   0.006
AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-synte...    41   0.007
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    41   0.007
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    41   0.007
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    41   0.008
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    41   0.008
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    40   0.008
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    40   0.009
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    40   0.009
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    40   0.011
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    40   0.011
Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON...    40   0.018
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    39   0.022
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    39   0.026
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    39   0.032
ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic ho...    39   0.039
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    38   0.046
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    37   0.074
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    37   0.077
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    37   0.087
AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}...    37   0.096
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    37   0.11 
NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204     37   0.12 
SAKL0H18612g Chr8 (1655787..1657124) [1338 bp, 445 aa] {ON} high...    37   0.12 
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    37   0.15 
TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa] ...    37   0.17 
SAKL0C10142g Chr3 complement(913490..914338) [849 bp, 282 aa] {O...    36   0.20 
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    36   0.24 
TPHA0A02080 Chr1 (424056..425432) [1377 bp, 458 aa] {ON} Anc_8.2...    35   0.36 
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       35   0.38 
CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} simila...    35   0.43 
KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} simila...    35   0.53 
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    35   0.65 
Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,...    33   1.3  
AER397C Chr5 complement(1392748..1397034) [4287 bp, 1428 aa] {ON...    33   1.9  
NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa] ...    32   4.4  
TDEL0A01940 Chr1 (355974..357236) [1263 bp, 420 aa] {ON} Anc_2.4...    31   6.5  
Smik_11.135 Chr11 (224382..225737) [1356 bp, 451 aa] {ON} YKL106...    31   7.5  
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    31   7.9  
Ecym_5623 Chr5 (1254121..1256373) [2253 bp, 750 aa] {ON} similar...    31   9.1  

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score = 1073 bits (2775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/518 (100%), Positives = 518/518 (100%)

Query: 1   MLSRPIIRSMPHSRLVLRHLSTRPGLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIP 60
           MLSRPIIRSMPHSRLVLRHLSTRPGLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIP
Sbjct: 1   MLSRPIIRSMPHSRLVLRHLSTRPGLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIP 60

Query: 61  LRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSG 120
           LRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSG
Sbjct: 61  LRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSG 120

Query: 121 ELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFL 180
           ELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFL
Sbjct: 121 ELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFL 180

Query: 181 TTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTE 240
           TTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTE
Sbjct: 181 TTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTE 240

Query: 241 QIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQEN 300
           QIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQEN
Sbjct: 241 QIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQEN 300

Query: 301 GFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEV 360
           GFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEV
Sbjct: 301 GFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEV 360

Query: 361 KQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQA 420
           KQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQA
Sbjct: 361 KQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQA 420

Query: 421 FQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSG 480
           FQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSG
Sbjct: 421 FQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSG 480

Query: 481 FGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDHRD 518
           FGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDHRD
Sbjct: 481 FGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDHRD 518

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/518 (83%), Positives = 480/518 (92%)

Query: 1   MLSRPIIRSMPHSRLVLRHLSTRPGLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIP 60
           MLSR + R+MPHSRL+LR LS +  ++ D SQK LGSKKTL+D+N+CVLNAKYAVRG IP
Sbjct: 2   MLSRQLTRTMPHSRLILRRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIP 61

Query: 61  LRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSG 120
           LRAEEL+ KL+EEPGSLPF+KIINANIGNPQQLDQKPLTFYRQVL+LLQNP LI  L +G
Sbjct: 62  LRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPTG 121

Query: 121 ELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFL 180
           ELHK FKPDAVERAKKMLKQVGGSVGAYS SQGVAGFR+SVAEFIEERDGEPASA DIFL
Sbjct: 122 ELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFL 181

Query: 181 TTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTE 240
           T GAS AVS ILS+FC G ENGALIPIPQYPLYTA+LALN++HALPYYLDE SGWSMDTE
Sbjct: 182 TAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTE 241

Query: 241 QIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQEN 300
           Q+E+VV+D+I+KG+RPTCLVVINPGNPTGA+L+ + IE ++ VAAKYS+V+IADEVYQEN
Sbjct: 242 QVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQEN 301

Query: 301 GFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEV 360
           GF+DA+FVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEV
Sbjct: 302 GFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEV 361

Query: 361 KQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQA 420
           KQVFLKLASISLCPVVTGQAL+DLMVRPPKKGDASYE DRQER  IH++LH++S LLY+ 
Sbjct: 362 KQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYET 421

Query: 421 FQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSG 480
           FQS+EGVSCQ+PQGAMYLFPKL+LS KAI KAES G+APDEYYCKELLEATGICTVPGSG
Sbjct: 422 FQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSG 481

Query: 481 FGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDHRD 518
           F QVPGT+HLRTTFLAPGTEW+DSWKKFH+KF ++HRD
Sbjct: 482 FRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/514 (69%), Positives = 431/514 (83%), Gaps = 5/514 (0%)

Query: 6   IIRSMPHSRLVLRHLSTRPGLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEE 65
           I ++MPHS L LR  S+       Y  +P   K +L+D+NE VL AKYAVRG IP +AEE
Sbjct: 22  IAKNMPHSTLFLRSFSSN---FVPYKFQP-ADKLSLEDLNENVLRAKYAVRGKIPQKAEE 77

Query: 66  LKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGELHKF 125
           LK +L  +P SLPFD+IINANIGNPQQLDQKPLTFYRQVL+LLQNPD++ ++   +L + 
Sbjct: 78  LKNQLARDPKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQI 137

Query: 126 FKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDG-EPASAQDIFLTTGA 184
           +KPDA++RA ++L  +GGSVGAYS+SQGV GFR++VA+FI +RDG E A A+DIFLT GA
Sbjct: 138 YKPDAIDRAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGA 197

Query: 185 SGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEK 244
           S AVSYILS+ C GP+ G LIPIPQYPLYTASLALNNSHALPYYLDEES WS + E+IEK
Sbjct: 198 SAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEK 257

Query: 245 VVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFND 304
           VV +SI KG+ P CLVVINPGNPTGA+L+ ++IE + +VAAKY +V+IADEVYQEN FN 
Sbjct: 258 VVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNG 317

Query: 305 AEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVF 364
           AEF SM+KVL+ LQ+   GK+DN+QLASLHSTSKGVSGECGQRGGYMEL+GFS +V+QVF
Sbjct: 318 AEFHSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVF 377

Query: 365 LKLASISLCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSM 424
           LKLASISLCPVVTGQAL+DLMV PPK GDASYEQD++ER +IHDAL  R+ +LY+ F  +
Sbjct: 378 LKLASISLCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRL 437

Query: 425 EGVSCQEPQGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQV 484
           EG+ CQ+PQGAMYLFP+L+LS KA+ KAE   L+PDE+YC+ELLEATGICTVPGSGFGQV
Sbjct: 438 EGIECQKPQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQV 497

Query: 485 PGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDHRD 518
           PGT+HLRTTFLAPGT+WI +W++FH+KF  ++RD
Sbjct: 498 PGTYHLRTTFLAPGTDWIKAWEEFHKKFYNEYRD 531

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/519 (64%), Positives = 418/519 (80%), Gaps = 4/519 (0%)

Query: 2   LSRPIIR-SMPHSRLVLRHLSTRPGLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIP 60
           +S  +IR + P  +  +  +++   LR   + KP   K +L D+NE VL AKYAVRG IP
Sbjct: 12  ISSGMIRVNAPALKSTMPSVTSLTQLRFSTTVKP-APKLSLDDVNENVLKAKYAVRGRIP 70

Query: 61  LRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSG 120
           +RAEEL+ +L ++P SLPF KII+ANIGNPQQLDQKPLTFYR+VL+LLQ+P+L+ +    
Sbjct: 71  MRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEADEA 130

Query: 121 ELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERD-GEPASAQDIF 179
            L   +K D+++RAK++L +VGGSVGAYS SQGV G RE+VA+FI +RD GE +  +DI+
Sbjct: 131 -LQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIY 189

Query: 180 LTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDT 239
           LT GAS AVSYILS+ C GP  G LIPIPQYPLYTASLALNNS  LPYYL EE  WS D 
Sbjct: 190 LTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDP 249

Query: 240 EQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQE 299
           E+IE+VV D+I+KGI+PTCLVVINPGNPTGA+L+  +I+ + +VAAKY +V+IADEVYQE
Sbjct: 250 EEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQE 309

Query: 300 NGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEE 359
           N F  ++F SMKKVLR LQKT  G+YDN+QLASLHSTSKGVSGECGQRGGYMELVGF+ +
Sbjct: 310 NVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHD 369

Query: 360 VKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQ 419
           ++QVFLKLASISLCPVVTGQAL+DLMV PP+ GD SYEQD+QER DIHDAL +R+  L++
Sbjct: 370 IRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFE 429

Query: 420 AFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGS 479
            F  +EG+ C++PQGAMYL+PKL+L  K I +A+   + PDE+YCK LLE TGICTVPGS
Sbjct: 430 TFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGS 489

Query: 480 GFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDHRD 518
           GFGQVPGT+HLRTTFL PGTEW+++W+KFH+ F + +RD
Sbjct: 490 GFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD 528

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/506 (66%), Positives = 407/506 (80%), Gaps = 9/506 (1%)

Query: 21  STRPGLRKDYSQK------PLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEP 74
           ST  GL   Y +K      P  S  T++D+NE VL AKYAVRG IP+RAEEL+++L  +P
Sbjct: 55  STAAGLHHIYHKKCHQDFYPAESL-TVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDP 113

Query: 75  GSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGELHK-FFKPDAVER 133
            SLPFDKI+NANIGNPQQL+QKPL+FYRQVL++LQ P+++       + K  FK DA+ER
Sbjct: 114 SSLPFDKIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIER 173

Query: 134 AKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYIL 192
           AK++L+ VGGSVGAYS+SQGV G R++VA+FI ERD GEPA  +DIFLT GAS AVSY+L
Sbjct: 174 AKRILRDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLL 233

Query: 193 SLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKK 252
           S+ C G E G LIPIPQYPLYTA+LALNNSH LPYYLDEESGWS +T +IE VV +SI+ 
Sbjct: 234 SILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIES 293

Query: 253 GIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKK 312
           GIRP+ LVVINPGNPTG++L+ + IE + +VAAKY +V+IADEVYQEN F  +EF SMKK
Sbjct: 294 GIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKK 353

Query: 313 VLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISL 372
           VLR LQK  PG YDNVQL SLHSTSKGVSGECGQRGGYMEL GF+ E++QV LKLASISL
Sbjct: 354 VLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISL 413

Query: 373 CPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEP 432
           CPVVTGQAL+DLMV PPK GD SYEQDR+ER  IH+ L  R+GLL+  F S+EG+ CQ+P
Sbjct: 414 CPVVTGQALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKP 473

Query: 433 QGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRT 492
           +GAMYLFP+++L  KAI  A+     PDE+YC++LLEATGICTVPGSGFGQ PGT+HLRT
Sbjct: 474 RGAMYLFPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRT 533

Query: 493 TFLAPGTEWIDSWKKFHEKFTEDHRD 518
           TFLAPGTEWI  W+ FH+KF + +RD
Sbjct: 534 TFLAPGTEWIKKWEDFHKKFYDQYRD 559

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/478 (67%), Positives = 393/478 (82%), Gaps = 2/478 (0%)

Query: 36  GSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQ 95
             + TL+D+NECVLNAKYAVRG IP+RAEELK +L+E P SLPF+ IINANIGNPQQL Q
Sbjct: 92  AEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNPQQLKQ 151

Query: 96  KPLTFYRQVLALLQNPDLISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVA 155
           KPL+FYRQVL+LLQ P+LI  L +       K DA++RAK++L  +GGSVGAYS+SQGV 
Sbjct: 152 KPLSFYRQVLSLLQYPELIPTLENNP-QTMIKQDAIDRAKRLLDDIGGSVGAYSSSQGVL 210

Query: 156 GFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYT 214
           G R++VA+FI  RD G  A  +DIFLT GAS AV Y+LS+FC G E G LIPIPQYPLYT
Sbjct: 211 GIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYT 270

Query: 215 ASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNT 274
           A+LAL NSHALPYYL+EE+GWS D E++E ++ DSI+  I+P+ LVVINPGNPTGA+L+ 
Sbjct: 271 ATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVINPGNPTGAVLSE 330

Query: 275 DTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLH 334
           + IE +  +AAKY +++IADEVYQEN F D +F SMKKVLR LQ  +PG YDNVQLASLH
Sbjct: 331 EAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLASLH 390

Query: 335 STSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDA 394
           STSKGVSGECGQRGGYMELVGF+ +++QV LKLASISLCPVVTGQAL+DLMV PP+KG+ 
Sbjct: 391 STSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPPQKGEE 450

Query: 395 SYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAES 454
           SYEQD++ER +IH  LHKR+ LL+ AF  ++G+SCQ+PQGAMYLFPKLEL  KAI +A  
Sbjct: 451 SYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYKAIQEALH 510

Query: 455 AGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKF 512
             ++PDE+YCK LLE TGICTVPGSGFGQ PGT+HLRTTFLAPGT+WI+ W  FH++F
Sbjct: 511 QDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVDFHQEF 568

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/481 (68%), Positives = 392/481 (81%), Gaps = 2/481 (0%)

Query: 40  TLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLT 99
           TL ++N+ VL AKYAVRG IP+RAEELK +L E+P SLPFD I+NANIGNPQQL+QKPL+
Sbjct: 88  TLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQLNQKPLS 147

Query: 100 FYRQVLALLQNPDLIS-DLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFR 158
           FYRQVL+LLQ P+++  D S       FK DA+ERAK +L ++GG+VGAYS SQGV G R
Sbjct: 148 FYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSASQGVYGIR 207

Query: 159 ESVAEFIEERD-GEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASL 217
           ++VA FI +RD GEPA  +DIFLT GAS AV Y+LS+ C GPE G LIPIPQYPLYTASL
Sbjct: 208 KTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASL 267

Query: 218 ALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTI 277
           ALNNSHALPYYLDE+SGWS + ++IE+VV  +  K IRP+ LVVINPGNPTGA+L+  +I
Sbjct: 268 ALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVLSEKSI 327

Query: 278 ENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTS 337
           E++ ++AAKY +V+IADEVYQEN FN+ +F SMKKVLR LQK  PG YD VQLASLHSTS
Sbjct: 328 EHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLASLHSTS 387

Query: 338 KGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASYE 397
           KGVSGECGQRGGYMEL GF+ EV+ V LKLASISLCPVVTGQAL+DLMV PPKKGD S+E
Sbjct: 388 KGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPPKKGDESFE 447

Query: 398 QDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAGL 457
           QD+ ER  I   LH R+  LY+ F ++EG+ CQ+PQGAMYLFP+L+L  KA+ KA+   +
Sbjct: 448 QDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAVQKAQHLEM 507

Query: 458 APDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDHR 517
           +PDE+YCK LLEATGICTVPGSGFGQ PGT+HLRTTFLAPGTEWI+ WK FH+ F   +R
Sbjct: 508 SPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFHQDFYNTYR 567

Query: 518 D 518
           D
Sbjct: 568 D 568

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/506 (65%), Positives = 406/506 (80%), Gaps = 4/506 (0%)

Query: 17  LRHLSTRP--GLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEP 74
           LRHL+  P   L+   ++     + TL+D+NE VL AKYAVRG IP+RAEELK +L ++P
Sbjct: 87  LRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDP 146

Query: 75  GSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGEL-HKFFKPDAVER 133
            SLPFD+IINANIGNPQQL QKPLT+YRQVL+LLQ P+L++      +  K FK DA++R
Sbjct: 147 QSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKR 206

Query: 134 AKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYIL 192
           AK +++ +GGSVGAYS+SQGV G R+SVAEFI +RD GE +  +DIFLT GAS AV+Y+L
Sbjct: 207 AKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLL 266

Query: 193 SLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKK 252
           S+FC GPE G LIPIPQYPLYTA+LALNNS ALPYYLDE SGWS + E+IE VV+++I+ 
Sbjct: 267 SIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQN 326

Query: 253 GIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKK 312
            I+PT LVVINPGNPTGA+L+ ++I  + +VAAKY  V+IADEVYQEN F   +F SMKK
Sbjct: 327 EIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKK 386

Query: 313 VLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISL 372
           +LR LQ+  PGK+DNVQLASLHSTSKGVSGECGQRGGYMEL GFS E++QV LKLASISL
Sbjct: 387 ILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISL 446

Query: 373 CPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEP 432
           CPVVTGQAL+DLMVRPP +G+ S+E D+ ER  IH+ L  R+  LY+ F S+EG+ CQ+P
Sbjct: 447 CPVVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKP 506

Query: 433 QGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRT 492
           QGAMYLFPK++L  KA+ +A    L PDE+YCK+LLE+TGICTVPGSGFGQ PGT+HLRT
Sbjct: 507 QGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRT 566

Query: 493 TFLAPGTEWIDSWKKFHEKFTEDHRD 518
           TFLAPG EWI  W+ FH++F + +RD
Sbjct: 567 TFLAPGLEWIKKWESFHKEFFDQYRD 592

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/507 (65%), Positives = 407/507 (80%), Gaps = 6/507 (1%)

Query: 17  LRHLSTRP--GLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEP 74
           LRHL+  P   L+   ++     + TL D+NE VL A+YAVRG IP+RAEELK +L ++P
Sbjct: 87  LRHLNRFPHHTLKTANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDP 146

Query: 75  GSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGEL--HKFFKPDAVE 132
            SLPF+KIINANIGNPQQL QKPLT+YRQVL+LLQ P+L++  +  EL   K FK DA++
Sbjct: 147 QSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNH-NEQELVGSKLFKIDAIK 205

Query: 133 RAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDG-EPASAQDIFLTTGASGAVSYI 191
           RAK ++K +GGSVGAYS+SQGV G R+SVA+FI +RDG E A  +DIFLT GAS AV+Y+
Sbjct: 206 RAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYL 265

Query: 192 LSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIK 251
           LS+FC GPE G LIPIPQYPLYTA+LALNNS  LPYYLDE SGWS + E+IE VV+++I+
Sbjct: 266 LSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQ 325

Query: 252 KGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMK 311
             I+PT LVVINPGNPTGA+L+ ++I  + +VAAKY  V+IADEVYQEN F   EF SMK
Sbjct: 326 NEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMK 385

Query: 312 KVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASIS 371
           KVLR LQ+  PGK+DNVQLASLHSTSKGVSGECGQRGGYMEL GFS E++QV LKLASIS
Sbjct: 386 KVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASIS 445

Query: 372 LCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQE 431
           LCPVVTGQAL+DLMVRPP +G+ S+E D+ ER  IH+ L+ R+  LY+ F S+EG+ CQ+
Sbjct: 446 LCPVVTGQALVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQK 505

Query: 432 PQGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLR 491
           PQGAMYLFPK+++  KAI +A    L PDE+YCK+LLE+TGICTVPGSGFGQ PGT+HLR
Sbjct: 506 PQGAMYLFPKIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLR 565

Query: 492 TTFLAPGTEWIDSWKKFHEKFTEDHRD 518
           TTFLAPG EW+  W+ FH++F + +RD
Sbjct: 566 TTFLAPGVEWMKKWEIFHKEFFDQYRD 592

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/482 (66%), Positives = 393/482 (81%), Gaps = 4/482 (0%)

Query: 41  LQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLTF 100
           + D+NE VL AKYAVRG IP+RAE+L+ +L E+P SLPFDKIINANIGNPQQL+QKPL+F
Sbjct: 110 IADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQLNQKPLSF 169

Query: 101 YRQVLALLQNPDLISDL--SSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFR 158
           YRQVL+LLQ P+L++ L  +       +K DAV RA+K+L+ +GGSVGAYS SQGV G R
Sbjct: 170 YRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYSTSQGVMGIR 229

Query: 159 ESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASL 217
           ++VA+FI  RD  EPA  +DIFLT GAS AVSY+LS+FC G + G LIPIPQYPLYTA+L
Sbjct: 230 KTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYPLYTATL 289

Query: 218 ALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTI 277
           ALNNSH LPYYLDE+SGWS +T++I+ VV D+I + I+P+ LVVINPGNPTGA+L+   I
Sbjct: 290 ALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAVLSEKAI 349

Query: 278 ENVIKVAAKYSMVIIADEVYQENGFN-DAEFVSMKKVLRVLQKTEPGKYDNVQLASLHST 336
             + ++AAKY +V+IADEVYQEN F+ D +F SMKKVLR LQ+  PGK+D VQLASLHST
Sbjct: 350 AEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQLASLHST 409

Query: 337 SKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASY 396
           SKGVSGECGQRGG+MEL GFS E++QV LKLASISLCPVVTGQAL+DLMV PP++G+ SY
Sbjct: 410 SKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHPPQEGEESY 469

Query: 397 EQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAG 456
           E D+ ER  IH  LHKR+  L++ F  +EG+ CQ+PQGAMYLFP+L L  KA+ KA+   
Sbjct: 470 ELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKAVQKAQHME 529

Query: 457 LAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDH 516
           +  DE+YCKELLE TGICTVPGSGFGQVPGT+HLRTTFLAPGTEWID W+KFH++F   +
Sbjct: 530 MTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKFHKEFYNKY 589

Query: 517 RD 518
           RD
Sbjct: 590 RD 591

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/506 (65%), Positives = 403/506 (79%), Gaps = 4/506 (0%)

Query: 17  LRHLSTRP--GLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEP 74
           LRHL+  P   L+          + TL+D+NE VL AKYAVRG IP+RAEELK +L ++P
Sbjct: 87  LRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDP 146

Query: 75  GSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGEL-HKFFKPDAVER 133
            SLPFDKIINANIGNPQQL QKPLT+YRQVL+LLQ P+L++      +  K FK DA++R
Sbjct: 147 QSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKR 206

Query: 134 AKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYIL 192
           AK +++ +GGSVGAYS+SQGV G R+SVAEFI +RD GE +  +DIFLT GAS AV+Y+L
Sbjct: 207 AKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLL 266

Query: 193 SLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKK 252
           S+FC GPE G LIPIPQYPLYTA+LALNNS ALPYYLDE+SGWS + E+IE VV+++I+ 
Sbjct: 267 SIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQN 326

Query: 253 GIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKK 312
            I+PT LVVINPGNPTGA+L+ +++  + +VAAKY  V+IADEVYQEN F   +F SMKK
Sbjct: 327 EIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKK 386

Query: 313 VLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISL 372
           +LR LQ+  PGK+DNVQLASLHSTSKGVSGECGQRGGYMEL GFS E++QV LKLASISL
Sbjct: 387 ILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISL 446

Query: 373 CPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEP 432
           CPVVTGQAL+DLMVRPP +G+ S+E D+ ER  IH+ L  R+  LY  F S+EG+ CQ+P
Sbjct: 447 CPVVTGQALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKP 506

Query: 433 QGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRT 492
           QGAMYLFPK++L  KA+ +A    L PDE+YCK LLE+TGICTVPGSGFGQ PGT+HLRT
Sbjct: 507 QGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRT 566

Query: 493 TFLAPGTEWIDSWKKFHEKFTEDHRD 518
           TFLAPG EWI  W+ FH++F + +RD
Sbjct: 567 TFLAPGLEWIKKWETFHKEFFDQYRD 592

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/506 (64%), Positives = 404/506 (79%), Gaps = 4/506 (0%)

Query: 17  LRHLSTRP--GLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEP 74
           LRHL+  P   L+   ++     + TL D+NE VL AKYAVRG IP+RAEELK +L ++P
Sbjct: 87  LRHLNRFPHHTLKTSNNEFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDP 146

Query: 75  GSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGEL-HKFFKPDAVER 133
            SLPF+KIINANIGNPQQL QKPLT+YRQVL+LLQ P+L++      +  K FK DA++R
Sbjct: 147 QSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKR 206

Query: 134 AKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYIL 192
           AK +++++GGSVGAYS+SQGV G R SVAEFI +RD GE +  +DIFLT GAS AV+Y+L
Sbjct: 207 AKSLMEEIGGSVGAYSSSQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLL 266

Query: 193 SLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKK 252
           S+FC GPE G LIPIPQYPLYTA+LALNNS ALPYYLDE SGWS + E+IE VV+++I+ 
Sbjct: 267 SIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIEN 326

Query: 253 GIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKK 312
            I+ T LVVINPGNPTGA+L+ ++I  + +VAAKY  V+IADEVYQEN F   +F SMKK
Sbjct: 327 EIKSTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKK 386

Query: 313 VLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISL 372
           +LR LQ+  PGK+DNVQLASLHSTSKGVSGECGQRGGYMEL GFS E++QV LKLASISL
Sbjct: 387 ILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISL 446

Query: 373 CPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEP 432
           CPVVTGQAL+DLMVRPP +G+ S+E D+ ER  IH+ L  R+  LY+ F S+EG+ CQ+P
Sbjct: 447 CPVVTGQALVDLMVRPPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKP 506

Query: 433 QGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRT 492
           QGAMYLFPK++L  +A+ +A    L PDE+YCK+LLE+TGICTVPGSGFGQ PGT+HLRT
Sbjct: 507 QGAMYLFPKIDLPFRAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRT 566

Query: 493 TFLAPGTEWIDSWKKFHEKFTEDHRD 518
           TFLAPG EWI  W+ FH++F + +RD
Sbjct: 567 TFLAPGLEWIKKWETFHKEFFDHYRD 592

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/504 (63%), Positives = 400/504 (79%), Gaps = 5/504 (0%)

Query: 17  LRHLSTRPGLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGS 76
           + H S +    KD++      + TL D+NE VL AKYAVRG IP+RAEELK +L   P +
Sbjct: 88  ISHHSLKVAKGKDFAP---AEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPST 144

Query: 77  LPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGELH-KFFKPDAVERAK 135
           LPF +I+NANIGNPQQL QKPL+FYRQVL++LQ PD++ +     +  K +K DA++RAK
Sbjct: 145 LPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAK 204

Query: 136 KMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSL 194
            +L ++GGSVGAYS SQGV G R++VA FI ERDG EPA  +DIFLT        Y+LS+
Sbjct: 205 LLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSI 264

Query: 195 FCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGI 254
            C GP+ G LIPIPQYPLYTA+LALNNSHALPYYLDE+SGWS + ++IE+VVQD++++ I
Sbjct: 265 LCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAI 324

Query: 255 RPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVL 314
            P+ LVVINPGNPTGA+L  ++IE++ ++AAKY +V+IADEVYQEN  +  +F SMKKVL
Sbjct: 325 NPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVL 384

Query: 315 RVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCP 374
           R LQK+ PGK+DNVQLASLHSTSKGVSGECGQRGGYMEL+GF+ EV++V LKLASISLCP
Sbjct: 385 RKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCP 444

Query: 375 VVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQG 434
           VVTGQAL+DLMV PPKKGDASYEQD+ ER  I   L  R+  LY+ F  +EG+ CQ+PQG
Sbjct: 445 VVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQG 504

Query: 435 AMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTF 494
           AMYLFPKL+L  KA+ +A+   + PDE+YCK LL+ATGICTVPGSGFGQ PGT+HLRTTF
Sbjct: 505 AMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTF 564

Query: 495 LAPGTEWIDSWKKFHEKFTEDHRD 518
           LAPGTEWI  W+ FH++F +++RD
Sbjct: 565 LAPGTEWIKKWEAFHKEFYDNYRD 588

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/483 (66%), Positives = 388/483 (80%), Gaps = 2/483 (0%)

Query: 38  KKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKP 97
           K  L ++NE VL AKYAVRG IP+ A EL  KL ++P SLPFD I++ANIGNPQ L QKP
Sbjct: 52  KLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLKQKP 111

Query: 98  LTFYRQVLALLQNPDLISDLSSGEL-HKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAG 156
           LTFYRQVL+LLQ P L+ +     +  K ++ DA+ RA+++L  +G SVGAYS SQG+ G
Sbjct: 112 LTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQGIQG 171

Query: 157 FRESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTA 215
            RE+VA+FI ERDG E A A+DIFLT GAS AVSY+LS+ C G E G LIPIPQYPLYTA
Sbjct: 172 IRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTA 231

Query: 216 SLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTD 275
           SLALNNSH LPYYLDE+SGWS +  +IE VV ++I++ I+P+ LVVINPGNPTGA+L+ +
Sbjct: 232 SLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEE 291

Query: 276 TIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHS 335
            I  +  +AAKY +V+IADEVYQEN F+ AEF SMKK+LR LQK+ PG +DNVQLASLHS
Sbjct: 292 DISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLASLHS 351

Query: 336 TSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDAS 395
           TSKGVSGECGQRGGYME+ GF+ +++QV LKLASISLCPVVTGQAL+DLMV PPK GD S
Sbjct: 352 TSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPGDES 411

Query: 396 YEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESA 455
           YE D+QER  IH+AL +R+G L+  F S+EG+ CQ+P+GAMYLFP+L L  KAI  AE  
Sbjct: 412 YELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSAEHE 471

Query: 456 GLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTED 515
           G+ PD +YCK+LLEATGICTVPGSGFGQ PGT+HLRTTFLAPGTEWI+ W+ FH+ F E+
Sbjct: 472 GMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAFYEE 531

Query: 516 HRD 518
           +RD
Sbjct: 532 YRD 534

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/506 (64%), Positives = 398/506 (78%), Gaps = 8/506 (1%)

Query: 14  RLVLRHLSTRPGLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEE 73
           R+ +R L+    L +         K  + D+N+ VL AKYAVRG IPLRAEELK   LE 
Sbjct: 14  RVGVRRLTLSTTLYEHKHNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKL-YLEA 72

Query: 74  PGSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGELHKFFKPDAVER 133
              LPFD +INANIGNPQQL QKPLTFYRQVL++LQ P+L   L SG     FK DA+ER
Sbjct: 73  GQKLPFDTVINANIGNPQQLKQKPLTFYRQVLSILQYPEL---LESGS--NIFKKDAIER 127

Query: 134 AKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYIL 192
           A+K+LK++G SVG+YS+SQG+   R++VA FI +RD GE ++  DIFLT GAS AV Y+L
Sbjct: 128 ARKLLKEIG-SVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLL 186

Query: 193 SLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKK 252
           S+ C   ++G LIPIPQYPLYTA+LALNN+HALPYYLDE  GWS D  +IE+V+ DS+ K
Sbjct: 187 SILCKNEKSGVLIPIPQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDK 246

Query: 253 GIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKK 312
           GI+PT LV+INPGNPTG++L+ +++E +I+VAA + +VIIADEVYQEN FN+A+F SMKK
Sbjct: 247 GIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKK 306

Query: 313 VLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISL 372
           VLR LQK  PG+YD VQLASLHSTSKGVSGECGQRGGYMEL GF+ E+KQV LKL SISL
Sbjct: 307 VLRNLQKAFPGEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISL 366

Query: 373 CPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEP 432
           CPVVTGQAL+DLMV PP+KGD SYEQD+ ER  I + L  R+ LL++AF SMEGVSCQ+P
Sbjct: 367 CPVVTGQALVDLMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKP 426

Query: 433 QGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRT 492
           +GAMYLFPK++L  K + K++   + PDE+YCK LLEATGICTVPGSGFGQ PGT+HLRT
Sbjct: 427 EGAMYLFPKIDLPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRT 486

Query: 493 TFLAPGTEWIDSWKKFHEKFTEDHRD 518
           TFLAPGTEWID W KFH +F + +RD
Sbjct: 487 TFLAPGTEWIDRWNKFHAEFYDKYRD 512

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/512 (63%), Positives = 400/512 (78%), Gaps = 12/512 (2%)

Query: 8   RSMPHSRLVLRHLSTRPGLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELK 67
           R +  + + L+H + +P             K T+ D+NE VL AKYAVRG IP RAE LK
Sbjct: 22  RLLSLTTISLKHKNFKPA-----------DKLTINDLNENVLKAKYAVRGKIPARAEVLK 70

Query: 68  QKLLEEPGSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGELHKFFK 127
           Q+L++ P SLPF K+INANIGNPQQL+QKPLTFYRQVL+LLQ P ++ +  SG     +K
Sbjct: 71  QQLIDNPSSLPFKKVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYK 130

Query: 128 PDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDG-EPASAQDIFLTTGASG 186
            DA+ERAK++L  +G SVG+YS+SQGV G R++VAE+I  RDG E A A+DIFLT GAS 
Sbjct: 131 QDAIERAKRILNDIGSSVGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASS 190

Query: 187 AVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVV 246
           AVSY+L++ C G E+G LIPIPQYPLYTA+LALNN++ALPYYL+E SGWS + E+IE VV
Sbjct: 191 AVSYLLNILCKGKESGVLIPIPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVV 250

Query: 247 QDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAE 306
            ++I++ I P  LVVINPGNPTGA+L+ ++IE +  VAA + +V+IADEVYQEN F   E
Sbjct: 251 HNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNE 310

Query: 307 FVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLK 366
           F SMKKVLR LQ+  PGKY+NVQLASLHSTSKGVSGECGQRGGYMEL GFS E+K   LK
Sbjct: 311 FHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILK 370

Query: 367 LASISLCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEG 426
           L SISLCPVVTGQAL+DLM  PPKKG+ASYEQD+ ER  IH  L++R+  L++AF  MEG
Sbjct: 371 LCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEG 430

Query: 427 VSCQEPQGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPG 486
           VSCQ+PQG+MYLFPK+++ +KA+ KA+   + PDE YC ELLEATGICTVPGSGFGQ PG
Sbjct: 431 VSCQKPQGSMYLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPG 490

Query: 487 TFHLRTTFLAPGTEWIDSWKKFHEKFTEDHRD 518
           TFHLRTTFLAPGT WID W++FH+ F   +RD
Sbjct: 491 TFHLRTTFLAPGTSWIDQWREFHQIFCNKYRD 522

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/482 (62%), Positives = 390/482 (80%), Gaps = 1/482 (0%)

Query: 38  KKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKP 97
           K +L+DINE V++AK+A+RG I ++AE+L+ +L + P  LPFD+I  ANIGNPQ+L+QKP
Sbjct: 16  KLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQELNQKP 75

Query: 98  LTFYRQVLALLQNPDLISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGF 157
           LTF RQV+++LQ P+L+++       K F  D+ +RA+++L+ +GGSVGAYS SQGV G 
Sbjct: 76  LTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSASQGVYGI 135

Query: 158 RESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTAS 216
           R++ AE+I +RDG EP+  +DIFLTTGA+ A SY+LS+ C GP+ G LIPIPQYPLYTA+
Sbjct: 136 RKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTAT 195

Query: 217 LALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDT 276
           LALN S  +PYYLDEES WS +T +IEK+V DSIKKGI+P+ +VVINPGNPTGA+L+   
Sbjct: 196 LALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLSELA 255

Query: 277 IENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHST 336
           I  + ++AAKY +V++ADEVYQEN F+  +F S KKVLR LQK  PGK+DN+QLAS+HST
Sbjct: 256 IAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLASMHST 315

Query: 337 SKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASY 396
           SKGV GECGQRGGYMELVGF++EV+Q+ LKLA +++C VVTGQA++DLM+ PPKKGDASY
Sbjct: 316 SKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPKKGDASY 375

Query: 397 EQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAG 456
           E D++ER +I DA+++R+  LY  F  ++G+ CQ+PQGAMYL+P L LS KAI KAES  
Sbjct: 376 ELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAIAKAESLN 435

Query: 457 LAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDH 516
           L PDE+YC ELL+ATGICTVPGSGFGQ  GT+HLRTTFLAPG EWI+ W+KFH+ F E +
Sbjct: 436 LTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFHKHFYEKY 495

Query: 517 RD 518
           +D
Sbjct: 496 QD 497

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/486 (65%), Positives = 393/486 (80%), Gaps = 3/486 (0%)

Query: 33  KPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQ 92
           KP G + T+ D+NE VL AKYAVRG IP RAEELK++L E+P SLPFDKIINANIGNPQQ
Sbjct: 53  KPAG-QLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQQ 111

Query: 93  LDQKPLTFYRQVLALLQNPDLISDLSSGE-LHKFFKPDAVERAKKMLKQVGGSVGAYSNS 151
           L Q+PL+FYRQVL+LLQ P L+  + +       +K DA+ RAKK+LK +GGSVGAYS S
Sbjct: 112 LQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAYSES 171

Query: 152 QGVAGFRESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQY 210
           QGV G R +VA FI ERDG EPA  +DIFLT GAS AV+Y+LS+ C G + G LIPIPQY
Sbjct: 172 QGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQY 231

Query: 211 PLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGA 270
           PLYTA+LALNNSHALPY+LDE +GWS++  +IE V++ +++  I+P  LVVINPGNPTGA
Sbjct: 232 PLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGA 291

Query: 271 LLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQL 330
           +L+ + I +++++AAKY +V+IADEVYQEN F+  +F S+K VLR LQ+  PGK+DNVQL
Sbjct: 292 VLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQL 351

Query: 331 ASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPK 390
           ASLHSTSKGVSGECGQRGGYME++GF+ EV+QV LKLASISLCPVVTGQAL+DLMV PPK
Sbjct: 352 ASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPK 411

Query: 391 KGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIH 450
           +G+ S+  D+ +R  IH  L +R+ LL++ F S++G+ CQ+P GAMYLFPKL L  +AI 
Sbjct: 412 RGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYRAIQ 471

Query: 451 KAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHE 510
           +A+   L+PDE+YCKELLE TGICTVPGSGFGQV GT+HLRTTFLAPG EWIDSWK+FH 
Sbjct: 472 EAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQFHI 531

Query: 511 KFTEDH 516
           +F E +
Sbjct: 532 EFMEKY 537

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/495 (61%), Positives = 382/495 (77%), Gaps = 3/495 (0%)

Query: 26  LRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINA 85
           + KD   KP  +K T +D+N  V  A+YAVRG IP RA+ELK++L + PG LPFD IINA
Sbjct: 14  IAKDLDFKP-AAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINA 72

Query: 86  NIGNPQQLDQKPLTFYRQVLALLQNPDLIS-DLSSGELHKFFKPDAVERAKKMLKQVGGS 144
           NIGNPQQLDQKPLTF RQVL++L+ P+++  D         F  DA++RA+ +LK +GGS
Sbjct: 73  NIGNPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGS 132

Query: 145 VGAYSNSQGVAGFRESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSLFCNGPENGA 203
           VGAYS+SQGV G R++VA+FI  RDG EPA+ +DI+LTTGAS A + +LSL C     G 
Sbjct: 133 VGAYSHSQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGL 192

Query: 204 LIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVIN 263
           LIPIPQYPLYTAS +L N+  LPYYLDEE  WS ++++IEKVVQD+++KGIRP+ L+VIN
Sbjct: 193 LIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVIN 252

Query: 264 PGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPG 323
           PGNPTGA+L  +TI  +  +AAKY + +I+DEVYQEN FND +F SMKKVLR LQ   PG
Sbjct: 253 PGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPG 312

Query: 324 KYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALID 383
           K+DNVQLASLHS SKG  GECGQRGGYME+VGFS++++    KL SIS+C VVTGQA++D
Sbjct: 313 KFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVD 372

Query: 384 LMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLE 443
           LMV PP+ GD SYEQDRQER  I + +  R+ LLY+ F  +EG+ CQ PQGAMYLFP+L 
Sbjct: 373 LMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLI 432

Query: 444 LSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWID 503
           L +KA  ++E  G+ PDE+YC  LLE+TGICTVPGSGFGQ PGT+H+RTTFLAPGT+WI 
Sbjct: 433 LPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQ 492

Query: 504 SWKKFHEKFTEDHRD 518
           +WK FH+ F  ++RD
Sbjct: 493 NWKNFHQSFFNEYRD 507

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/491 (62%), Positives = 385/491 (78%), Gaps = 1/491 (0%)

Query: 28  KDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANI 87
           KD S+       TL D+NE V+ AKYAVRG IP RAEEL+++L E PGSLPF KII ANI
Sbjct: 32  KDGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANI 91

Query: 88  GNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGA 147
           GNPQQL QKPLTFYRQV++L+QNP L+ ++ +  L + FK D V RA++ML+  GGSVGA
Sbjct: 92  GNPQQLGQKPLTFYRQVISLMQNPQLL-EMPAEWLQQAFKADVVVRARRMLQDAGGSVGA 150

Query: 148 YSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPI 207
           YS SQGV G+R +VA+FIE RDG PA+  +++LT GAS AVS +LS FC GPE G LIPI
Sbjct: 151 YSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPI 210

Query: 208 PQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNP 267
           PQYPLYTA++  NN+ ALPYYL+E  GWS + +++E+V+ DS K+ I P CLVVINPGNP
Sbjct: 211 PQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNP 270

Query: 268 TGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDN 327
           TG++L+   +E ++ +AAKY +V+IADEVYQ+N F DA+F SM+KVL+ LQ  EP  Y N
Sbjct: 271 TGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKN 330

Query: 328 VQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVR 387
           VQLASLHS SKG+SGECGQRGGYMEL+GF EE+++VF+KLASISLCPVVTGQAL+DLMV 
Sbjct: 331 VQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVG 390

Query: 388 PPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNK 447
           PP +GD SYEQ  QE   I+  L +RS LL++ F S+EG+ C  PQGA+YLFPKL L  K
Sbjct: 391 PPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQK 450

Query: 448 AIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKK 507
           AI  A+  G+  DE YC ELL+ TGICTVPG+GFGQ+PGT+H+RTTFL PGT+WI+SWK 
Sbjct: 451 AIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKD 510

Query: 508 FHEKFTEDHRD 518
           FH+KF + +RD
Sbjct: 511 FHKKFYDKYRD 521

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/513 (59%), Positives = 394/513 (76%), Gaps = 5/513 (0%)

Query: 6   IIRSMPHSRLVLRHLSTRPGLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEE 65
           ++  +PH+ + LR +S+     +     PL     L+D+N  VL AKYAVRG IP RA E
Sbjct: 27  VLHGLPHATMGLRSISSGTSRIRFEPGDPL----KLEDLNSNVLEAKYAVRGKIPARAME 82

Query: 66  LKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGELHKF 125
           L+++L  +P SLPF KII ANIGNPQQL QKPL+F R+VL+LL++P+L+  +    L+  
Sbjct: 83  LERQLSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLL-QMPMEVLNLI 141

Query: 126 FKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGAS 185
           +KPDAV RAK+M++ +  S+GAYS+SQGV GFR++VAE++  RDGEPASA+DIFLTTGAS
Sbjct: 142 YKPDAVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGAS 201

Query: 186 GAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKV 245
              S ++ L C G E+G LIPIPQYPLYTA++ LNN+ ALPYYLDEESGWS++ + +E++
Sbjct: 202 NGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERI 261

Query: 246 VQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDA 305
           + +SI+KG++P CLVVINPGNPTGA+L  +++E +  +AAKYS+V+IADEVYQEN F   
Sbjct: 262 IIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGL 321

Query: 306 EFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFL 365
           +F SMKKVLR LQ+     + NVQL SLHSTSKG+SGECGQRGGYMELVGFS+++++V L
Sbjct: 322 KFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVIL 381

Query: 366 KLASISLCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSME 425
           K+ASI LC  V GQAL+DLM+  PK GD SYE+D  ER  I +AL +RS  L++ F ++E
Sbjct: 382 KMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLE 441

Query: 426 GVSCQEPQGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVP 485
           GV C++PQG+MYLFP+L L  KAI  AES  + PDE+YC ELL +TGICTVPGSGFGQ P
Sbjct: 442 GVECRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAP 501

Query: 486 GTFHLRTTFLAPGTEWIDSWKKFHEKFTEDHRD 518
            T HLRTTFL PGTEWI+SW+ FH+ F + +RD
Sbjct: 502 DTCHLRTTFLCPGTEWIESWELFHKSFYDKYRD 534

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/496 (61%), Positives = 385/496 (77%), Gaps = 9/496 (1%)

Query: 28  KDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANI 87
           KD   KP G K T +D+N  V  A+YAVRG IP RA+ELK++L + P  LPFD IINANI
Sbjct: 16  KDLDFKPAG-KITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANI 74

Query: 88  GNPQQLDQKPLTFYRQVLALLQNPDLI----SDLSSGELHKFFKPDAVERAKKMLKQVGG 143
           GNPQQLDQKPLTF RQVLA+L+ P+++    ++L+S  L   F  DA+ERA+++L  +GG
Sbjct: 75  GNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNL---FSRDALERAERLLNDIGG 131

Query: 144 SVGAYSNSQGVAGFRESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSLFCNGPENG 202
           S+GAYS+SQGV G R++VA+FI  RDG EPA+ +DI+LTTGAS A + +LSL C   + G
Sbjct: 132 SIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTG 191

Query: 203 ALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVI 262
            LIPIPQYPLYTAS +L N+  LPYYLDEES WS ++++IEKVVQD++KK IRP+ L+VI
Sbjct: 192 LLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVI 251

Query: 263 NPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEP 322
           NPGNPTGA+L+ +TI  +  +AAKY + II+DEVYQEN FND +F SMKKVLR LQ   P
Sbjct: 252 NPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYP 311

Query: 323 GKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALI 382
           GK+DNVQLASLHS SKG   ECGQRGGYME++GFS+E++    KL SIS+C VVTGQA++
Sbjct: 312 GKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVV 371

Query: 383 DLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKL 442
           DLMV+PP+ GD SYEQD  ER  I   +  R+ LLY+ F+ +EG+ CQ+PQGAMYLFP+L
Sbjct: 372 DLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRL 431

Query: 443 ELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWI 502
            L  KA+ ++E  G+ PDE+YC  LLE+TGICTVPGSGFGQ PGT+H+RTTFLAPGT+WI
Sbjct: 432 VLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWI 491

Query: 503 DSWKKFHEKFTEDHRD 518
             WK+FH+ F   +R+
Sbjct: 492 QDWKEFHQDFFSKYRN 507

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/496 (60%), Positives = 385/496 (77%), Gaps = 9/496 (1%)

Query: 28  KDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANI 87
           KD + KP  +K T +D+N  V  A+YAVRG IP RA+ELK++L  +PG LPFD IINANI
Sbjct: 16  KDLNFKP-AAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANI 74

Query: 88  GNPQQLDQKPLTFYRQVLALLQNPDLI----SDLSSGELHKFFKPDAVERAKKMLKQVGG 143
           GNPQQLDQKPLTF RQVL++L+ P+++      L+S  L   F+ DA+ RA+ +L+ +GG
Sbjct: 75  GNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNL---FRKDALGRAEHLLEDIGG 131

Query: 144 SVGAYSNSQGVAGFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYILSLFCNGPENG 202
           S+GAYS+SQGV G R+SVAEFI +RD GEPA+ ++I+LTTGAS A + +LSL C   + G
Sbjct: 132 SIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTG 191

Query: 203 ALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVI 262
            LIPIPQYPLYTAS +L N+  LPYYLDE S WS  +++IEKVV+D+++KGI+P+ L+VI
Sbjct: 192 LLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVI 251

Query: 263 NPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEP 322
           NPGNPTGA+L+ DTI  +  +AAKY + II+DEVYQEN FN  +F SMKKVLR LQ+  P
Sbjct: 252 NPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYP 311

Query: 323 GKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALI 382
           GK+DNVQLASLHS SKG  GECGQRGGYME+VGFS++++    KL SIS+C VVTGQA++
Sbjct: 312 GKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVV 371

Query: 383 DLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKL 442
           DLMV+PP+ GD SY+QD  ER  I   ++ R+ LL++ F  +EG+ CQ+PQGAMYLFP+L
Sbjct: 372 DLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRL 431

Query: 443 ELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWI 502
            L  KA+ ++E  G+ PDE+YC  LLE+TGICTVPGSGFGQ PGT+H+RTTFLAPGT+WI
Sbjct: 432 VLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWI 491

Query: 503 DSWKKFHEKFTEDHRD 518
             WK FH+ F   +RD
Sbjct: 492 QDWKHFHQDFFNKYRD 507

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/478 (62%), Positives = 372/478 (77%), Gaps = 2/478 (0%)

Query: 43  DINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLTFYR 102
           D+N+ +++A+YAVRG IP++AEEL+ +L ++P  LPF+ I  ANIGNPQQLDQKPLTF R
Sbjct: 44  DLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQLDQKPLTFSR 103

Query: 103 QVLALLQNPDLISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVA 162
           QV+++LQ P L+           +K DA +RA  +L+Q+GGSVGAYS +QGV G RESVA
Sbjct: 104 QVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQGVYGIRESVA 163

Query: 163 EFIEERD-GEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNN 221
           +FI  RD GE AS  DIFLT GAS A +Y+LS+ C     G +IPIPQYPLYTAS+ + N
Sbjct: 164 DFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYN 223

Query: 222 SHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVI 281
           S  LPYYLDEESGWS   E+IE+ V DSIK+G+ P  +VVINPGNPTGA+L+ DTI  ++
Sbjct: 224 SVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQIL 283

Query: 282 KVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEP-GKYDNVQLASLHSTSKGV 340
            +AAKY +V++ADEVYQ N +   +F SMKKVLR LQ+  P G+YDNVQLAS+HSTSKGV
Sbjct: 284 TIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKGV 343

Query: 341 SGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASYEQDR 400
           SGECGQRGGYMELVGFS EV+QV LKLASIS+C VVTGQAL+DLM+ PP++GD SYE D 
Sbjct: 344 SGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPREGDDSYELDV 403

Query: 401 QERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAGLAPD 460
           +ER +IH+ +  R  LLY  FQ +EG+ CQEPQGAMYLFPKL LS KAI +A+S GL PD
Sbjct: 404 RERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEEAKSLGLQPD 463

Query: 461 EYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDHRD 518
           E+YC  LL+ TGICTVPGSGFGQ  GT+H+RTTFLAPGT+WI  W+ FH+ F + +RD
Sbjct: 464 EFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHKAFYDKYRD 521

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/493 (59%), Positives = 375/493 (76%), Gaps = 3/493 (0%)

Query: 28  KDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANI 87
           KD   KP  +K T +D+N  V  A+YAVRG IP RAEELK++L     SLPF+ IINANI
Sbjct: 16  KDLDFKP-AAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANI 74

Query: 88  GNPQQLDQKPLTFYRQVLALLQNPDLIS-DLSSGELHKFFKPDAVERAKKMLKQVGGSVG 146
           GNPQQLDQKPLTF RQVL++L+ P+++  D         F  DA++RA+++L  +GGSVG
Sbjct: 75  GNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVG 134

Query: 147 AYSNSQGVAGFRESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSLFCNGPENGALI 205
           AYS+SQGV G R++VA+FI ERDG EPA  +DI+LTTGAS A + +LSL C   + G L+
Sbjct: 135 AYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLLL 194

Query: 206 PIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPG 265
           PIPQYPLYTAS +L N+  LPYYLDEE+ WS ++++IE+VV D++KKGIRP+ LVVINPG
Sbjct: 195 PIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPG 254

Query: 266 NPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKY 325
           NPTGA+L  +TI  +  +AAKY + II+DEVYQEN F D +F SMKK+LR LQ   PGK+
Sbjct: 255 NPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKF 314

Query: 326 DNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLM 385
           DNVQLASLHS SKG  GECGQRGGYME+VGFS++++    KL SIS+C V TGQA+IDLM
Sbjct: 315 DNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLM 374

Query: 386 VRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELS 445
           V+PP+ GD SY+QDR+ER  I++ +  R+ LLY+ F  +EG+ CQ+PQGAMYLFPKL L 
Sbjct: 375 VKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLP 434

Query: 446 NKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSW 505
            KA+ ++E   + PD  YC  LLE+TGICTVPGSGFGQ  GT+H+RTTFL PGT+WI  W
Sbjct: 435 EKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDW 494

Query: 506 KKFHEKFTEDHRD 518
           ++FH+ F   +RD
Sbjct: 495 RQFHQDFFNKYRD 507

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/483 (61%), Positives = 376/483 (77%), Gaps = 4/483 (0%)

Query: 38  KKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLE--EPGSLPFDKIINANIGNPQQLDQ 95
           K ++ D+N+ ++NA+YAVRG I +RAEEL+ +L    +P S PF++II ANIGNPQQLDQ
Sbjct: 29  KISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNPQQLDQ 88

Query: 96  KPLTFYRQVLALLQNPDLISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVA 155
           KPLTF RQV+++L+ P L+           +K DA+ERA+ +  Q+G SVGAYS +QGV 
Sbjct: 89  KPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYSLAQGVY 148

Query: 156 GFRESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYT 214
           G RE+ A FI +RD  E ASA DIFLT GAS AV+Y++   C     G LIPIPQYPLYT
Sbjct: 149 GIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQYPLYT 208

Query: 215 ASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNT 274
           AS+ ++N+  LPYYLDEESGWS   E+IE  V ++I+ GI+P+ +VVINPGNPTGA+L+ 
Sbjct: 209 ASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGAVLSV 268

Query: 275 DTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLH 334
           D I+ +I VAAKY +V+IADEVYQ+N FN  EF SMKK+LR LQK  PGKYDNVQLASLH
Sbjct: 269 DVIQRIITVAAKYGIVLIADEVYQDNIFN-GEFHSMKKILRQLQKKYPGKYDNVQLASLH 327

Query: 335 STSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDA 394
           STSKGVSGECGQRGGYME+VGFS+EV+ + LKLASI++C VVTGQAL+DLMV PP  GD 
Sbjct: 328 STSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDPPHVGDE 387

Query: 395 SYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAES 454
           SYE+D++ER +IH  L KR+  LY  F ++EG+ CQ+PQGAMYLFP+L L ++AI +A+ 
Sbjct: 388 SYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRAIEEAKK 447

Query: 455 AGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTE 514
             +  DE+YC +LLE TGICTVPGSGFGQ  GT+H+RTTFL+PGTEWID WKKFHEKF +
Sbjct: 448 LQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKFHEKFMK 507

Query: 515 DHR 517
           +++
Sbjct: 508 EYQ 510

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/500 (61%), Positives = 377/500 (75%), Gaps = 7/500 (1%)

Query: 18  RHLSTRPGLRKD--YSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLL--EE 73
           ++   R  L  D  ++ KP   K TL D+N+ VL ++YAVRG IP RAEEL+ +LL  + 
Sbjct: 12  QYFPVRKALDDDTIHNFKP-AKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDS 70

Query: 74  PGSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGELHKFFKPDAVER 133
             SL F+ I++ANIGNPQQLDQKPLTF RQV+++LQ P+L++  +       FK DA+ER
Sbjct: 71  SDSLAFENIVHANIGNPQQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMER 130

Query: 134 AKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYIL 192
           A+ +L  +GGSVGAYS+SQGV G RE+VA +I  RD GE AS  DIFLT GAS A SY+L
Sbjct: 131 AETLLCHIGGSVGAYSSSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLL 190

Query: 193 SLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKK 252
           SL C     G LIPIPQYPLYTA++ L ++  LPYYL+EESGWS +T +IEKVV D+I  
Sbjct: 191 SLLCKDKNTGVLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIAD 250

Query: 253 GIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKK 312
            ++P+ +VVINPGNPTG++L+ D I ++I + AKY +V+IADEVYQEN F D EF SMKK
Sbjct: 251 NVKPSVMVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIF-DGEFHSMKK 309

Query: 313 VLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISL 372
           VLR LQK  PGKYD VQLASLHSTSKGVSGECGQRGGYMELVGF +E++Q  LKLASISL
Sbjct: 310 VLRSLQKQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISL 369

Query: 373 CPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEP 432
           C V+TGQAL+DLMV PPKKGD SYE D  ER +IH+ L +R+  LY  F  ++GV CQ+P
Sbjct: 370 CSVITGQALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKP 429

Query: 433 QGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRT 492
           QGAMYLFPKL      I +A +  ++PDE+YC  LLEATGICTVPGSGFGQ  GT+HLRT
Sbjct: 430 QGAMYLFPKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRT 489

Query: 493 TFLAPGTEWIDSWKKFHEKF 512
           TFLAPG +W + WK FHE+F
Sbjct: 490 TFLAPGNQWTEKWKLFHEEF 509

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/482 (60%), Positives = 374/482 (77%), Gaps = 5/482 (1%)

Query: 38  KKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKP 97
           K ++ D+N+  ++A YAVRG IP+RAE+L  +++ +PGSLPFDKII ANIGNPQQ+ QKP
Sbjct: 8   KLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQVGQKP 67

Query: 98  LTFYRQVLALLQNPDLISD---LSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGV 154
           LTF RQVL++L+ P++++D   L        ++ D +ERA+KML  +GGSVGAYS SQGV
Sbjct: 68  LTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYSASQGV 127

Query: 155 AGFRESVAEFIEERDG--EPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPL 212
            GFR++VA+FI +RDG  + AS  DIFLT GAS AV Y+LS+ C+GPE G LIPIPQYPL
Sbjct: 128 LGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQYPL 187

Query: 213 YTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALL 272
           YTA+L L+NS A+PYYL E + WS +T++IE  +++S+  G++P  +V+INPGNPTGA+L
Sbjct: 188 YTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTGAIL 247

Query: 273 NTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLAS 332
           +   + ++I+++AKY + IIADEVYQEN F   EF SM+KVL  LQ   PG YDNVQLAS
Sbjct: 248 SESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQLAS 307

Query: 333 LHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKG 392
           LHSTSKG  GECGQRGGYMEL+GF +EV  + LKLASIS+C VVTGQAL+DL+  PP+ G
Sbjct: 308 LHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTCPPQPG 367

Query: 393 DASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKA 452
           DASY+ D++ER  I   L  R+  LY  F S+EGV CQ PQGAMYLFPKL L +KAI KA
Sbjct: 368 DASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDKAIEKA 427

Query: 453 ESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKF 512
               + PDEYYC+ELL+ATGICTVPGSGFGQ PGT+HLRTTFL PGTEWI+ W++FH++F
Sbjct: 428 LQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWREFHQQF 487

Query: 513 TE 514
            E
Sbjct: 488 YE 489

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/477 (61%), Positives = 367/477 (76%), Gaps = 2/477 (0%)

Query: 42  QDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLTFY 101
           +D+N  V+ AKYAVRG IP  A++LK +LL+ PG+LPF+ +IN+NIGNPQQL QKPL+F 
Sbjct: 87  EDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQKPLSFG 146

Query: 102 RQVLALLQNPDLISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESV 161
           RQVL++L+ P L+    +      + PD++ERAK +L  +G S+GAYSNSQGV G R++V
Sbjct: 147 RQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQGVHGIRQTV 205

Query: 162 AEFIEERD-GEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALN 220
           A+FI  RD GE A   DIFLT GAS AVS ILS+ C G + G LIPIPQYPLYTA+L LN
Sbjct: 206 ADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPLYTATLTLN 265

Query: 221 NSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENV 280
           ++ ALPYYLDE +GWS D  +I KV QDS++ GI+PTCLVVINPGNPTG++L  + I+NV
Sbjct: 266 DATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNV 325

Query: 281 IKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGV 340
             VAAKY +V+IADEVYQ+N F  +EF SMKK+LR+LQK  P KYDN+QLASLHS SKG+
Sbjct: 326 FDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGL 385

Query: 341 SGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASYEQDR 400
            GECG RGGY E +GF+ EVKQV  KL+SISLC  V GQAL+DLM  PPKKG+ SYE D+
Sbjct: 386 LGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGEPSYELDQ 445

Query: 401 QERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAGLAPD 460
            ER  I     KRS  LY+ F S+EGV+CQ+PQGAMY+FP ++L   AI  A++  + PD
Sbjct: 446 HERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQNLDITPD 505

Query: 461 EYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDHR 517
           E+YC+ELL+ATGICTVPGSGFGQ PGT+H+RTTFLAPG EW+  W+KFH +F E +R
Sbjct: 506 EFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFFEKYR 562

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/479 (58%), Positives = 373/479 (77%), Gaps = 4/479 (0%)

Query: 38  KKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKP 97
           K +++D+N  V+ A++AVRG IP++A+EL+ +L + P SLPF++I  ANIGNPQ+L QKP
Sbjct: 18  KLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQELHQKP 77

Query: 98  LTFYRQVLALLQNPDLISDLS--SGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVA 155
           LTF RQV+++LQ P+L++  +  +      +  D+ +RA+K+L ++GGSVGAYS SQGV 
Sbjct: 78  LTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSASQGVY 137

Query: 156 GFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYT 214
           G R+++A +I +RD GE AS  DIF+TTGA+ A SY+LS+  NGP+ G L+PIPQYPLYT
Sbjct: 138 GIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYT 197

Query: 215 ASLALNNSHALPYYLDEESGWSMDTEQIEKVVQ-DSIKKGIRPTCLVVINPGNPTGALLN 273
           A LAL+N+  LPYYL+EESGWS+DT +IEK ++ +++ KGI+P  +V+INPGNPTG++L+
Sbjct: 198 ALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILS 257

Query: 274 TDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASL 333
            D++  +  +AAKY +VIIADEVYQEN FN  +F S KKVLR LQK  P +Y+NVQLASL
Sbjct: 258 EDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASL 317

Query: 334 HSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGD 393
           HSTSKG+ GECGQRGGYME++GF+ +V+ + LKLA I +CPVVTGQA++DLM+ PPK+GD
Sbjct: 318 HSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPKQGD 377

Query: 394 ASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAE 453
            SY+ D  ER  IH+ +  R+  LY  F  MEG+ CQ+PQGAMYLFP+L LS K I +A+
Sbjct: 378 QSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKVIDEAK 437

Query: 454 SAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKF 512
              + PDE+YC ELL  TGICTVPGSGFGQ P T+HLRTTFLAPG +WI+ W+KFH+ F
Sbjct: 438 KFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEKFHKAF 496

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/485 (59%), Positives = 367/485 (75%), Gaps = 4/485 (0%)

Query: 37  SKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQK 96
           +K TL+D+N  ++  +YAVRG IP RAEELK +L ++P SLPF+KIINANIGNPQQL QK
Sbjct: 13  AKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQLGQK 72

Query: 97  PLTFYRQVLALLQNPDLISDLSSGELH---KFFKPDAVERAKKMLKQVGGSVGAYSNSQG 153
           PL+F R+VL++LQ PD++ D S  +     + ++ D V RA+K+L ++GGSVGAYS SQG
Sbjct: 73  PLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYSLSQG 132

Query: 154 VAGFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPL 212
           V G +++VA++I +RD GE A  +DIFLTTGAS AVS+IL +FCNGP  G LIPIPQYPL
Sbjct: 133 VPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPL 192

Query: 213 YTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALL 272
           YTA++ L  + A+ YYL+EE  WS++T ++E  +Q+SIK GI+PT +V+INPGNPTG++L
Sbjct: 193 YTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSIL 252

Query: 273 NTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLAS 332
               I N+I+++AKY ++IIADEVYQEN F+  EF S+KKVLR LQ+   G Y+ VQLAS
Sbjct: 253 TEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETVQLAS 312

Query: 333 LHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKG 392
           LHSTSKG+ GECGQRGGYMEL+G +++V+   +KL SIS+C VVTGQALID++V PP+ G
Sbjct: 313 LHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVSPPRPG 372

Query: 393 DASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKA 452
           D SYE D+ ER +I + L  RS  L+Q F S+EGV C  PQGAMYLFPK     K I  A
Sbjct: 373 DESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQKFIDIA 432

Query: 453 ESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKF 512
           +      D  YCKELLE TGICTVPGSGFGQ P T+HLRTTFL PG  WID W+KFH +F
Sbjct: 433 QKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRKFHTEF 492

Query: 513 TEDHR 517
            E +R
Sbjct: 493 CERYR 497

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/488 (60%), Positives = 362/488 (74%), Gaps = 8/488 (1%)

Query: 38  KKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKP 97
           K +L DINE +L A+YA+RG IP RAEEL  +LLE   SLPF KI+ ANIGNPQQLDQ+P
Sbjct: 13  KFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQLDQQP 72

Query: 98  LTFYRQVLALLQNPDLISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGF 157
           LTF RQV++L+Q PDL+         K +  D++ERA K+L  +GGSVGAYS+SQGV   
Sbjct: 73  LTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSSQGVLDI 132

Query: 158 RESVAEFIEERD--GEPA------SAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQ 209
           R++VA FI +RD   +P       +A ++FLT GAS AV +IL LF      G L+PIPQ
Sbjct: 133 RKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLLPIPQ 192

Query: 210 YPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTG 269
           YPLYTA++ L  S  LPYYL+E + WS D +QIE++V D+IK+ I+PT LVVINPGNPTG
Sbjct: 193 YPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGNPTG 252

Query: 270 ALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQ 329
           A+L  D+I ++I +AA+Y +VIIADEVYQEN +   EF S KKVL  L+K  P KYDNVQ
Sbjct: 253 AILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSKYDNVQ 312

Query: 330 LASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPP 389
           LASLHS SKGV+GECGQRGGYME+ GFS +VK+V LK+ASIS+C VVTGQ L+DLMV PP
Sbjct: 313 LASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVDLMVNPP 372

Query: 390 KKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAI 449
           + GD SYE D+ ER  IH  L  +S  LY  F  + G+SCQ+PQGAMYLFP+L LS  AI
Sbjct: 373 QPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLHLSENAI 432

Query: 450 HKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFH 509
           + A    L PDE+YC +LLE TGICTVPGSGFGQ PGT+HLRTTFL PG EWI+SW+KFH
Sbjct: 433 NAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWINSWEKFH 492

Query: 510 EKFTEDHR 517
            +F E ++
Sbjct: 493 LEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/500 (54%), Positives = 368/500 (73%), Gaps = 13/500 (2%)

Query: 28  KDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANI 87
           KD +  P   K +L DI++ +L+ +YA+RG IP RA+EL+++L   P  LPF KII ANI
Sbjct: 4   KDCTPAP---KFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANI 60

Query: 88  GNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGA 147
           GNPQQL+Q+PLTF RQVL+L++ P+L++  +    +K + PDA++RA+ +L  +GGSVGA
Sbjct: 61  GNPQQLEQEPLTFQRQVLSLVEYPNLVNSKNILVENKIYAPDAIKRAETILNSIGGSVGA 120

Query: 148 YSNSQGVAGFRESVAEFIEERDGEP----------ASAQDIFLTTGASGAVSYILSLFCN 197
           YS+SQG+   R++VA+ I +RD +            +A +IFLT GA+ AVSYIL LF  
Sbjct: 121 YSSSQGILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAK 180

Query: 198 GPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPT 257
               G L+PIPQYPLYTA++ L NS  LPYYL+E+  WS D E+IE +++D+I + I+PT
Sbjct: 181 DENCGVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPT 240

Query: 258 CLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVL 317
            LV+INPGNPTGA+L+ ++I  +I +AAKY +VIIADEVYQ N + D +F S KK+L  L
Sbjct: 241 TLVIINPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSL 300

Query: 318 QKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVT 377
           +   P KYDNVQLASLHS SKGV+GECGQRGGY EL+GFS+E+K++ LKLASI +C VVT
Sbjct: 301 KLQYPKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVT 360

Query: 378 GQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMY 437
           GQ L+DLM +PP+KGD SY+ D++ER +I   L  +S  LY  F  + G+SCQ+PQGAMY
Sbjct: 361 GQILVDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMY 420

Query: 438 LFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAP 497
           LFP+L L++  I++A+   L PDE+YC +LLE TGICTVPGSGFGQ  GT+H+RTTFL  
Sbjct: 421 LFPRLHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPS 480

Query: 498 GTEWIDSWKKFHEKFTEDHR 517
           G EWI  W+KFH +F   ++
Sbjct: 481 GIEWIKLWEKFHLEFMNQYK 500

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 90/188 (47%), Gaps = 23/188 (12%)

Query: 130 AVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGAS-GAV 188
           A++ A+K L+     V  YS ++G      S+ +       +   A+++ +TTGA+ G +
Sbjct: 72  AIKEAQKALEI--PLVNQYSPTRGRPSLINSLIDLYTPIYNKELKAENVVVTTGANEGIL 129

Query: 189 SYILSLFCNGPENGALIPIPQYPLYTASLALNNSHAL------PYYLDEESG----WSMD 238
           S ++ L  +G E   ++  P +  Y  ++ L     +      P  LD+ +     W++D
Sbjct: 130 SCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTID 187

Query: 239 TEQIEKVVQDSIKKGIRPTCLVVIN-PGNPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
            EQ EK +    K        V+IN P NP G +   D +  +  +  K+++VII+DEVY
Sbjct: 188 FEQFEKAITSKTKA-------VIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISDEVY 240

Query: 298 QENGFNDA 305
           +   F D+
Sbjct: 241 EHLYFTDS 248

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 83/184 (45%), Gaps = 26/184 (14%)

Query: 116 DLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASA 175
           +LS   LH++  P  +E    M K                 +R   + +  + + +P +A
Sbjct: 45  ELSKTNLHRYPDPHQLEFKTAMTK-----------------YRNKTSSYANDPEVKPLTA 87

Query: 176 QDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESG- 234
            ++ L  G+  ++  I+   C   +   L+  P Y +Y+    +N+   +   L    G 
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSDGS 147

Query: 235 WSMDTEQIEKVVQ-DSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIA 293
           + MDTE +  +++ DS+ K      + V +PGNPTGA + T  IE V++     + +++ 
Sbjct: 148 FQMDTEAVLTILKNDSLIK-----LMFVTSPGNPTGAKIKTSLIEKVLQNWD--NGLVVV 200

Query: 294 DEVY 297
           DE Y
Sbjct: 201 DEAY 204

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 75/159 (47%), Gaps = 24/159 (15%)

Query: 147 AYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGA---VSYILS-----LFCNG 198
            Y   QG    R+ +AE     D    S +++ LT GA  A     Y L+       C  
Sbjct: 54  TYGAIQGSHALRKLIAEMYSNED-VTLSEENVILTNGAIAANFLTHYTLAGKGDHFICIS 112

Query: 199 PENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTC 258
           P    L  IPQ  ++ A + L        +L +E+ +  +  ++E++++ + K      C
Sbjct: 113 PTYQQLSSIPQ--MFGAEVEL-------LHLRKETNYQPNIVELERMIKPNTK------C 157

Query: 259 LVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
           +V+  P NP  +++ T+T+  + ++A K+ +V+  DEVY
Sbjct: 158 IVLNTPNNPLSSVIPTETLREIAELADKHGIVVFCDEVY 196

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 84/184 (45%), Gaps = 27/184 (14%)

Query: 116 DLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASA 175
           D S+ ELH++  P  +E    M                 A +R   + +  E +  P ++
Sbjct: 47  DASNSELHRYPDPHQLEFKTAM-----------------ASYRNKTSTYKAE-NLTPLTS 88

Query: 176 QDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPY-YLDEESG 234
           +++ L  G+  ++  I+   C   +   L+  P Y +Y+    +N+   +    L + + 
Sbjct: 89  ENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVECPLLYKNNS 148

Query: 235 WSMDTEQIEKVVQ-DSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIA 293
           + MDTE +  V+Q D + K      L + +PGNPTGA + T+ IE V++       +++ 
Sbjct: 149 FQMDTESVLTVLQNDPLIK-----LLFITSPGNPTGARIETERIETVLQNWT--DGLVVV 201

Query: 294 DEVY 297
           DE Y
Sbjct: 202 DEAY 205

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 80/361 (22%), Positives = 150/361 (41%), Gaps = 63/361 (17%)

Query: 145 VGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGAS-GAVSYILSLFCNGPENGA 203
           V  YS ++G     ES+ +           A+++ +TTGA+ G +S ++ +   G E   
Sbjct: 84  VNQYSPTRGRVSLLESLIKLYSPLYNAELKAENVTVTTGANEGILSCLMGILNPGDE--V 141

Query: 204 LIPIPQYPLYTASLALNNSHAL------PYYLDEE----SGWSMDTEQIEKVVQDSIKKG 253
           ++  P +  Y  ++ L     +      P  +D+     + W++D EQ    + D  K  
Sbjct: 142 IVFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRVVKGTEWTVDYEQFANAITDKTK-- 199

Query: 254 IRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKV 313
                +++  P NP G +   + +  + ++  K ++VII+DEVY+   F D+ F  +  +
Sbjct: 200 ----AVIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVYEHLYFTDS-FTRIATL 254

Query: 314 LRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLC 373
                  E G+       S+ S  K  +   G R G++  V  + E+   ++  A   +C
Sbjct: 255 -----SPEIGQLT----LSVGSAGKSFAA-TGWRVGWV--VSLNPELLS-YVSKAHTRIC 301

Query: 374 ---PVVTGQALIDLMVRPPKKGDA----SYEQDRQE---RCDIHDALHKRSGLLYQAFQS 423
              P    +A+ + +       DA     +E  RQE   + DI  ++ K  GL Y     
Sbjct: 302 FASPSPLQEAVANSI------NDALEINYFENMRQEYKHKYDIFTSVFKELGLPY----- 350

Query: 424 MEGVSCQEPQGAMYL---FPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSG 480
                  EP+G  ++   F K+++     +  E A  A D      L+   G+  +P + 
Sbjct: 351 ------TEPEGTYFILVDFSKVKIPEGYSYPEEIANKAKDFRIAYWLINELGVVAIPPTE 404

Query: 481 F 481
           F
Sbjct: 405 F 405

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 87/188 (46%), Gaps = 23/188 (12%)

Query: 130 AVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGAS-GAV 188
           A++ A+K L      V  YS ++G      S+ +           A+++ +TTGA+ G +
Sbjct: 72  AIKEAQKALDI--PMVNQYSPTRGRPSLINSLIKLYSPIYNTELKAENVTVTTGANEGIL 129

Query: 189 SYILSLFCNGPENGALIPIPQYPLYTASLALNNSHAL------PYYLDEESG----WSMD 238
           S ++ L   G E   ++  P +  Y  ++ L     +      P  LD+ +     W++D
Sbjct: 130 SCLMGLLNAGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTID 187

Query: 239 TEQIEKVVQDSIKKGIRPTCLVVIN-PGNPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
            EQ EK +    K        V+IN P NP G +   + +  +  +  K+++VII+DEVY
Sbjct: 188 FEQFEKAITSKTKA-------VIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVY 240

Query: 298 QENGFNDA 305
           +   F D+
Sbjct: 241 EHLYFTDS 248

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 89/187 (47%), Gaps = 21/187 (11%)

Query: 130 AVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGAS-GAV 188
           A++ A+K L+     V  YS ++G A    S+ +      G+    ++I +TTGA+ G +
Sbjct: 76  AIKEAQKALEI--PLVNQYSPTRGRASLLNSLIKLYSPFYGKELKQENITITTGANEGIL 133

Query: 189 SYILSLFCNGPENGALIPIPQYPLYTASLAL----------NNSHALPYYLDEESGWSMD 238
           S ++ L   G E   ++  P +  Y +++ L          N    L   + E + W++D
Sbjct: 134 SCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKVVYVPINPPKDLDQRITEGTEWTID 191

Query: 239 TEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQ 298
            EQ    +    K       ++V +P NP G +   + +  + ++  + +++II+DEVY+
Sbjct: 192 FEQFRNAITPKTK------AVIVNSPHNPIGKVFTKEELTKLGEICVENNVIIISDEVYE 245

Query: 299 ENGFNDA 305
              FND+
Sbjct: 246 FLYFNDS 252

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 77/151 (50%), Gaps = 8/151 (5%)

Query: 147 AYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIP 206
            Y +  G    R+ VA+ I   D    +A ++ +T GA GA ++++     GP +  +  
Sbjct: 54  TYGSIWGTPVLRDLVAK-IHSSDEIQLTADNVLITNGAIGA-NFLVHYTAAGPGDHIICV 111

Query: 207 IPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGN 266
            P Y   ++  ++  +     +L+ E G++ + ++++  V+ + K       +V+ NP N
Sbjct: 112 DPTYQQLSSVPSMFGADVELLHLEAEDGYTPNIQKLKSKVRANTKY------IVLNNPNN 165

Query: 267 PTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
           P G++++T+ +  +I  A +  + I+ DEVY
Sbjct: 166 PLGSVISTEKMTEIIDYAERNEIFIVCDEVY 196

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 76/146 (52%), Gaps = 10/146 (6%)

Query: 154 VAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLY 213
           +A +R   + F ++++  P +A++I L  G+  ++  ++ + C   ++  +I  P Y +Y
Sbjct: 67  MANYRNKHSSF-KDQNLPPLTAENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMY 125

Query: 214 TASLALNNSHALPYYL-DEESGWSMDTEQI-EKVVQDSIKKGIRPTCLVVINPGNPTGAL 271
           +    +N+   +   L  E++ + MDT ++ E + QD   K I      + +PGNPT AL
Sbjct: 126 SICADINDVGCVKVPLVAEDNSFQMDTSKVLETLAQDPTIKLI-----FITSPGNPTAAL 180

Query: 272 LNTDTIENVIKVAAKYSMVIIADEVY 297
           ++T  IE V+        +++ DE Y
Sbjct: 181 IDTAEIEKVLNNWT--GGLVVVDEAY 204

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 81/168 (48%), Gaps = 8/168 (4%)

Query: 153 GVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPL 212
            +A +R   + F  +    P ++ +I L  G+  ++  I+   C       L+  P Y +
Sbjct: 65  AIAEYRNRSSTFTADECTRPLTSGNICLGVGSDESIDAIIRATCVPAREKILVLPPTYSM 124

Query: 213 YTASLALNNSHALPY-YLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGAL 271
           Y+    +N+   +    + E++ + MD++++  ++ +  +  +    L + +PGNPTGA 
Sbjct: 125 YSVCAKINDVEVVTCPLITEDNSFQMDSDKVLDILNNDQEIKL----LFITSPGNPTGAQ 180

Query: 272 LNTDTIENVIKVAAKYSMVIIADEVYQE-NGFNDAEFVSMKKVLRVLQ 318
           + T  IE V++   +   +++ DE Y +  G + A  V+  + L  LQ
Sbjct: 181 IETARIEKVLQNWDR--GLVVVDEAYVDFCGGSTAPLVTKYQNLVTLQ 226

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 79/168 (47%), Gaps = 19/168 (11%)

Query: 148 YSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAV-SYILSLFCNGPENGALIP 206
           YS ++G     +++A+      G+  SA +I + TGA+ A+ S ++ L   G E   ++ 
Sbjct: 77  YSPTRGRPNLIKALADLYTPLYGQQLSADNITVHTGANEAIFSCLMGLLNKGDE--VIVF 134

Query: 207 IPQYPLYTASLAL----------NNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRP 256
            P +  Y +++ L          N    L   +   + W +D + +EK +        R 
Sbjct: 135 EPFFDQYISNIELAGGVVRYVPINPPRELDDRVTRGTEWEIDWDILEKTINS------RT 188

Query: 257 TCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFND 304
            C+++  P NP G +   + +  + K+    ++VII+DEVY+   F+D
Sbjct: 189 KCVIINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVYEHLYFSD 236

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 84/184 (45%), Gaps = 29/184 (15%)

Query: 116 DLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASA 175
           DL+   LH++  P  +E    M                 A +R   + F   +D  P +A
Sbjct: 45  DLAGLNLHRYPDPHQIEFKTAM-----------------ANYRNRTSSF---KDITPLTA 84

Query: 176 QDIFLTTGASGAVSYILSLFCN-GPENGALIPIPQYPLYTASLALNNSHALPYYL-DEES 233
           +++ L  G+  ++  I+   C  G E    +P P Y +Y+   ++N+   +   L   ++
Sbjct: 85  ENLCLGVGSDESIDAIIRATCVPGKEKIMAMP-PTYGMYSVCASVNDVEIVKCPLVTSDN 143

Query: 234 GWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIA 293
            + +DTE     V D++KK      + + +PGNPTGA + T  IE +++   +   +++ 
Sbjct: 144 SFQVDTE----AVLDTLKKDPLIKLVFITSPGNPTGAKIETSRIEKILQNWDQ--GILVV 197

Query: 294 DEVY 297
           DE Y
Sbjct: 198 DEAY 201

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 88/188 (46%), Gaps = 23/188 (12%)

Query: 130 AVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGAS-GAV 188
           A++ A+K L+     V  YS ++G      S+ +           A+++ +TTGA+ G +
Sbjct: 88  AIKEAQKALEI--PLVNQYSPTRGRPSLINSLIKLYSPIYDTDLRAENVTVTTGANEGIL 145

Query: 189 SYILSLFCNGPENGALIPIPQYPLYTASLALNNSHAL------PYYLDEESG----WSMD 238
           S ++ L  +G E   ++  P +  Y  ++ L     +      P  LD+ +     W++D
Sbjct: 146 SCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTKGEEWTID 203

Query: 239 TEQIEKVVQDSIKKGIRPTCLVVIN-PGNPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
            EQ E  +    K        V+IN P NP G +   + +  +  +  K+++VII+DEVY
Sbjct: 204 FEQFENAITSKTKA-------VIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVY 256

Query: 298 QENGFNDA 305
           +   F D+
Sbjct: 257 EHLFFTDS 264

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 75/152 (49%), Gaps = 8/152 (5%)

Query: 147 AYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIP 206
            Y   +G    R  VA    +++ +     ++ +T GA GA ++++S    GP +  +  
Sbjct: 54  TYGAIKGSDELRSLVASLYSDKEVK-LDKDNVLITNGAIGA-NFLVSYTLAGPGDHVICV 111

Query: 207 IPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGN 266
            P Y   ++   +  +      L+ E+ +  D  +++ +++ + K      C+V+ NP N
Sbjct: 112 DPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMIKGNTK------CIVLNNPNN 165

Query: 267 PTGALLNTDTIENVIKVAAKYSMVIIADEVYQ 298
           P G+++ T T+E +  +A K  + +I DEVY+
Sbjct: 166 PLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 94/195 (48%), Gaps = 26/195 (13%)

Query: 154 VAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLY 213
           ++ +R   + F ++++ +P  A ++ L  G+  ++  ++   C   +   LI    Y +Y
Sbjct: 67  LSDYRNKTSIF-KDQNLKPLDADNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMY 125

Query: 214 TASLALNNSH--ALPYYLDEESGWSMDTEQIEKVVQD--SIKKGIRPTCLVVINPGNPTG 269
           T    +N+     +P  L EE  + +D E+I + +Q+  SIK       + + +PGNPTG
Sbjct: 126 TICSQVNDVEYVTVPLLLSEEDKFQIDEEKILETLQNDPSIK------LVFITSPGNPTG 179

Query: 270 ALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFV--SMKKVLRVLQKTEPGKYDN 327
             ++ + IE ++  +   + +++ DE Y        +FV  S K  L  L      KY+N
Sbjct: 180 TFIDVNRIEKIL--SQWQTGLVVVDEAY-------IDFVEGSDKGSLAPLAT----KYEN 226

Query: 328 VQLASLHSTSKGVSG 342
           + +    S S G++G
Sbjct: 227 IAVLQTLSKSFGLAG 241

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 81/173 (46%), Gaps = 21/173 (12%)

Query: 145 VGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGAS-GAVSYILSLFCNGPENGA 203
           V  YS ++G      S+ +       +  + +++ +TTGA+ G +S ++ L   G E   
Sbjct: 85  VNQYSPTRGRPSLINSLIKLYSPIYNKDLTTENVTVTTGANEGILSCLMGLLNAGDE--V 142

Query: 204 LIPIPQYPLYTASLALNNSHAL------PYYLDEESG----WSMDTEQIEKVVQDSIKKG 253
           ++  P +  Y +++ L     +      P  LD  +     W++D EQ EK +    K  
Sbjct: 143 IVFEPFFDQYISNIELCGGKVVYVPINPPKELDLRNTRGEEWTIDFEQFEKAITPKTKA- 201

Query: 254 IRPTCLVVIN-PGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDA 305
                 V+IN P NP G +   + +  +  +  K++++II+DEVY+   F D+
Sbjct: 202 ------VIINTPHNPIGKVFTREELTTLGNICVKHNVIIISDEVYEHLYFTDS 248

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 63/125 (50%), Gaps = 11/125 (8%)

Query: 177 DIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNS---HALPYYLDEES 233
           D+  T G +GA   +L +FCN    G  I   Q+  +++S++   +   +  P  LDE  
Sbjct: 134 DVLATIGNTGAWESVLRIFCN---RGDTILAEQF-AFSSSISAAEAQGVNVFPIPLDEHG 189

Query: 234 GWSMDTEQIEKVVQDSIKKGIRPTCLVVINPG-NPTGALLNTDTIENVIKVAAKYSMVII 292
              +   ++E ++ +  +   +P  L  +  G NPTG+ L+ D  E + ++A K+  +II
Sbjct: 190 ---IIPSKLETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIII 246

Query: 293 ADEVY 297
            DE Y
Sbjct: 247 EDEPY 251

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 89/197 (45%), Gaps = 30/197 (15%)

Query: 113 LISDLSSG-ELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGE 171
           +I+ L  G ELH++  P  V   + M                 A +R + + F  E    
Sbjct: 42  MIAGLQDGSELHRYPDPHQVTLKELM-----------------ANYRNNTSAFKSEGLA- 83

Query: 172 PASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPY-YLD 230
           P S ++I L  G+   V  ++   C    +  L+  P Y +Y+    +N++  +    + 
Sbjct: 84  PISYKNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPLIT 143

Query: 231 EESGWSMDTEQIEKVV--QDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYS 288
           E++ + MD + + + +   DSIK       L +  PGNPTGA ++T  IE ++   +  +
Sbjct: 144 EDNSFDMDLDNVLETLSNDDSIK------LLFITTPGNPTGASISTQKIEMLLNNWS--A 195

Query: 289 MVIIADEVYQENGFNDA 305
            +++ DE Y +   +D+
Sbjct: 196 GIVVVDEAYIDFSSSDS 212

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 75/183 (40%), Gaps = 9/183 (4%)

Query: 118 SSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASAQD 177
           +S   H   K D V +A             Y  S G   F   V E  +       S  +
Sbjct: 76  ASDTCHIAIKKDGVSKAGSSTDIPLSRALQYGFSMGQPEFLSFVREHTQLVHKMKYSDWN 135

Query: 178 IFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNS--HALPYYLDEESGW 235
           +  TTG +G+    L +FCN    G  I   QY   ++  A      +  P  LD +   
Sbjct: 136 VLATTGNTGSWESTLRIFCN---RGDTILAEQYTFSSSVYAAEAQGINVFPVPLDADG-- 190

Query: 236 SMDTEQIEKVVQDSIKKGIRPTCLVVINPG-NPTGALLNTDTIENVIKVAAKYSMVIIAD 294
            +  E++E ++ +      +P  L  I  G NPTG+ L+ D    + ++A K+ ++II D
Sbjct: 191 -LIPERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLIIED 249

Query: 295 EVY 297
           E Y
Sbjct: 250 EPY 252

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 92/190 (48%), Gaps = 25/190 (13%)

Query: 142 GGSVGAYSNSQGVAGFRESVAEFIEERDGE---------PASAQDIFLTTGASGAVSYIL 192
           G  +  Y +   +A F+ ++A F   R+GE         P +A+++ L  G+  ++  I+
Sbjct: 48  GSGLNRYPDPHQLA-FKTAMANF---RNGENHQYKDLPQPLTAENLCLGVGSDESIDAII 103

Query: 193 SLFCNGPENGALIPIPQYPLYTASLALNNSHALPY-YLDEESGWSMDTEQIEKVVQD--S 249
              C   +   L+  P Y +Y+    +N+   +    +  ++ +  +T+++ K  Q+  S
Sbjct: 104 RACCVPAKEKILVLPPTYSMYSVCAHINDVEIVKCPLITSDNSFQANTDEVIKTAQNDPS 163

Query: 250 IKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQE-NGFNDAEFV 308
           IK       + + +PGNPTGA + T  IE +++   +  MV++ DE Y +  G + A  V
Sbjct: 164 IK------LIFITSPGNPTGAKVETSRIEKILQNWDR-GMVVV-DEAYIDFCGGSTAPLV 215

Query: 309 SMKKVLRVLQ 318
           +    L VLQ
Sbjct: 216 TKYPNLCVLQ 225

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 65/128 (50%), Gaps = 11/128 (8%)

Query: 174 SAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHAL---PYYLD 230
           S  D+  TTG + A    L +FC   + G +I + +   +++ LA   +  +   P  +D
Sbjct: 129 SDWDVVATTGNTNAWESTLRVFC---DKGDVI-LAEAHSFSSCLAAAQAQGIITFPIPID 184

Query: 231 EESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPG-NPTGALLNTDTIENVIKVAAKYSM 289
           E     +  E++E+++ +  +   +P  L  I  G NPTG+ L+ D  E + KVA K+  
Sbjct: 185 EHG---IIPEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDF 241

Query: 290 VIIADEVY 297
           +II DE Y
Sbjct: 242 IIIEDEPY 249

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 92/198 (46%), Gaps = 22/198 (11%)

Query: 154 VAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLY 213
           +A +R + + F EE    P +A++I L  G+  ++  I+   C+  E   ++  P Y +Y
Sbjct: 67  LASYRNAASAFREEGLA-PLTAKNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMY 125

Query: 214 TASLALNNSHALPY-YLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALL 272
                +N+   +    +  ++ + +D ++I  + Q ++ K I+   + + +PGNPTGA +
Sbjct: 126 KVCADINDVGYVEVPLISSDNSFQIDEDRI--LEQLNLDKSIK--VVFITSPGNPTGACI 181

Query: 273 NTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLAS 332
               +E +++     + +++ DE Y        +F + K  L  L    P       L  
Sbjct: 182 EVGRVEKLLR--NWTAGIVVVDEAY-------IDFSADKPSLSPLVNKHP------NLVV 226

Query: 333 LHSTSKGVSGECGQRGGY 350
           L + SK  SG  G R G+
Sbjct: 227 LQTLSKA-SGLAGIRLGF 243

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 77/152 (50%), Gaps = 12/152 (7%)

Query: 172 PASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPY-YLD 230
           P SA ++ L  G+  ++  ++   C   ++  LI  P Y +Y+    +N+   +    + 
Sbjct: 84  PLSADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIV 143

Query: 231 EESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMV 290
           E++ + M+T+++ + +Q      I      V +PGNPTGAL++  +IE   K+ +++   
Sbjct: 144 EDNSFQMNTDKVIETLQGDSNIKIA----FVTSPGNPTGALIDIASIE---KILSQWQSG 196

Query: 291 IIA-DEVYQE---NGFNDAEFVSMKKVLRVLQ 318
           I+A DE Y +    G + A  V+    L VLQ
Sbjct: 197 IVAIDEAYIDFCSTGGSAAPLVNKYPNLAVLQ 228

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 77/153 (50%), Gaps = 14/153 (9%)

Query: 172 PASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLD- 230
           P + +++ L  G+   +  ++   C   ++  LI  P Y +Y+    +N+   +   L  
Sbjct: 84  PLTHENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVV 143

Query: 231 EESGWSMDTEQIEKVVQD--SIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYS 288
           E++ + MDTE++ + +Q+  SIK       + + +PGNPTGAL+  + IE ++  +   S
Sbjct: 144 EDNSFQMDTEKVIETLQNDPSIK------LVFITSPGNPTGALIKPENIEKLL--SQWQS 195

Query: 289 MVIIADEVYQE---NGFNDAEFVSMKKVLRVLQ 318
             ++ DE Y +    G + A  V+    L VLQ
Sbjct: 196 GFVVVDEAYIDFCTTGGSVAPLVNKYPNLAVLQ 228

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 72/148 (48%), Gaps = 11/148 (7%)

Query: 153 GVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPL 212
            +  +R   + ++ +   +P SA ++ L  G+  ++  I+   C   +   L+  P Y +
Sbjct: 65  AMTAYRNETSSYLNDPTVKPLSADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSM 124

Query: 213 YTASLALNNSHAL--PYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGA 270
           Y+    +N+   +  P  + + S + M+TE +  ++ +     I    +   +PGNPTGA
Sbjct: 125 YSVCANINDVEVVQCPLTVSDNS-FQMNTEAVLTILNNDPLIKI----MFATSPGNPTGA 179

Query: 271 LLNTDTIENVIKVAAKY-SMVIIADEVY 297
            + T  IE V++   K+ + +++ DE Y
Sbjct: 180 KIKTCLIEEVLQ---KWDNGIVVVDEAY 204

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 90/193 (46%), Gaps = 24/193 (12%)

Query: 154 VAGFRESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPL 212
           +AGFR      +++  G EP +  ++ L  G+   +  ++   C    +  L   P Y +
Sbjct: 66  LAGFRNR----LDKTPGIEPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSM 121

Query: 213 YTASLALNNSHALPY-YLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGAL 271
           Y+    +N+   +    + E++ + M+  +    V  ++K   +   L + +PGNPTG L
Sbjct: 122 YSVCANINDVEIVECPLITEDNSFQMNVPE----VLSTLKNDPKIKLLFITSPGNPTGKL 177

Query: 272 LNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAE--FVSMKKVLRVLQKTEPGKYDNVQ 329
           +N   IE +++     + +++ DE Y +  F DAE    SM K++         KY N+ 
Sbjct: 178 VNKKDIEFILENWT--NGLVVVDEAYID--FADAEGTTYSMAKLVT--------KYPNLT 225

Query: 330 LASLHSTSKGVSG 342
           +    S S G++G
Sbjct: 226 VLQTLSKSFGLAG 238

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 74/355 (20%), Positives = 145/355 (40%), Gaps = 62/355 (17%)

Query: 145 VGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGAS-GAVSYILSLFCNGPENGA 203
           V  YS ++G     +S+ +            +++ +TTGA+ G ++ ++ +     E   
Sbjct: 84  VNQYSPTRGRPTLIKSLTDLYSPLYKLTLKPENVLVTTGANEGILACLMGILNQNDE--V 141

Query: 204 LIPIPQYPLYTASLALNNSHAL------PYYLDEE----SGWSMDTEQIEKVVQDSIKKG 253
           ++  P +  Y  ++ L     +      P  LD+     + W++D EQ E V+ +  K  
Sbjct: 142 IVFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVITNKTK-- 199

Query: 254 IRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKV 313
                +++  P NP G +   + ++ +  +  K++++II+DEVY    F D EF  +  +
Sbjct: 200 ----AIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVYDNLYFVD-EFTRIATL 254

Query: 314 LRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYM-----ELVGFSEEVKQVFLKLA 368
                  E G     QL     ++       G R G++     EL+ F+ +      ++ 
Sbjct: 255 -----SPEIG-----QLTLSVGSAGKTFAATGWRIGWVVSLNPELLNFASKAHT---RIC 301

Query: 369 SISLCPVVTGQA-LIDLMVRPPKKGDASYEQDRQE---RCDIHDALHKRSGLLYQA---- 420
             S  P+    A  I++ +R     +  +E  R E   +  I  ++    GL Y      
Sbjct: 302 FASPSPIQEACAESINIALR-----NGYFENMRNEYVKKYKIFTSVFDELGLPYTEAEGT 356

Query: 421 -FQSMEGVSCQEPQGAMYLFPK--------LELSNKAIHKAESAGLAPDEYYCKE 466
            F  ++    + P+   Y FP+          +SN  I++     + P E+Y KE
Sbjct: 357 YFLLVDFSRVKIPED--YKFPEEIINKGKDFRISNWLINELGVVAIPPTEFYIKE 409

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 74/360 (20%), Positives = 147/360 (40%), Gaps = 61/360 (16%)

Query: 145 VGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGAS-GAVSYILSLFCNGPENGA 203
           V  YS ++G     +S+ E  +   G+    Q++ +TTGA+ G +S ++ +   G E   
Sbjct: 74  VNQYSPTRGRPSLIKSLVELYKPVFGDFIDNQNVLVTTGANEGILSCLMGILNAGDE--V 131

Query: 204 LIPIPQYPLYTASLALNNS--HALPYYLDEE--------SGWSMDTEQIEKVVQDSIKKG 253
           ++  P +  Y  ++ L       +P +  +E          W +D + +EK   +  K  
Sbjct: 132 IVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDWDALEKTFNNKTKA- 190

Query: 254 IRPTCLVVIN-PGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKK 312
                 V+IN P NP G +     +  + ++  +++ V+I+DEVY+   F +    S  +
Sbjct: 191 ------VIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVYEHLYFTE----SFPR 240

Query: 313 VLRVLQKTEPGKYDNVQLASLHST--SKGVS-GECGQRGGYM-----ELVGFSEEVKQVF 364
           +  +          N  +A+L  T  S G S    G R G++     +L+ +   V +  
Sbjct: 241 IANI----------NEDIANLTLTVGSAGKSFAATGWRIGWIISKNDQLLNY---VSKAH 287

Query: 365 LKLASISLCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSM 424
            ++   S  P+    A           G   +         + +   K+  +L  AF  +
Sbjct: 288 TRICFASPSPLQEACA-----------GSIEHALKIDYFPKMREEYRKKFEILTTAFDKL 336

Query: 425 EGVSCQEPQGAMYL---FPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGF 481
            G++  +P+G  ++   F K+++    ++  E    A D      L+   GI  +P + F
Sbjct: 337 -GLNYTQPEGTYFILVDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEIGIVAIPPTEF 395

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 62/125 (49%), Gaps = 5/125 (4%)

Query: 174 SAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEES 233
           S  D+  TTG + A    L +FCN    G +I + +   +++SLA   +  +  +     
Sbjct: 129 SDWDVVATTGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSSLASAEAQGIITFPVPID 184

Query: 234 GWSMDTEQIEKVVQDSIKKGIRPTCLVVINPG-NPTGALLNTDTIENVIKVAAKYSMVII 292
              +  E++E ++ +  +   +P  L  I  G NPTG+ LN +  + + ++A K+  +II
Sbjct: 185 AHGIIPEKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLII 244

Query: 293 ADEVY 297
            DE Y
Sbjct: 245 EDEPY 249

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 63/128 (49%), Gaps = 11/128 (8%)

Query: 174 SAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHAL---PYYLD 230
           S  D  LTTG +      L +FCN    G +I + +   +++SLA   +  +   P  +D
Sbjct: 129 SDWDSILTTGNTNGWESTLRIFCN---KGDVI-LAEAHSFSSSLASAEAQGVITFPVPID 184

Query: 231 EESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPG-NPTGALLNTDTIENVIKVAAKYSM 289
            +    +  E++E ++ +      +P  L  I  G NPTG+ L+ +  E + K+A K+  
Sbjct: 185 SDG---IIPEKLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDF 241

Query: 290 VIIADEVY 297
           +II DE Y
Sbjct: 242 IIIEDEPY 249

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 70/154 (45%), Gaps = 8/154 (5%)

Query: 148 YSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPI 207
           Y NS+G       + E I +    P S  D+ +T G++ A    L LFCN P +  L+  
Sbjct: 100 YGNSRGQRELVSFLKEHIVKFHQIPYSDWDVLITAGSTQAWDASLRLFCN-PGDSVLL-- 156

Query: 208 PQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQ--DSIKKGIR-PTCLVVINP 264
            +   Y++S+    +  +     E  G  +  E++E ++Q  D +  G   P  L VI  
Sbjct: 157 -ESWTYSSSVEAAEAQGMYCVGVEIDGHGVVPEKLEWLLQNWDDLHPGRSLPKLLYVIPT 215

Query: 265 G-NPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
           G NP G  L  +    +  +  KY MV+I D+ Y
Sbjct: 216 GQNPMGVTLADERKPLIYNIIQKYDMVLIEDDPY 249

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 78/331 (23%), Positives = 137/331 (41%), Gaps = 49/331 (14%)

Query: 177 DIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLAL--NNSHALPYYLDEESG 234
           D+  T G +G+    L +FCN    G  I   +Y   ++  A      +  P  LD +  
Sbjct: 135 DVLATIGNTGSWESTLRIFCN---RGDTILAEKYTFSSSVYAAEAQGVNVFPVPLDADG- 190

Query: 235 WSMDTEQIEKVVQDSIKKGIRPTCLVVINPG-NPTGALLNTDTIENVIKVAAKYSMVIIA 293
             +  E++E ++ +   +  +P  L  I  G NPTG+ L+ D  + + ++A K+  +II 
Sbjct: 191 --LIPERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIE 248

Query: 294 DEVY---QENGFND-------AEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGE 343
           DE Y   Q + +          EF S  + +  L K+        ++  + S SK +   
Sbjct: 249 DEPYYFLQMDAYEKDPSKRKAIEFASHDEFVNSLAKSFISLDTEGRVIRMDSFSKVLG-- 306

Query: 344 CGQRGGYMELVGFSEEVKQVFLKLASISL-CPVVTGQALID-LMVRPPKKGDASY----E 397
            G R G+  LVG S+ + + + +L  +++  P    QA++   + R  + G   +     
Sbjct: 307 PGTRLGW--LVG-SKRILRAYTQLHEMTIQNPSGFSQAIVSGTLNRWGQHGFLDWLIGLR 363

Query: 398 QDRQERCDIH-DALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKL------ELSNKAIH 450
           Q+  E+ D+  DA       LY+   S   ++   P   M+    +      E + K   
Sbjct: 364 QEYNEKRDVAIDA-------LYKYVPSTPALTVTPPIAGMFFTVNIDASAHPEFATKYQS 416

Query: 451 KAESAGLAPDEYYCKELLEATGICTVPGSGF 481
           K E       E    E + A G+  VPG  F
Sbjct: 417 KPELV-----EQAIYEKVIACGVLVVPGIWF 442

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 62/128 (48%), Gaps = 11/128 (8%)

Query: 174 SAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHAL---PYYLD 230
           S  DI LTTG +      L +FCN    G +I + +   +++SLA   +  +   P  +D
Sbjct: 129 SDWDIILTTGNTNGWESTLRVFCN---KGDVI-LAEAHSFSSSLASAEAQGITTFPIPID 184

Query: 231 EESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPG-NPTGALLNTDTIENVIKVAAKYSM 289
           E     +  E++E+++ +      +P  L  I  G NPTG  L  +    + ++A K+  
Sbjct: 185 EHG---IIPEKLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDF 241

Query: 290 VIIADEVY 297
           +II DE Y
Sbjct: 242 LIIEDEPY 249

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 80/177 (45%), Gaps = 20/177 (11%)

Query: 148 YSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGAS-GAVSYILSLFCNGPENGALIP 206
           YS ++G     +S+ +F      E  +  ++ +TTGA+ G ++ ++ L   G E   ++ 
Sbjct: 88  YSPTRGRPSLLKSLTDFYSPIYNETLNESNVTITTGANEGILASLVGLLNPGDE--VIVF 145

Query: 207 IPQYPLYTASLALNNSHA------LPYYLDEE----SGWSMDTEQIEKVVQDSIKKGIRP 256
            P +  Y +++ +            P  L E     + W +D + + K + +      R 
Sbjct: 146 EPFFDQYISNIEIPGGKVRYVPLVAPKELSERVTIGAEWKIDFDILNKTINE------RT 199

Query: 257 TCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKV 313
            C+++  P NP G +   + +  +  +  K ++ II+DEVY+   F D EF  +  +
Sbjct: 200 KCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVYEHLYFGD-EFTRIATI 255

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 110/249 (44%), Gaps = 25/249 (10%)

Query: 148 YSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPI 207
           Y  SQG     E V +          +  D+  T G + A    L +FCN    G  I  
Sbjct: 106 YGFSQGQPELMEFVRKHTSLVHDIKYADWDVLATAGNTNAWESTLRVFCN---RGDTILA 162

Query: 208 PQYPLYTASLAL--NNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPG 265
             Y   ++  A      +  P  LDE   + +  E++E ++ +   +  +P  L  I  G
Sbjct: 163 EAYSFSSSLYAAEAQGVNVFPVPLDE---FGIIPEKLESIMDNWNPETPKPKLLYTIPTG 219

Query: 266 -NPTGALLNTDTIENVIKVAAKYSMVIIADEVY----QENGFNDAE------FVSMKKVL 314
            NPTG+ L+ D    + ++A K++ +II DE Y     E    DA       + S  + +
Sbjct: 220 QNPTGSSLSDDRKAKIYRIAQKHNFIIIEDEPYYFLQMEPYVKDASAREKKTYSSHDEFI 279

Query: 315 RVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISL-C 373
           + L K+      + ++  L S SK ++   G R G+  +VG S+++ + +L+L  +++  
Sbjct: 280 QSLAKSFISLDTDGRVVRLDSFSKVLA--PGTRLGW--IVG-SKKILEPYLRLHEMTIQA 334

Query: 374 PVVTGQALI 382
           P    Q+L+
Sbjct: 335 PSGFTQSLV 343

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 69/149 (46%), Gaps = 19/149 (12%)

Query: 177 DIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHAL---PYYLDEES 233
           D+F T G + A    L LFCN    G +I + +   +++SLA   +  +   P  +D + 
Sbjct: 134 DVFATAGNTNAWESTLRLFCN---RGDVI-LAEAHSFSSSLASAEAQGVITFPVPIDADG 189

Query: 234 GWSMDTEQIEKVVQDSIKKGIRPTCLVVINPG-NPTGALLNTDTIENVIKVAAKYSMVII 292
              +  E++ K++ +      +P  L  I  G NPTG  +     E + K+A K+  +I+
Sbjct: 190 ---IIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIV 246

Query: 293 ADEVYQENGFNDAEFVSMKKVLRVLQKTE 321
            DE Y         F+ M   ++ L++ E
Sbjct: 247 EDEPYY--------FLQMNPYIKDLKERE 267

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 80/178 (44%), Gaps = 22/178 (12%)

Query: 145 VGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGAS-GAVSYILSLFCNGPENGA 203
           V  YS ++G      ++ +      G     +++ +TTGA+ G +S ++ L   G E   
Sbjct: 86  VNQYSPTRGRVSLLNALIKQYTPIYGSELKQENVTITTGANEGILSCLMGLLNAGDE--V 143

Query: 204 LIPIPQYPLYTASLAL----------NNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKG 253
           ++  P +  Y +++ L          N    L   + E + W++D EQ +  +    K  
Sbjct: 144 IVFEPFFDQYISNIELMGGKIVYVPINPPKELDQRVTEGTEWTVDMEQFKNAITSKTKA- 202

Query: 254 IRPTCLVVIN-PGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSM 310
                 V+IN P NP G +   + +  +  +  + +++II+DEVY+   F D EF  +
Sbjct: 203 ------VIINTPHNPIGKVFTREELLQIGNICVEKNVIIISDEVYEHLYFTD-EFTRI 253

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 80/184 (43%), Gaps = 27/184 (14%)

Query: 116 DLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASA 175
           +L    LH++  P  +E  K M         +Y N   V  FR          D  P + 
Sbjct: 45  ELQGTNLHRYPDPHQIEFKKAM--------ASYRNKTSV--FRS--------YDLVPLTD 86

Query: 176 QDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPY-YLDEESG 234
           ++  L  G+  ++  I+   C   +   L+  P Y +Y+    +N+   +    + E++ 
Sbjct: 87  ENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLITEDNS 146

Query: 235 WSMD-TEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIA 293
           + +D TE +  +  D + K      + + +PGNPTGA +  D IE ++K   +   ++I 
Sbjct: 147 FQIDATEILNILANDPLIK-----LVFITSPGNPTGAKIEIDRIEYLLKNWDQ--GLVIV 199

Query: 294 DEVY 297
           DE Y
Sbjct: 200 DEAY 203

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 83/168 (49%), Gaps = 9/168 (5%)

Query: 153 GVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPL 212
            +A +R + + F ++RD    + +++ L  G+  ++  I+   C   +   L+  P Y +
Sbjct: 66  AMAKYRNTTSAF-KDRDLATLTNENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSM 124

Query: 213 YTASLALNNSHALPY-YLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGAL 271
           Y+    +N+   +    + E++ + +++++    V D +K       + + +PGNPTG  
Sbjct: 125 YSVCANINDIEVVECPLIYEDNSFQLNSDK----VLDILKNDPLIKLVFITSPGNPTGVK 180

Query: 272 LNTDTIENVIKVAAKYSMVIIADEVYQE-NGFNDAEFVSMKKVLRVLQ 318
           + T  IE V++     + +++ DE Y +  G + A  V+  + L VLQ
Sbjct: 181 IETKRIEKVLQNWD--NGLVVVDEAYIDFCGGSLAPLVTQYQNLIVLQ 226

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 76/180 (42%), Gaps = 12/180 (6%)

Query: 148 YSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPI 207
           Y  SQG     + V E          +  D+  T G + A    L +FCN    G  I  
Sbjct: 103 YGFSQGQPELMDFVREHTRRLHRMQYADWDVLATVGNTSAWESTLRVFCN---RGDTILA 159

Query: 208 PQYPLYTASLAL--NNSHALPYYLDEESGWSMDTEQIEKVVQD--SIKKGI-RPTCLVVI 262
            +Y   ++ +A       A P  LDE     M  E++ +++ +      G+ RP  L  +
Sbjct: 160 EEYTFSSSLVAAEAQGVRAYPVPLDENG---MVPERLGELLDNWERWHDGVPRPKLLYTV 216

Query: 263 NPG-NPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTE 321
             G NPTG  L+ D  + V ++A ++ ++I+ DE Y     +  E  + ++  RV    E
Sbjct: 217 PTGQNPTGTCLSNDRRQAVYRLAQQHDLLIVEDEPYYFLQLDPYEADAGRRAPRVFASHE 276

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 81/185 (43%), Gaps = 17/185 (9%)

Query: 130 AVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGAS-GAV 188
           A+  A+K L+     V  YS ++G      S+ +      G+    +++ +TTGA+ G +
Sbjct: 79  AIHEAQKALEI--PLVNQYSPTKGRPSVINSLKKLYSPLYGQELKDENVTITTGANEGIL 136

Query: 189 SYILSLFCNGPENGALIP-----IPQYPLYTASLA---LNNSHALPYYLDEESGWSMDTE 240
           S ++ +   G E     P     IP   L    +    +N    +   + E   W++D E
Sbjct: 137 SSLMGILNPGDEVIVFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRIVEGKDWTIDYE 196

Query: 241 QIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQEN 300
           ++ K      K       L++  P NP G +   + +  +  +  + ++VII+DEVY+  
Sbjct: 197 ELAKAFTSKTK------ALILNTPHNPIGKVFTKEELTKIGNLCVENNVVIISDEVYEFL 250

Query: 301 GFNDA 305
            F D+
Sbjct: 251 YFTDS 255

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 77/340 (22%), Positives = 135/340 (39%), Gaps = 64/340 (18%)

Query: 177 DIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHAL---PYYLDEES 233
           D+  T G + A    L +FCN    G +I +  +  +++SLA   +  +   P  +D + 
Sbjct: 134 DVLATAGNTNAWESTLRVFCN---RGDVILVEAHS-FSSSLASAEAQGVITFPVPIDADG 189

Query: 234 GWSMDTEQIEKVVQDSIKKGIRPTCLVVINPG-NPTGALLNTDTIENVIKVAAKYSMVII 292
              +  E++ KV+++      +P  L  I  G NPTG  +     E + K+A KY  +I+
Sbjct: 190 ---IIPEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIV 246

Query: 293 ADEVYQENGFNDAEFVSMKKVLRVLQKTE-----PGKYDNVQLASLHSTSKGVSGEC--- 344
            DE Y         F+ M   ++ L++ E     P +  +  L SL +T   +  E    
Sbjct: 247 EDEPYY--------FLQMNPYIKDLKEREKAQSSPKQDHDEFLKSLANTFLSLDTEGRVI 298

Query: 345 -----------GQRGGYMELVGFSEEVKQVFLKLASISL-CPVVTGQALID-LMVRPPKK 391
                      G R G+   +  S ++ + +L L  +++  P    Q L++  + R  +K
Sbjct: 299 RMDSFSKVLAPGTRLGW---ITGSSKILKPYLSLHEMTIQAPAGFTQVLVNATLSRWGQK 355

Query: 392 GDASY------EQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELS 445
           G   +      E   +  C I DA       LY+     +      P   M+    ++ S
Sbjct: 356 GYLDWLLGLRHEYTLKRDCAI-DA-------LYKYLPQSDAFVINPPIAGMFFTVNIDAS 407

Query: 446 NKAIHKAESAGLAPDEYYCKELLE----ATGICTVPGSGF 481
              +H         D Y  ++ L       G+  VPGS F
Sbjct: 408 ---VHPEFKTKYNSDPYQLEQSLYHKVVERGVLVVPGSWF 444

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 63/154 (40%), Gaps = 8/154 (5%)

Query: 148 YSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPI 207
           Y NS+G       + E        P    DI  TTG++      L +FCN    G  + +
Sbjct: 103 YGNSRGQKELVAYLKEHTSLFHRIPYQDWDIITTTGSTQGWDASLRIFCN---KGDTVLL 159

Query: 208 PQYPLYTASLALNNSHAL---PYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINP 264
            +Y  Y++S+   ++  L   P  LD E       E++     D       P  L  I  
Sbjct: 160 EEY-TYSSSVEAADAQGLNCIPMPLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPT 218

Query: 265 G-NPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
           G NPTG  L+      +  +A KY M+II DE Y
Sbjct: 219 GQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPY 252

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 80/185 (43%), Gaps = 28/185 (15%)

Query: 116 DLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASA 175
           +L    LH++  P  ++    M K                 +R   + +  +   +P  A
Sbjct: 45  ELGKTNLHRYPDPHQLDFKTAMTK-----------------YRNKTSSYSNDPTVKPLRA 87

Query: 176 QDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHAL--PYYLDEES 233
            ++ L  G+  ++  I+   C   +   L+  P Y +Y+    +N+   +  P  + + S
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNS 147

Query: 234 GWSMDTEQIEKVVQ-DSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVII 292
            + MDTE    +++ D + K I      V +PGNPTGA + T  IE +++     + +++
Sbjct: 148 -FQMDTEAALTILKNDPLIKLI-----FVTSPGNPTGAKIKTCLIEKILQNWE--NGLVV 199

Query: 293 ADEVY 297
            DE Y
Sbjct: 200 VDEAY 204

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 76/184 (41%), Gaps = 33/184 (17%)

Query: 147 AYSNSQGVAGFRESVAEFIEE------RDGEPASAQDIF-LTTGASGAVSYIL---SLFC 196
            Y + +G    RE++  F  +      RD +  S  +   L++GAS  V  IL   +L  
Sbjct: 50  TYGSDEGALWVREAITRFNNDETFRFARDDKARSRPEFLNLSSGASYGVLSILLQATLAH 109

Query: 197 NGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQD-------- 248
            G    A I  P Y L           +    +DE+   S+D   +E+ +Q+        
Sbjct: 110 TGYTRQAFIVSPTYFLINDCFIDAGFGSKITAIDEDGQGSIDLALLERKLQEFEDKFTEE 169

Query: 249 --------------SIKKGIRPTCLVVI-NPGNPTGALLNTDTIENVIKVAAKYSMVIIA 293
                         ++ K I    +  I    NPTG   +T+T   +I++A KY M+IIA
Sbjct: 170 EDQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDMLIIA 229

Query: 294 DEVY 297
           D+VY
Sbjct: 230 DDVY 233

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 65/128 (50%), Gaps = 8/128 (6%)

Query: 172 PASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYP-LYTASLALNNSHALPYYLD 230
           P   +D  L T  + A ++++     GP +  +   P Y  LY+         +L   L 
Sbjct: 74  PEFNKDNVLVTNGAIAANFLIYYTLVGPGDHVICVDPTYAQLYSVPKMFGAEVSL-LKLQ 132

Query: 231 EESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMV 290
           +E G+  + E ++K+++ + K       +++ NP NP G+ ++T+T+ ++ ++  + ++ 
Sbjct: 133 KEDGFIPNIETLKKMIKSNTK------LIIINNPNNPLGSAISTETLNDICQLCEENNIY 186

Query: 291 IIADEVYQ 298
           +  DEVY+
Sbjct: 187 LHCDEVYK 194

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 107/258 (41%), Gaps = 38/258 (14%)

Query: 114 ISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPA 173
           IS+LS+ E+ K      V+  K +    G    A S   G +  +  + EFI E +    
Sbjct: 72  ISELSNDEVCK------VDLKKDVKVHEGDIPLARSLQYGFSQGQPELLEFIREHNKLIH 125

Query: 174 SAQ----DIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHAL---P 226
             Q    D+  T G + A    L +FCN    G +I + +   +++ LA   +  +   P
Sbjct: 126 DMQYEDWDVVATAGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSCLAAAQAQGITTFP 181

Query: 227 YYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPG-NPTGALLNTDTIENVIKVAA 285
             +D++    +   ++E ++ +      +P  L  I  G NPTG  L  +    + ++A 
Sbjct: 182 VPIDDKG---IIPAKLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQ 238

Query: 286 KYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQK-----TEPGKYDNVQLASLHSTSKGV 340
           K+  +II D  Y         F+ M K  R LQK      +P +     LASL  T   V
Sbjct: 239 KHDFLIIEDAPYY--------FLQMDKYERDLQKRAVTRAQPRESHKDFLASLDKTFLSV 290

Query: 341 SGECGQRGGYMELVGFSE 358
             +    G  + L  FS+
Sbjct: 291 DTD----GRVIRLDSFSK 304

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 81/186 (43%), Gaps = 28/186 (15%)

Query: 115 SDLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPAS 174
           ++LS   L+++  P  +E  K  +        +YSN   V                   +
Sbjct: 44  NELSKSNLNRYPDPHQLE-FKTAMTTYRNKTSSYSNDPAVKSL----------------T 86

Query: 175 AQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHAL--PYYLDEE 232
           A ++ L  G+  ++  I+   C   +   L+  P Y +Y+    +N+   +  P  + + 
Sbjct: 87  ADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLVVSDN 146

Query: 233 SGWSMDTEQIEKVVQ-DSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVI 291
           S + MD E +  +++ D + K +      V +PGNPTGA + T  IE V++     + ++
Sbjct: 147 S-FQMDVEAVLTILENDPLIKLV-----FVTSPGNPTGAKIKTSLIEQVLQ--NWQNGLV 198

Query: 292 IADEVY 297
           + DE Y
Sbjct: 199 VVDEAY 204

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 74/157 (47%), Gaps = 14/157 (8%)

Query: 148 YSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPI 207
           Y NS+G       + E        P +  DI  TTG++ A    L +FCN    G  + +
Sbjct: 104 YGNSRGQKELVSFLKEHTSIFHSIPYNDWDIITTTGSTQAWDASLRIFCN---KGDTVLL 160

Query: 208 PQYPLYTASLALNNSHAL---PYYLDEESGWSMDTEQIEKVVQDSIKK--GI-RPTCLVV 261
            ++  Y++S+   ++  L   P  +D +    +  E++E+++ +   +  GI  P  L  
Sbjct: 161 EEF-TYSSSVEAADAQGLNCIPVPMDNQG---IIPEKLEEMLSNWTDRYPGIPMPKLLYT 216

Query: 262 INPG-NPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
           I  G NPTG  L+      + ++A KY ++I+ D+ Y
Sbjct: 217 IPTGQNPTGCTLSECRKPCIYRLAQKYDILIVEDDPY 253

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 76/187 (40%), Gaps = 36/187 (19%)

Query: 147 AYSNSQGVAGFRESVAEFIEE------RDGEPASAQDIF-LTTGASGAVSYIL---SLFC 196
            Y +++G    R ++ EF+ E      RD +  S  +   LT+GAS  V  IL   +L  
Sbjct: 50  TYGSNEGALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYGVLNILLQATLPH 109

Query: 197 NGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIE------------- 243
            G    A I  P Y L                +DE+   S+D E +E             
Sbjct: 110 TGVTKQAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESIDPNP 169

Query: 244 --------KVVQDSI-----KKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMV 290
                    ++++ I     KK  +    V+    NP+G   N +T   +I++A KY M+
Sbjct: 170 VNENGKELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKYDML 229

Query: 291 IIADEVY 297
           II D+VY
Sbjct: 230 IITDDVY 236

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 68/149 (45%), Gaps = 19/149 (12%)

Query: 177 DIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSH---ALPYYLDEES 233
           D+  T G + A    L +FCN    G +I + +   +++SLA   +    A P  +D + 
Sbjct: 134 DVVATAGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSSLAAAEAQGIIAFPVPIDADG 189

Query: 234 GWSMDTEQIEKVVQDSIKKGIRPTCLVVINPG-NPTGALLNTDTIENVIKVAAKYSMVII 292
              +  E++ K++ +      +P  L  I  G NPTG  +     E + K+A K+  +I+
Sbjct: 190 ---IIPEKLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFLIV 246

Query: 293 ADEVYQENGFNDAEFVSMKKVLRVLQKTE 321
            DE Y         F+ M   ++ L++ E
Sbjct: 247 EDEPYY--------FLQMNAYIKDLKERE 267

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 59/125 (47%), Gaps = 11/125 (8%)

Query: 177 DIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHAL---PYYLDEES 233
           DI  T G + A    L +FCN    G +I + +   +++ LA   +  +   P  +D+  
Sbjct: 133 DIIATAGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSCLAAAQAQGITTFPIPIDDNG 188

Query: 234 GWSMDTEQIEKVVQDSIKKGIRPTCLVVINPG-NPTGALLNTDTIENVIKVAAKYSMVII 292
              +  E++EK++ +      +P  L  I  G NPTG  L    +E + ++A K+  +I+
Sbjct: 189 ---IIPEKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLIV 245

Query: 293 ADEVY 297
            D  Y
Sbjct: 246 EDAPY 250

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 72/171 (42%), Gaps = 17/171 (9%)

Query: 145 VGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGAL 204
           V  YS ++G     +S+ +F          A +  + TGA+ A+  IL    N P +  +
Sbjct: 76  VNQYSPTRGRLSLIDSLVKFYTPFYNTKLEAANFSVFTGANEAIFSILIGLLN-PGDEVI 134

Query: 205 IPIPQYPLYTASLALNNSHAL------PYYLDEESG----WSMDTEQIEKVVQDSIKKGI 254
           +  P +  Y  ++ L+    +      P  LD        W +D + ++  +    K   
Sbjct: 135 VFEPFFDQYIPNIELSGGKVVYVPITPPKNLDTRVTKGEEWQIDWDSLQAAMNSKTK--- 191

Query: 255 RPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDA 305
               +++  P NP G +     +  +  +  K ++VII+DEVY+   F D+
Sbjct: 192 ---AIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEHLYFKDS 239

>KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {ON}
           Anc_8.204 YER152C
          Length = 443

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 74/181 (40%), Gaps = 31/181 (17%)

Query: 147 AYSNSQGVAGFRESVAEF-------IEERDGEPASAQDIFLTTGASGAVSYILSLFCNGP 199
            Y +++G    R ++ +F         E  G  ++ + + LT+GAS  V  IL L C  P
Sbjct: 52  TYGSNEGAHWVRSTICKFNNEEIFKFGENYGARSAPECLNLTSGASYGVLNIL-LQCTLP 110

Query: 200 ENG----ALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQ--DSIKKG 253
            N     A I  P Y L          H     ++E    S+D + +E  +   DSIK  
Sbjct: 111 HNNYTRQAFIISPTYFLINDCFIDAGFHGKLTAINEMGTDSIDFDTLESNLAELDSIKAD 170

Query: 254 IRPTCLV-----------------VINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEV 296
           +   C+                  V    NP+G   +  T   ++++A KY ++II D+V
Sbjct: 171 VGTQCITKNENSKGKKIYRYVLYCVPTYSNPSGHTYSLTTKLRLLELARKYDILIITDDV 230

Query: 297 Y 297
           Y
Sbjct: 231 Y 231

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 71/331 (21%), Positives = 129/331 (38%), Gaps = 60/331 (18%)

Query: 174 SAQDIFLTTGASGAV-SYILSLFCNGPENGALIPIPQYPLYTASLA--------LNNSHA 224
           + ++I +TTGA  A+   +++L   G E   + P     ++   +A        L N + 
Sbjct: 97  TNENILVTTGAIQALLESLMALIKPGDEVIVIEPFFDPYIHLIKIAGGVVKYVPLTNPNQ 156

Query: 225 LPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVA 284
               + E + W +D E +     D  K       +++ NP NP G + N D +  +  + 
Sbjct: 157 GKKRILEANDWILDRETLRAAFTDKTK------LMIINNPNNPLGKVFNRDELLEMATLC 210

Query: 285 AKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGEC 344
                 IIADEVY+   F      +   + R+   +E      + + S    +  +    
Sbjct: 211 VNNGAYIIADEVYEFLQF------TPNPLSRISNLSEAIAQKTITIGS----AGKIFRVT 260

Query: 345 GQRGGYM-----ELVGFSEEVKQVFLKL--ASISLCPVVTGQALIDLMVRPPKKGDASYE 397
           G R G+M     ELV   E+V  V +++   S S+  V +G  +                
Sbjct: 261 GWRVGWMISKNRELV---EKVTAVHVRMGFCSPSISQVASGLGI---------------- 301

Query: 398 QDRQERC----DIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYL---FPKLELSNKAIH 450
             R   C     + +   ++  ++Y+A   + GVS  +PQGA ++   F K+++      
Sbjct: 302 -QRALECGYFLSMPNEFDRKFSIIYKALDYL-GVSYTKPQGAHFIITDFSKVKIPEDYQF 359

Query: 451 KAESAGLAPDEYYCKELLEATGICTVPGSGF 481
                  A D +    L +   I  +P S F
Sbjct: 360 PEYLKNRARDFFISYWLTQEFCILLLPCSEF 390

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 73/162 (45%), Gaps = 15/162 (9%)

Query: 148 YSNSQGVAGFRESVAEFIEERDGEP---ASAQDIFLTTGASGAVSYILSLFCNGPENGAL 204
           YS +QG+    + +  FI + +  P    +  DI L  G+S ++  +    C+      +
Sbjct: 137 YSETQGMKPLLDFIKTFITKLNNTPPYNETLYDIMLANGSSDSMFKVFETLCDESTTVLM 196

Query: 205 IPIPQYPLYTASLALNNSHALPYYLD---EESGWSMDTEQIEKVVQD-----SIKKGIRP 256
                 P+ +  +A   +  +P  L+   E+ G  +D E +E ++ +     + K   +P
Sbjct: 197 EEFTFVPVISNVMA-TGAKCIPLKLNLNYEDQG--IDIEYLENLLDNWGGKSNTKHLSKP 253

Query: 257 TCLVVINPG-NPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
             L  I+ G NP G  L+ +    +  +A ++ ++I+ D+ Y
Sbjct: 254 KILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPY 295

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 73/166 (43%), Gaps = 10/166 (6%)

Query: 148 YSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPI 207
           Y NS+G       + E          +  D+  T G++ A    L LFCN    G  + +
Sbjct: 99  YGNSRGQPELISFLKEHTSIFHNISINDWDLITTAGSTQAWDACLRLFCN---RGETVLM 155

Query: 208 PQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDS--IKKGIRPTCLVVI-NP 264
            +Y  Y++SL    +  L     +     +  +++ ++++D     +G  P  L  I N 
Sbjct: 156 EEYT-YSSSLEAAVAQGLNCVAMKMDKDGIKVDKLSEMLRDWDVAVQGPFPKLLYTIPNG 214

Query: 265 GNPTGALLNTDTIENVIKVAAKYSMVIIADEVY---QENGFNDAEF 307
            NPTG  L+ +    ++++A++Y  +II D+ Y   Q N F   E 
Sbjct: 215 HNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPEL 260

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 73/183 (39%), Gaps = 34/183 (18%)

Query: 148 YSNSQGVAGFRESVAEFIEERDGEPASA------QDIFLTTGASGAVSYIL---SLFCNG 198
           Y +  G A  R  +AEF       P S+      + + LT+GAS  +  IL   +L   G
Sbjct: 48  YGSDNGSAWVRACIAEFSNRAFKLPVSSNAATRPEHLNLTSGASYGIMNILLQTTLPHTG 107

Query: 199 PENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVV------------ 246
               A I  P Y L   +  L+          EE G  +D   +E  +            
Sbjct: 108 YTKQAFIVTPTYFLVNKAF-LDAGFTGKITAVEEKGDGLDLAFLEAKLKSCENSSNGESG 166

Query: 247 ------------QDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIAD 294
                       QD  KK  R    +V    NPTGA+ +  +   ++++A KY ++II+D
Sbjct: 167 QKAEESLRIINAQDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISD 226

Query: 295 EVY 297
           +VY
Sbjct: 227 DVY 229

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 73/178 (41%), Gaps = 28/178 (15%)

Query: 148 YSNSQGVAGFRESVAEFIEER-----DGEPASAQ--DIFLTTGASGAVSYIL---SLFCN 197
           Y + +G    RE +  F+ ++     DG     Q   + L +GAS  +  IL   +L  N
Sbjct: 50  YGSDEGALWVREQICTFLNDQVFKFDDGARTRTQVDHLNLNSGASYGMLNILLQTTLPHN 109

Query: 198 GPENGALIPIPQYPLYTASL----------ALN-NSH------ALPYYLDEESGWSMDTE 240
           G    A I  P Y L               A+N  SH      +L   LD   G S    
Sbjct: 110 GYTRQAFIITPTYFLINDCFRDAGFKGRITAINEKSHDSIDFESLVAALDHHEGESQPDS 169

Query: 241 QIEKVVQDSIKKGIRPTCLVVI-NPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
             E +   ++ K I    L  I    NP+G   + +T   +I +A KY M++I+D+VY
Sbjct: 170 TTEIIQGPALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKYDMLVISDDVY 227

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 83/177 (46%), Gaps = 23/177 (12%)

Query: 174 SAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPY-YLDEE 232
           S +++ L  G+   +  ++   C       ++  P Y +Y+    +N+   +    + E+
Sbjct: 83  SHKNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVED 142

Query: 233 SGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKY-SMVI 291
           + + MD ++      +++KK      L + +PGNPTG ++    I+++I V   + + ++
Sbjct: 143 NSFQMDVKR----TLETLKKDDLIRLLFITSPGNPTGKII---AIKDIIYVLEHWKNGLV 195

Query: 292 IADEVYQE--NGFND----AEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSG 342
           + DE Y +    FN+     E+ S+ K++         KY N+ +    S S G++G
Sbjct: 196 VVDEAYVDFSTYFNEETKKTEYFSVAKLV--------TKYPNLTVLQTLSKSFGLAG 244

>AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGL202W (ARO8)
          Length = 512

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 72/159 (45%), Gaps = 18/159 (11%)

Query: 148 YSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPI 207
           Y NS+G +   E + +  E+      +  D+ +T G++ A    + LFCN  ++  +   
Sbjct: 98  YGNSRGQSELVEFLRQHTEKFHKLRYADWDVLVTAGSTQAWDATMRLFCNEGDSVVM--- 154

Query: 208 PQYPLYTASLALNNSHALPYYLDEESGWSMDTEQI--EKVVQ-----DSIKKG-IRPTCL 259
                +T S ++  + A   Y     G  +D+E I  E++ +     D+   G  RP  L
Sbjct: 155 ---EAFTYSSSVEAAEAQGLYC---VGMEVDSEGIVPERLAELLAEWDTQHAGHARPRVL 208

Query: 260 VVINPG-NPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
             I  G NP G+ L       + ++A +Y M+I+ D+ Y
Sbjct: 209 YTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPY 247

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 72/336 (21%), Positives = 132/336 (39%), Gaps = 63/336 (18%)

Query: 132 ERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGAS-GAVSY 190
           E+ KK L+ +  +   YS  +G     +++++       +    ++I +TTGA+ G  + 
Sbjct: 58  EQGKKALENIPAN--QYSPVRGQPILVDALSKLYSPVYKKQLKPENIQVTTGANVGIFAC 115

Query: 191 ILSLFCNGPENGALIPIPQYPLYTASL--------ALNNSHALPYYLDEESGWSMDTEQI 242
           ++SL   G E   L P     +Y   +         L     L     + S W++D +Q 
Sbjct: 116 LMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKDLKTRRTKGSEWTLDFDQF 175

Query: 243 EKVVQDSIKKGIRPTCLVVIN-PGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENG 301
              + +  K        V+IN P NPTG +   + +  +  +  + ++ II+DEVY+   
Sbjct: 176 RSAISEKTKA-------VIINSPHNPTGKVFTREELLTLGNICVEKNVYIISDEVYENLY 228

Query: 302 FNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGF----- 356
           F                       + V+LASL      ++   G  G    + G+     
Sbjct: 229 FTP---------------------ECVKLASLSPEISNITLTIGSAGKIFAVTGWRIGWI 267

Query: 357 -SEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHK--- 412
            SE V+   LKLAS       +    I      P +   ++  D     D  D + K   
Sbjct: 268 ISENVE--LLKLAS-------SAHIKICFSSPSPPQLACAHAIDIALNSDYFDRMRKDYI 318

Query: 413 -RSGLLYQAFQSMEGVSCQEPQGAMYL---FPKLEL 444
            +  +L   F+ + G+    P+G+ ++   F KL++
Sbjct: 319 EKVEILTSVFEEL-GMPYTVPEGSYFIVVDFSKLKI 353

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 58/127 (45%), Gaps = 9/127 (7%)

Query: 174 SAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHAL--PYYLDE 231
           S  ++  TTG + A    L +FCN    G +I    +   ++  +      +  P  +D 
Sbjct: 128 SDWNVVATTGNTNAWESTLRVFCN---RGDVILAEAHSFSSSLSSAEAQGVIVFPIPIDA 184

Query: 232 ESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPG-NPTGALLNTDTIENVIKVAAKYSMV 290
           +    +  E++EK++ +      RP  L  I  G NPTG  L  D  + + ++A K+  +
Sbjct: 185 DG---IIPEKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFL 241

Query: 291 IIADEVY 297
           II DE Y
Sbjct: 242 IIEDEPY 248

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 64/146 (43%), Gaps = 13/146 (8%)

Query: 177 DIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWS 236
           D+  T G +      L +FCN    G +I + +   +++SLA   +  +  +        
Sbjct: 134 DVLATAGNTNGWESTLRVFCN---RGDVI-LAEAHSFSSSLASAEAQGVITFPIPIDAGG 189

Query: 237 MDTEQIEKVVQDSIKKGIRPTCLVVINPG-NPTGALLNTDTIENVIKVAAKYSMVIIADE 295
           +  E++ K++ +      +P  L  I  G NPTG  +     E + K+A K+  +I+ DE
Sbjct: 190 IIPEKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDE 249

Query: 296 VYQENGFNDAEFVSMKKVLRVLQKTE 321
            Y         F+ M   ++ L++ E
Sbjct: 250 PYY--------FLQMNPYIKDLKERE 267

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 71/154 (46%), Gaps = 11/154 (7%)

Query: 148 YSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPI 207
           Y +SQG     + + E  E          ++ +T G + A    L +FCN    G  I +
Sbjct: 103 YGHSQGQPELLKFIREHTEIIHTMQYDDWELLVTAGNTSAWESTLRIFCN---RGDTI-L 158

Query: 208 PQYPLYTASLALNNSHAL---PYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINP 264
            +   +++SL+   +  +   P  +D++    +  E++  ++ +   +  +P  L  I  
Sbjct: 159 AEAHSFSSSLSAAQAQGIITFPVPIDDKG---IIPEKLAAIMDNWNPETPKPKLLYTIPT 215

Query: 265 G-NPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
           G NPTG+ L+ +    V K+A K+  +I+ DE Y
Sbjct: 216 GQNPTGSSLDAERKSQVYKIAQKHDFLIVEDEPY 249

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 84/186 (45%), Gaps = 21/186 (11%)

Query: 128 PDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGAS-G 186
           P A+  A+  L      V  Y+ ++G      S+ +           A ++ +TTGA+ G
Sbjct: 69  PFAIHEAQAALS--SPMVNQYAPTKGRVSLINSLVKLYSPLYNTQLDASNVQVTTGANEG 126

Query: 187 AVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHA--LPYYLDEE--------SGWS 236
            +S ++ L   G E   ++  P +  Y +++ +       +P +  +E        + W+
Sbjct: 127 ILSCLVGLLNPGDE--VIVFEPFFDQYISNIQIPGGKVTYVPMHPPKEMNVRNTKGTEWT 184

Query: 237 MDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEV 296
           ++ +++E  +    K       L++  P NP G +   + +  + ++  K+++VII+DEV
Sbjct: 185 VNYDELEAAITPKTK------ALILNTPHNPVGKVFTREELLRIGEICVKHNVVIISDEV 238

Query: 297 YQENGF 302
           Y+   F
Sbjct: 239 YEHLYF 244

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 56/122 (45%), Gaps = 5/122 (4%)

Query: 177 DIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWS 236
           ++  + G + A    L +FC   + G ++   +Y  +++ LA   +  +         + 
Sbjct: 131 EVIASVGNTNAWESTLRIFC---DRGDVVLFEEYS-FSSCLAACEAQGVTTIPIPIDAFG 186

Query: 237 MDTEQIEKVVQDSIKKGIRPTCLVVINPG-NPTGALLNTDTIENVIKVAAKYSMVIIADE 295
           +  E++E ++ +      +P  L  I  G NPTG  L  D  E + ++A K+  +I+ DE
Sbjct: 187 IVPEKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVEDE 246

Query: 296 VY 297
            Y
Sbjct: 247 PY 248

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 72/160 (45%), Gaps = 27/160 (16%)

Query: 147 AYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGA---VSYIL-----SLFCNG 198
           +Y   +G    R S+A       G   +  DI LT GA GA     Y L      + C  
Sbjct: 54  SYGAIKGSDELRTSIASLY----GPDFTMDDILLTNGAIGANFLAFYTLVGAGDHVICVE 109

Query: 199 PENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTC 258
           P    L  +P+  ++ A + L         L +E  +  + + ++ +++++ K       
Sbjct: 110 PTYSQLYSVPE--MFGAEVDL-------LTLKKEDDFLPNLQTLKSMIKNNTK------L 154

Query: 259 LVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQ 298
           +++ NP NP G+++  D ++ + K+  +  + + +DEVY+
Sbjct: 155 IIINNPNNPLGSVIKKDLLKQICKLCEENDIYLHSDEVYR 194

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 75/170 (44%), Gaps = 17/170 (10%)

Query: 145 VGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGAS-GAVSYILSLFCNGPENGA 203
           V  YS ++G      S+ +       +  + +++ +TTGA+ G +S ++ +   G E   
Sbjct: 85  VNQYSPTRGRPRLINSLIDLYSPFYKKQLTPENVLVTTGANEGILSCLMGIINPGDEVIV 144

Query: 204 LIP-----IPQYPL---YTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIR 255
             P     IP   L       + +N    L   + + + W++D ++  + +    K    
Sbjct: 145 FEPFFDQYIPNIELCGGKVVYVPINPPKELDNRVTKGTEWTVDFDEFTRAITPKTKA--- 201

Query: 256 PTCLVVIN-PGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFND 304
               V+IN P NP G +   + +  +  +  + +++IIADEVY+   F D
Sbjct: 202 ----VIINTPHNPIGKVFTREELTKLGNICVENNVIIIADEVYEHLYFVD 247

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 72/160 (45%), Gaps = 20/160 (12%)

Query: 148 YSNSQG----VAGFRESVAEF--IEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPEN 201
           Y NS+G    +A  +E V+ F  I  +D       DI  TTG++      L +FCN    
Sbjct: 103 YGNSRGQKELLAFLKEHVSLFHRILYKD------WDIITTTGSTQGWDASLRIFCN---K 153

Query: 202 GALIPIPQYPLYTASLALNNSHAL---PYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTC 258
           G  + +  Y  Y++S+   ++  L   P  LD E       E++         +   P  
Sbjct: 154 GDTVLLEDY-TYSSSVEAADAQGLNCVPMPLDGEGIVPSKLEEMLANWSSLYGEMPMPKL 212

Query: 259 LVVINPG-NPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
           L  I  G NPTG  L+ +   ++ ++A +Y ++II D+ Y
Sbjct: 213 LYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDIIIIEDDPY 252

>Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 71/178 (39%), Gaps = 28/178 (15%)

Query: 148 YSNSQGVAGFRESVAEFIEE-----RDGEPAS--AQDIFLTTGASGAVSYIL---SLFCN 197
           Y + +G    RE +  F+ E     +DG      AQ + L +GAS  +  IL   +L  N
Sbjct: 50  YGSDEGALWVREQICRFLNEQVFKFKDGARTRTLAQHLNLDSGASYGMLNILLQTTLPHN 109

Query: 198 GPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQI--------------- 242
           G    A I  P Y L                ++E    S+D E +               
Sbjct: 110 GYTRQAFIITPTYFLINDCFTDAGFKGKITAINERGHDSIDFESLIAALDRHEAEPQPRG 169

Query: 243 -EKVVQDS--IKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
             +++Q S   KK  +     +    NP+G   + +T   +I +A +Y M++I D+VY
Sbjct: 170 TTEIIQGSKLSKKIFKYVMYCIPTFANPSGNTYSLETRRRLIDIARQYDMLVITDDVY 227

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%)

Query: 236 SMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADE 295
           S D E I    + + KK  R     +    NP+G     +T   +I++A KY M+I+AD+
Sbjct: 175 SKDLELINNPWKSTHKKVYRYVLYCIPTFANPSGQTYTLETRRRLIEIARKYDMLILADD 234

Query: 296 VY 297
           VY
Sbjct: 235 VY 236

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 79/183 (43%), Gaps = 19/183 (10%)

Query: 130 AVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVS 189
            VE A+K L      V  YS ++G      S+ +           A +I +TTGA+  + 
Sbjct: 71  VVEEAQKALDD--AMVNQYSPTKGRMSLINSLIKQYSPLYNTQLQANNIQVTTGANEGIL 128

Query: 190 YILSLFCNGPENGALIPIPQYPLYTASLALNNSHA--LPYYLDEE--------SGWSMDT 239
             L    N P +  ++  P +  Y +++ +       +P +  +E        + W++D 
Sbjct: 129 ACLVGLLN-PGDEVIVFEPFFDQYISNIQIPGGKVTYVPLHPPKEMSVRPTEGTEWTVDY 187

Query: 240 EQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQE 299
           +++   +    K       L++  P NP G +   + +  + ++  + ++VII+DEVY+ 
Sbjct: 188 DELRAAITPKTK------ALILNTPHNPVGKVFTREELLQIGQICVENNVVIISDEVYEH 241

Query: 300 NGF 302
             F
Sbjct: 242 LYF 244

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 74/185 (40%), Gaps = 35/185 (18%)

Query: 148 YSNSQGVAGFRESVAEFIEER-----DGEPASAQDIFLT--TGASGAVSYIL---SLFCN 197
           Y + +G    RE + EF+ ++      G PA  +  +L    GAS  +  IL   +L  N
Sbjct: 50  YGSDEGALWVREQICEFLNDQVFRFDGGSPARTRPEYLNLDNGASYGMLNILLQTTLPHN 109

Query: 198 GPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQI--------------- 242
           G    A I  P Y L    L     +     ++E+   S+D E +               
Sbjct: 110 GYTRQAFIITPTYFLINDCLTDAGFNGKLTAINEKGHDSIDFESLLAALDQHEASAAAAT 169

Query: 243 --------EKVVQDS--IKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVII 292
                     ++Q S   KK  +     +    NP+G   + +T   +I++A KY M++I
Sbjct: 170 NSAAGSDPTAMIQGSKLTKKIYKYVMYCIPTFANPSGNTYSLETRRRLIEIARKYDMLVI 229

Query: 293 ADEVY 297
            D+VY
Sbjct: 230 TDDVY 234

>ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL106W (AAT1)
          Length = 443

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 54/243 (22%), Positives = 97/243 (39%), Gaps = 18/243 (7%)

Query: 119 SGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFI------EERDGEP 172
           +GE+  F    +V RA+ M++   G   AY    G   +   V++F+      + R+   
Sbjct: 76  NGEVTSF---PSVARAQLMVEGQRGGRLAYLPIAGCPSYGARVSDFLYSECAPQGREFLA 132

Query: 173 ASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEE 232
           +       T   +GA+S       N       +P P +  +     LN    +  Y   E
Sbjct: 133 SGCVSFMQTLSGTGALSLASLFLSNFISKTIWVPQPSWANHMNIFKLNGFEEVRRYRYYE 192

Query: 233 SGWSMDTEQIEKVVQDSIKKGIRPTCLVV-INPGNPTGALLNTDTIENVIKVAAKYSMVI 291
            G ++D +     ++ +      P C+++     NPTG     +    ++ V     MV 
Sbjct: 193 DG-AVDVDSWLAQLERAAADRPYPQCILLHACCHNPTGVDPTREQWSRILSVINGLGMVP 251

Query: 292 IADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYM 351
           I D  YQ  G    +  +   +LR+  +    ++DN  L   HS +K + G  G+R G +
Sbjct: 252 IVDMAYQ--GLESGDLRADAYLLRMCLEH---RWDN-GLYVCHSFAKNM-GLYGERVGSL 304

Query: 352 ELV 354
            +V
Sbjct: 305 SVV 307

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 40/194 (20%), Positives = 87/194 (44%), Gaps = 22/194 (11%)

Query: 128 PD-AVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASG 186
           PD A+  A++ L+    +   Y+ ++G     E++ +      G+ A A+++ +TTGA+ 
Sbjct: 84  PDFAIAGAQRALENAMNN--QYAPTRGRPALVEALLKLYRPMYGDLA-AENVQVTTGANE 140

Query: 187 AVSYILSLFCNGPENGALIPIPQYPLYTASLALNNS----------HALPYYLDEESGWS 236
            +   L+   N P +  ++  P +  Y  ++ L               L   + E + W 
Sbjct: 141 GIFACLAGLVN-PGDEVIVFEPFFDQYIPNIELLGGVVRYVPIRPPAELSKRVTEGTEWV 199

Query: 237 MDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEV 296
           +D + + + + +  K       +++ +P NP G +   + +  +  +  +  + II+DEV
Sbjct: 200 IDYDMLRQTINEKTK------AVIINSPHNPIGKVFTREELLKLGNICVEKGIYIISDEV 253

Query: 297 YQENGFNDAEFVSM 310
           Y+   F D EF  +
Sbjct: 254 YEHLYFTD-EFTRI 266

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 78/192 (40%), Gaps = 36/192 (18%)

Query: 147 AYSNSQGVAGFRESVAEF------IEERDGEPASAQDIFLTTGASGAVSYIL---SLFCN 197
            Y   +G A  RE++AE       +E+++     A+ + LT GAS  +  IL   +L   
Sbjct: 47  GYGTDKGAAWVRETIAELTNQVFGLEKQERMATDAEFLNLTAGASYGILNILLQTTLPHT 106

Query: 198 GPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQ---------- 247
                A I  P Y L    + L+   +      EE+   +D   +E+ ++          
Sbjct: 107 NYTRQAFIITPTYYLIN-KVFLDAGFSGKLTAVEETRHGIDLGFLEEKIKYFESSSHSTE 165

Query: 248 ----------------DSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVI 291
                           D  KK  R    +V    NP+GA  + +    ++ +A +Y ++I
Sbjct: 166 KSTSSSSQSLSIINAADDKKKFYRYVIYLVPTFSNPSGATYSQECRLKLLDLARRYDILI 225

Query: 292 IADEVYQENGFN 303
           I+D+VY   GF+
Sbjct: 226 ISDDVYDLLGFH 237

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 37.4 bits (85), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%)

Query: 238 DTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
           DT  +    ++  KK  R     V    NP+G   + +T + ++ +A KY M+IIAD+VY
Sbjct: 178 DTSCVTNPTKNPNKKVYRYVLYCVPTYANPSGMSFSLETKKKLLDLARKYDMLIIADDVY 237

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 37.4 bits (85), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 75/163 (46%), Gaps = 19/163 (11%)

Query: 148 YSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPI 207
           YS +QG+A   + +   +   +  P    D+ L  G+S +   +  LF    +    + +
Sbjct: 112 YSQTQGLAPILDFLKLIVANCNNPPYQNWDLLLANGSSDS---MFKLFDTLTDETTTVLV 168

Query: 208 PQYPLYTASLALNNSHA-----LPYYLDEESGWS---MDTEQIEKVVQD----SIKKGIR 255
            ++   T S  L+N  A     +P  L+  S  S   ++   ++ ++++      K   R
Sbjct: 169 EEF---TFSPVLSNITATGASCVPLQLNFTSNPSNQGINVTYLQHLLENWQSGPYKHLNR 225

Query: 256 PTCLVVINPG-NPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
           P+ L  I+ G NPTG  ++ +    + K+A KY+ +I+ D+ Y
Sbjct: 226 PSILYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER152C
          Length = 438

 Score = 37.0 bits (84), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 72/172 (41%), Gaps = 22/172 (12%)

Query: 148 YSNSQGVAGFRESVAEFIEE--RDGEPASAQDIFLTTGASGAVSYIL---SLFCNGPENG 202
           Y + QG    R ++A  I +  R  +   A+ + LT GAS  +  IL   +L   G    
Sbjct: 51  YGSEQGSLWVRSAIATLINDCYRPEKATRAEHVNLTGGASYGIMNILMQTTLAHAGYTRR 110

Query: 203 ALIPIPQYPL-------------YTASLALNNSHALPYYLDEE----SGWSMDTEQIEKV 245
           A +  P Y L              TA     +      YL E+          TE + + 
Sbjct: 111 AFLVSPTYFLINQIFLDAGFGGRMTAVRETQDGQLDLEYLAEKLSEFDAEHPSTEALTEP 170

Query: 246 VQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
            +   K+  R    ++    NP+G+  + +T   ++++A +Y M++I+D++Y
Sbjct: 171 RRTPPKRTYRYVMYLIPTYSNPSGSTYSLETRTRLVELARRYDMLLISDDIY 222

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 74/183 (40%), Gaps = 34/183 (18%)

Query: 148 YSNSQGVAGFRESVAEFIEERDGEPASAQ------DIFLTTGASGAVSYIL---SLFCNG 198
           Y +  G A  R  +AEF  +    P  +        + LT+GAS  +  IL   +L   G
Sbjct: 49  YGSDNGSAWVRACIAEFSNKVFKLPVHSSAATRPDHLNLTSGASYGIMNILVQTTLPHTG 108

Query: 199 PENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIE---KVVQDSI----- 250
               A I  P Y L   +  L+          EE G  +D   +E   K+ ++S      
Sbjct: 109 YTKQAFIVTPTYFLVNKAF-LDAGFTGKITAVEEKGDGLDLAFLEAKLKLFENSANGERE 167

Query: 251 ----------------KKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIAD 294
                           KK  R    +V    NPTGA+ +  +   ++++A KY ++II+D
Sbjct: 168 QKTEESLDIINAQGGQKKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISD 227

Query: 295 EVY 297
           +VY
Sbjct: 228 DVY 230

>NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204
          Length = 446

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 66/179 (36%), Gaps = 28/179 (15%)

Query: 147 AYSNSQGVAGFRESVAEFIEERDGEPASAQDIFL--TTGASGAVSYIL---SLFCNGPEN 201
            Y +  G    RE +A F  E+       +  FL  T+GAS  +  +L   SL   G   
Sbjct: 52  TYGSDLGALWVREQIARFNNEKIFHVNHTKPEFLNLTSGASYGILNVLLQTSLPHTGYTK 111

Query: 202 GALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDT-------------------EQI 242
            A I  P Y L                +DE  G   D                    E I
Sbjct: 112 QAFIVTPTYFLINDCFIDAGFGGKLTAIDETMGDEYDLNLELLETNLKSFAEEEDEKESI 171

Query: 243 EKVVQDSI----KKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
             + +D I    KK  R     V    NP+G   +  T   +I++A +Y M+II+D+VY
Sbjct: 172 SCIQRDKIGVENKKIYRFVMYCVPTFSNPSGNTYSLKTKLKLIELARRYDMLIISDDVY 230

>SAKL0H18612g Chr8 (1655787..1657124) [1338 bp, 445 aa] {ON} highly
           similar to gnl|GLV|KLLA0E00935g Kluyveromyces lactis
           KLLA0E00935g and similar to YER152C uniprot|P10356
           Saccharomyces cerevisiae YER152C Hypothetical ORF
          Length = 445

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 73/181 (40%), Gaps = 31/181 (17%)

Query: 147 AYSNSQGVAGFRESVAEFIEERDGEPASAQD----IFLTTGASGAVSYIL---SLFCNGP 199
            Y + +G    R+++ +F     G   S +     I LT GAS  V  IL   +L   G 
Sbjct: 50  TYGSDEGALWVRQAICDFSNHVFGLSDSVKSKPEFINLTGGASYGVMNILEQTTLAHTGY 109

Query: 200 ENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQ--DSIKKGI-RP 256
              A I  P Y L   +  ++           E G S+D E ++  ++  DSI  GI   
Sbjct: 110 TRQAFIVSPTYFLINETF-IDAGFNGKLTAINELGDSIDFETLKSKLEHFDSIDDGIDHS 168

Query: 257 TCLVVINP--------------------GNPTGALLNTDTIENVIKVAAKYSMVIIADEV 296
             L +IN                      NP G   N +T   +I +A K+ M+II+D+V
Sbjct: 169 KDLDLINSPSTAHPKKIYKYVLYFVPTYSNPGGKTYNLETRLKLIDLARKHDMLIISDDV 228

Query: 297 Y 297
           Y
Sbjct: 229 Y 229

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 69/179 (38%), Gaps = 28/179 (15%)

Query: 147 AYSNSQGVAGFRESVAEFIEER-----DGEPAS--AQDIFLTTGASGAVSYIL---SLFC 196
            Y + +G    RE +  F+ ++     +G  +   A  + L +GAS  +  IL   +L  
Sbjct: 49  TYGSDEGALWVREQICTFLNDQLFKFENGARSRTRADYLNLNSGASYGMLNILLQTTLPH 108

Query: 197 NGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDS------- 249
           NG    A I  P Y L                ++E+   S+D E +   ++         
Sbjct: 109 NGYTRQAFIITPTYFLINNCFTDAGFKGKMTAINEQGHDSIDFESLISALEQHEAEPQPH 168

Query: 250 -----------IKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
                       KK  R     +    NP+G   + +T   +I +A KY M+II D+VY
Sbjct: 169 STTEMIQGPKLTKKVYRYVMYCIPTFANPSGNTYSLETRRRLIDIARKYDMLIITDDVY 227

>TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa]
           {ON} Anc_8.204 YER152C
          Length = 444

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 72/182 (39%), Gaps = 25/182 (13%)

Query: 147 AYSNSQGVAGFRESVAEFIEERDGEPASAQD-IFLTTGASGAVSYIL---SLFCNGPENG 202
            Y + +G    R+ V   I +   +  S  + I LT+GAS  +  IL   +L   G    
Sbjct: 50  TYGSDEGALWVRQEVCNMINQIGSDINSKPEYINLTSGASYGILNILLQTTLPHTGYTKQ 109

Query: 203 ALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTE-----------QIEKVVQDSI- 250
           A I  P Y L           +    + E+   S+D E           +I  V Q+S  
Sbjct: 110 AFIVSPTYFLINDCFIDAGFGSKMTAIKEKGYTSIDLEYLKEKLEYFEQEIPDVPQNSTD 169

Query: 251 ---------KKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENG 301
                    KK  +     +    NP+G   + +T   +IK+A KY M+II D+VY    
Sbjct: 170 IIQNKNNLQKKIYKYVFYCIPTFSNPSGITWDYETRIQLIKIAKKYDMLIICDDVYDLLD 229

Query: 302 FN 303
           +N
Sbjct: 230 YN 231

>SAKL0C10142g Chr3 complement(913490..914338) [849 bp, 282 aa] {ON}
           similar to uniprot|P38120 Saccharomyces cerevisiae
           YBR146W MRPS9 Mitochondrial ribosomal protein of the
           small subunit
          Length = 282

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 48/92 (52%), Gaps = 13/92 (14%)

Query: 72  EEPGSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQ-----NPDLISDLSSGELHKFF 126
           E P  L FD+   A IG   +L  KP+  Y+Q+++LL      +P+L++D  +GEL ++F
Sbjct: 83  ERPAWLSFDEY--ALIGGGTRL--KPIQ-YQQLVSLLNRLHSIDPELVNDEINGELSQYF 137

Query: 127 KPDAVER---AKKMLKQVGGSVGAYSNSQGVA 155
           K   ++    A K L + G SV        VA
Sbjct: 138 KKTKLQSSHTAVKTLDEFGRSVAVGKRKTSVA 169

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 35/179 (19%), Positives = 80/179 (44%), Gaps = 29/179 (16%)

Query: 122 LHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLT 181
           LH++  P  +E  ++M                 A +R + + F ++    P +  ++ L 
Sbjct: 51  LHRYPDPHQLEFKRQM-----------------ATYRNNSSSF-KDLSLPPLTEDNLCLG 92

Query: 182 TGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPY-YLDEESGWSMDTE 240
            G+  ++  ++   C   +   L   P Y +Y+    +N+   L    + E++ +  D++
Sbjct: 93  VGSDESIDAVIRACCVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIYEDNSFQPDSQ 152

Query: 241 QIEKVVQ-DSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYS-MVIIADEVY 297
           ++  ++  D + K +      + +PGNPTGA ++++ I   IK+   +    ++ DE Y
Sbjct: 153 KVISILSSDPLIKLV-----FLTSPGNPTGAKIDSNII---IKILESWDGGFVVVDEAY 203

>TPHA0A02080 Chr1 (424056..425432) [1377 bp, 458 aa] {ON} Anc_8.204
           YER152C
          Length = 458

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 77/205 (37%), Gaps = 50/205 (24%)

Query: 147 AYSNSQGVAGFRESVAEF-------IEERDGEPASAQDIF-LTTGASGAVSYILSLFCNG 198
            Y +++G    R+++ EF        +  D    S  +   LT+GAS  V  IL L C  
Sbjct: 50  TYGSNEGSLWVRDTICEFNNYKAFKFKASDKNVKSKPEYLNLTSGASYGVLNIL-LQCTL 108

Query: 199 PENG----ALIPIPQYPLYTASL--------------ALNNSHALPY------YLDEESG 234
           P  G    A I  P Y L                     N+S  L        Y +E+  
Sbjct: 109 PHTGYTRQAFIITPTYFLINDCFFDAGFGNKLTAINEVGNDSFDLKMLEDKLIYFEEQ-- 166

Query: 235 WSMDTEQIEKVVQDSI-------------KKGIRPTCLVVINPGNPTGALLNTDTIENVI 281
             ++  +IE+   D               KK  R    ++    NP+    N +T   +I
Sbjct: 167 --VNVNKIEENCNDDFAVLRNPLKAEQDQKKIYRYVIYLIPTYSNPSSHTYNMETRVALI 224

Query: 282 KVAAKYSMVIIADEVYQENGFNDAE 306
            +A KY M+II D+VY    +N +E
Sbjct: 225 DLARKYDMLIITDDVYDLLNYNISE 249

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 25/129 (19%), Positives = 62/129 (48%), Gaps = 7/129 (5%)

Query: 170 GEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYL 229
           G   SA ++ +T GA GA +++L     G  +  +   P Y    +   +  +      L
Sbjct: 74  GVQFSADNVLVTNGAIGA-NFLLYYTLVGKGDHVICVHPTYSQLYSVPKMFGAEVTLLEL 132

Query: 230 DEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSM 289
            E+  +  + + ++K ++ + K       +++ NP NP G +++ + + ++ ++  + ++
Sbjct: 133 SEKDSFLPNLDTLKKAIKSNTK------LIIINNPNNPLGCVISDELLTSICELCKEKNV 186

Query: 290 VIIADEVYQ 298
            +  DEVY+
Sbjct: 187 YLHCDEVYR 195

>CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152c
          Length = 436

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 75/174 (43%), Gaps = 23/174 (13%)

Query: 147 AYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGAS-GAVSYIL--SLFCNGPENGA 203
            Y   +G    R+ + +F     G  +  + + L++G+S G +S +L  +L        A
Sbjct: 52  TYGPDEGALWVRQQICDFNNRLFGSDSKPEFLNLSSGSSYGCLSVLLHTTLPHTNFTRQA 111

Query: 204 LIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQI-------EKVVQDS------I 250
            I  P Y L           +    +DEE   S++ EQ+       E++  +S      I
Sbjct: 112 FIISPTYFLINDCFIDAGFGSKLTAIDEEGEDSINFEQLLSKLRHFEELYGNSNGDVSII 171

Query: 251 KKGIRPTCLV-------VINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
           +   +PT  V       V    NP+G   + +T   +I++A +Y M+II D+VY
Sbjct: 172 QNPNKPTKKVYKYVMYCVPTFANPSGKSYSLETRTKLIEIARRYDMLIICDDVY 225

>KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 445

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 76/189 (40%), Gaps = 33/189 (17%)

Query: 147 AYSNSQGVAGFRESVAEFI--------EERDGEPASAQDIFLTTGASGAVSYIL---SLF 195
            Y   +G    R ++A F         EE   +P   + I LT GAS  V  IL   +L 
Sbjct: 51  TYGPDEGSKWVRTAIAAFSNDCFQLPSEEMKTKP---EHINLTAGASYGVMNILEQTTLP 107

Query: 196 CNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQ--DSI--- 250
             G    A I  P Y L   +            +DE     +D + +++ ++  DSI   
Sbjct: 108 HTGYTRQAFIVSPTYFLINETFIDAGFGGKLTAIDELGHGKIDFDTLQQKLEYFDSISND 167

Query: 251 --------------KKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEV 296
                         KK  R    +V    NP G   + +T   +I++A K+ M+I++D+V
Sbjct: 168 NSSELQLITAPNANKKVYRYVIYLVPTYSNPGGQTYSLETRVKLIELARKHDMLIVSDDV 227

Query: 297 YQENGFNDA 305
           Y    ++D+
Sbjct: 228 YDLLRYDDS 236

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 7/76 (9%)

Query: 235 WSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIAD 294
           W++D +++   +    K       L++  P NP G +   + +  +  +  + ++VII+D
Sbjct: 187 WTVDYDELRAAITPKTK------ALILNTPHNPIGKVFTREELLEIGNICVENNVVIISD 240

Query: 295 EVYQENGFNDAEFVSM 310
           EVY+   F  +EF  +
Sbjct: 241 EVYEHLYFT-SEFTRI 255

>Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,
           443 aa] {ON} complement(37728..38465,38468..39061) [1332
           nt, 444 aa]
          Length = 443

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 68/321 (21%), Positives = 114/321 (35%), Gaps = 50/321 (15%)

Query: 153 GVAGFRESVAEFIEERDGEPASAQDIFLT-----------TGASGAVSYILSLFCNGPEN 201
           G   +R++V  F+  RD  P     +              TGA    S +LS F +   +
Sbjct: 99  GCPNYRDNVLNFLF-RDSVPKYGDKLIADNRVSFIQSLSGTGAIAVASKLLSSFIS---D 154

Query: 202 GALIPIPQYPLYTASLALNNSHALPYYLDEESG------WSMDTEQIEKVVQDSIKKGIR 255
              IP P +P +     +N    L YY     G      W    E  E  V+ S  K + 
Sbjct: 155 TVWIPNPSWPNHDNIFHMNGFKNLKYYSYYNDGKITIDRW---LESTETEVRSSNSK-LP 210

Query: 256 PTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLR 315
            + ++     NPTG     D    +I    +  M+ I D  YQ  G           +LR
Sbjct: 211 QSIILHACCHNPTGFDPTIDQWNEIIDTVYELDMIPIIDMAYQ--GLESGSLYDDAYLLR 268

Query: 316 VLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELV----------GFSEEVKQVFL 365
                   K     L    S +K + G  G+R G + +V              ++K++  
Sbjct: 269 HCLDESRYKGWKHGLFLCQSFAKNM-GLYGERVGSLSIVVPPNLEKAKLSIDSQLKKIVR 327

Query: 366 KLASISLCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSM- 424
            + S    P   G  + +L++  P       E   Q   D+H  + + + +  Q +  + 
Sbjct: 328 GIYS---SPPGYGCRIANLVLSQP-------ELRNQWHQDVHSIVGRLTNVRKQMYDKLG 377

Query: 425 -EGVSCQEPQGAMYLFPKLEL 444
             G+     Q  M+ F +L++
Sbjct: 378 WSGLVDSSQQHGMFYFTRLDI 398

>AER397C Chr5 complement(1392748..1397034) [4287 bp, 1428 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL079W
           (NUP170) and YER105C (NUP157)
          Length = 1428

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 46/79 (58%), Gaps = 5/79 (6%)

Query: 101 YRQVLALLQNPDLISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRES 160
           ++ ++  L + D+ SDL+  +    F P+  +++K++++++  S+   + S+G  GF E 
Sbjct: 863 FKDIMKFL-SLDVQSDLTKLKFKDIFAPN--DQSKRLVREILSSIINRNISRG--GFIEY 917

Query: 161 VAEFIEERDGEPASAQDIF 179
           +A  ++ER G   S+ D+ 
Sbjct: 918 IATALQERCGSFCSSSDVL 936

>NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa]
           {ON} Anc_8.204 YER152C
          Length = 478

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 83/191 (43%), Gaps = 17/191 (8%)

Query: 240 EQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQE 299
           E I +   +S+KK  +     V +  NP+G   +  T   +I +A  Y ++II D+VY+ 
Sbjct: 200 ECIRRPNANSMKKIYKYVLYCVPSFANPSGKSYSLKTKRKLIDLACLYDILIITDDVYEF 259

Query: 300 NGF--NDAEFVSMKKVLRVLQKTEPGKYDNVQLASL--HSTSKGVSGEC---GQRGGYME 352
             +  N A  V  K+ + + ++      D   L  +  H  S     +    G R GY E
Sbjct: 260 LNYKVNPATSVIPKRFVDIEREMWRDLPDGCDLEGMYGHVVSNATFSKIIAPGLRVGYNE 319

Query: 353 LVGFSEEVKQVFLKLASIS-LCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALH 411
            +  S+ V Q+    A++S   P      ++  M+R     + S  +  Q   ++ D   
Sbjct: 320 TIS-SKLVTQLSKGGANVSGGTPSQLNSMIVGTMLR-----NGSAMRILQ---NLRDTYK 370

Query: 412 KRSGLLYQAFQ 422
            RS +LY++ +
Sbjct: 371 HRSEVLYESIK 381

>TDEL0A01940 Chr1 (355974..357236) [1263 bp, 420 aa] {ON} Anc_2.420
           YLR027C
          Length = 420

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 72/192 (37%), Gaps = 22/192 (11%)

Query: 168 RDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPY 227
           + G  AS Q +  T     A  +I S     P     I  P +  + A           Y
Sbjct: 96  QQGRIASVQSLSGTGALHIAAKFISSFL---PGRSLYISEPTWANHNAIFKSQGVQTATY 152

Query: 228 YLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPG---NPTGALLNTDTIENVIKVA 284
              + S  ++D E   K ++D+      PT  V++      NPTG     D   ++I   
Sbjct: 153 PYWQASTKTLDMEGFLKTIKDA------PTGSVILLHACAHNPTGLDPTQDQWSDIIDAV 206

Query: 285 AKYSMVIIADEVYQ--ENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSG 342
           A    +++ D  YQ   +G  D +  +++  +  L +  P       +    S +K V G
Sbjct: 207 ASKDHIVLFDSAYQGFASGDLDRDAYAIRLGVEKLARVSP-------IFVCQSFAKNV-G 258

Query: 343 ECGQRGGYMELV 354
             G+R G   LV
Sbjct: 259 MYGERAGCFHLV 270

>Smik_11.135 Chr11 (224382..225737) [1356 bp, 451 aa] {ON} YKL106W
           (REAL)
          Length = 451

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 62/171 (36%), Gaps = 16/171 (9%)

Query: 182 TGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALN---NSHALPYYLDEE---SGW 235
           TGA    +  L+LF         IP P +  +      N   N H   YY D +    GW
Sbjct: 130 TGALAVAAKFLALFI---SRDIWIPDPSWANHKNIFQNNGFENIHRYSYYKDGQIDIDGW 186

Query: 236 SMDTEQIEKVVQDSIKKGIRPTCLVV-INPGNPTGALLNTDTIENVIKVAAKYSMVIIAD 294
               +      Q    K   P C+++     NPTG     +  + +I    + +MV I D
Sbjct: 187 IKQLKTFAYNTQSENNKN--PPCIILHACCHNPTGLDPTKEQWKEIIDTVYELNMVPIVD 244

Query: 295 EVYQENGFNDAEFVSMKKVLRVLQKTE--PGKYDNVQLASLHSTSKGVSGE 343
             YQ  G      +    +LR+       P   + + L    + + G+ GE
Sbjct: 245 MAYQ--GLESGNLLKDAYLLRLCLDVNRYPNWSNGIFLCQSFAKNMGLYGE 293

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
           Ashbya gossypii AGR141C
          Length = 446

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%)

Query: 251 KKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297
           KK  R    +V    NP+G   +  T   ++++A KY +++I+D+VY
Sbjct: 184 KKVYRYVMYLVPTFSNPSGKTYSVSTRLKLVELARKYDILLISDDVY 230

>Ecym_5623 Chr5 (1254121..1256373) [2253 bp, 750 aa] {ON} similar to
           Ashbya gossypii AFL187C
          Length = 750

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 177 DIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPL---YTASLALNNSHALPYYLDEE 232
           DI  +TG    +   LS+ C G +N  L P+  YPL    ++S+ +NNS  LP Y  EE
Sbjct: 132 DIGDSTGGWCLIEGELSVACTGSQNCQL-PLRCYPLAEKSSSSIYVNNSLLLPGYAPEE 189

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,826,106
Number of extensions: 2370914
Number of successful extensions: 6141
Number of sequences better than 10.0: 138
Number of HSP's gapped: 6224
Number of HSP's successfully gapped: 138
Length of query: 518
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 404
Effective length of database: 40,409,475
Effective search space: 16325427900
Effective search space used: 16325427900
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)