Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.237828.264ON41441421420.0
KLTH0G13640g8.264ON41441517590.0
SAKL0H16984g8.264ON43543911401e-154
ZYRO0C01606g8.264ON4324449721e-128
Ecym_43068.264ON4344219621e-127
AGR084C8.264ON4274339571e-126
TDEL0F039108.264ON4294119461e-124
KLLA0F19184g8.264ON5124219381e-122
NDAI0B020008.264ON4334478971e-117
NCAS0B050308.264ON4334468901e-116
Kpol_543.408.264ON4144057801e-100
TPHA0A017908.264ON4394517272e-91
YLR090W (XDJ1)8.264ON4593927248e-91
Smik_12.1498.264ON4604307082e-88
Skud_12.1588.264ON4553916942e-86
Suva_10.1748.264ON4564216621e-81
KNAG0G020508.264ON4323836556e-81
CAGL0L12276g8.264ON4524616212e-75
CAGL0J09966g2.243ON4073655292e-62
YNL064C (YDJ1)2.243ON4094225274e-62
Smik_14.2632.243ON4094225241e-61
KLLA0F03333g2.243ON4093655231e-61
Skud_14.2682.243ON4104225213e-61
NDAI0D010302.243ON4113665204e-61
TBLA0E038102.243ON4103675162e-60
Suva_14.2772.243ON4094225152e-60
KAFR0J009402.243ON4113665101e-59
ADL257C2.243ON4103675101e-59
ZYRO0A01496g2.243ON4123705065e-59
KNAG0I019002.243ON4093675056e-59
Kwal_23.48302.243ON4114235003e-58
Ecym_32812.243ON4093664987e-58
Kpol_1003.122.243ON4083654961e-57
TPHA0C031102.243ON4073654892e-56
SAKL0E08734g2.243ON4113664821e-55
TDEL0C046002.243ON4113664794e-55
KLTH0G09394g2.243ON4114294794e-55
NCAS0G030002.243ON4103674771e-54
KLTH0G08756g2.218ON4623924423e-49
KLLA0E07899g2.218ON4954064401e-48
TDEL0C043502.218ON4623754198e-46
AER427W2.218ON4703644162e-45
Kwal_23.30612.218ON4583774101e-44
SAKL0E09306g2.218ON4613774013e-43
ZYRO0C15048g2.218ON4913974014e-43
SAKL0H05258g8.730ON3683503831e-41
Ecym_62368.730ON3743593789e-41
Ecym_53842.218ON5034043832e-40
KAFR0A041608.730ON3783563727e-40
YMR214W (SCJ1)8.730ON3773533631e-38
NCAS0B005308.730ON3753563622e-38
Skud_14.2532.218ON5324273641e-37
KNAG0M020202.218ON4603543602e-37
YNL077W (APJ1)2.218ON5284123603e-37
Smik_13.4228.730ON3783543534e-37
CAGL0J10296g2.218ON4793943575e-37
Suva_13.3978.730ON3753513509e-37
Suva_14.2622.218ON5364243589e-37
KLLA0C07260g8.730ON3683583509e-37
ZYRO0A06226g8.730ON3773573491e-36
Skud_13.3838.730ON3753513463e-36
Kpol_1002.1222.218ON5034053524e-36
TBLA0E036602.218ON4484063461e-35
KNAG0G028808.730ON3783743412e-35
NDAI0F024502.218ON5304483473e-35
TDEL0B037908.730ON3733613384e-35
NDAI0E008708.730ON3763513369e-35
CAGL0F03729g8.730ON3613443322e-34
TPHA0G006308.730ON3933663254e-33
NCAS0G028502.218ON4943923296e-33
Kpol_1064.408.730ON3873553238e-33
KNAG0G011308.61ON5004163271e-32
TPHA0D005508.61ON4863983234e-32
KLTH0D12496g8.730ON3753593132e-31
TBLA0B034908.730ON3843622922e-28
AER346W8.730ON3673472851e-27
Smik_14.2492.218ON5332932732e-25
KAFR0C031608.61ON4984022617e-24
NDAI0G032808.61ON5524102618e-24
TBLA0D026008.61ON5104122601e-23
Kwal_26.90248.730ON3752242392e-21
ZYRO0F03652g8.61ON4623992394e-21
NCAS0C039508.61ON5194092361e-20
Smik_6.638.61ON5104012272e-19
YFL016C (MDJ1)8.61ON5114022219e-19
Suva_6.448.61ON5074062192e-18
Kpol_1011.98.61ON4953992182e-18
CAGL0J04224g8.61ON5224202183e-18
Skud_6.568.61ON5174132094e-17
TDEL0H022907.217ON387911852e-14
TPHA0C029802.218ON5542191854e-14
TBLA0E024907.217ON3661011791e-13
KNAG0I007407.157ON425981791e-13
CAGL0J01936g7.157ON425981782e-13
TBLA0D042407.217ON389941772e-13
ZYRO0D16390g7.217ON398911773e-13
CAGL0J02750g7.217ON382911763e-13
NCAS0E029307.217ON387911763e-13
AFR507W8.61ON474681773e-13
KLTH0A03740g7.217ON3951101754e-13
TBLA0J018707.157ON470981748e-13
ADR015W7.157ON436981738e-13
KLLA0D04818g1.398ON354671711e-12
SAKL0F04444g7.157ON429991721e-12
KAFR0B047807.157ON423981721e-12
KLLA0D13464g7.157ON433981712e-12
Kwal_47.179578.61ON4782551712e-12
Kwal_0.2071.398ON353671692e-12
TPHA0C012607.217ON380911702e-12
KNAG0L013307.217ON396911702e-12
NDAI0E045607.217ON394911702e-12
NDAI0C026101.398ON340671682e-12
KAFR0L007407.217ON364911692e-12
NDAI0A028207.157ON482981702e-12
Ecym_44697.157ON433981703e-12
Ecym_43727.217ON579671703e-12
Skud_5.1587.217ON391911693e-12
NDAI0G042501.398ON363671683e-12
CAGL0H03707g1.398ON349671673e-12
Suva_5.1507.217ON391911674e-12
AAL008W1.398ON349671664e-12
NCAS0A132107.157ON414981674e-12
ZYRO0E04598g1.398ON357671665e-12
KAFR0H031501.398ON359671665e-12
Kpol_457.151.398ON357671656e-12
Kpol_1070.227.217ON380911659e-12
Smik_5.1737.217ON391911641e-11
Kwal_47.181337.217ON3931251641e-11
CAGL0L00957g7.217ON373911631e-11
Kpol_1072.48.698ON661771651e-11
TPHA0B037601.398ON355671621e-11
YER048C (CAJ1)7.217ON391911631e-11
SAKL0D08778g1.398ON348671622e-11
TDEL0B059601.398ON369671622e-11
YNL007C (SIS1)1.398ON352671622e-11
Smik_14.3211.398ON366671622e-11
CAGL0G07469g8.698ON668901642e-11
KLTH0H12100g1.398ON350671612e-11
Suva_14.3411.398ON359671612e-11
KNAG0H016801.398ON363671612e-11
SAKL0B01276gna 1ON292881592e-11
YMR161W (HLJ1)2.350ON2241241562e-11
TBLA0A011007.157ON434981613e-11
Skud_14.3201.398ON368671613e-11
TPHA0L007907.157ON446911613e-11
KLLA0E04423g7.217ON428731613e-11
TPHA0G014808.698ON660781614e-11
Skud_13.3232.350ON2241241554e-11
Smik_13.3612.350ON2241241554e-11
Smik_9.2037.157ON432981604e-11
ZYRO0G03850g7.157ON418981595e-11
KNAG0J018408.698ON650771596e-11
KLTH0A02882g8.61ON4732521587e-11
KAFR0H023108.698ON655771598e-11
KLTH0F13398g7.157ON419981578e-11
TBLA0C014801.398ON353671569e-11
TDEL0A064308.698ON666771589e-11
Kwal_55.209657.157ON421981561e-10
SAKL0F08052g7.217ON393911551e-10
NCAS0G036101.398ON327671532e-10
NCAS0C048901.398ON367671542e-10
YIR004W (DJP1)7.157ON432981542e-10
Ecym_12921.398ON347671523e-10
Suva_9.2137.157ON431981533e-10
Skud_9.1817.157ON421981524e-10
TDEL0E005002.15ON581841516e-10
YJR097W (JJJ3)1.113ON172641437e-10
Suva_13.3402.350ON2251211458e-10
Smik_15.4378.698ON663871509e-10
NCAS0C012208.698ON669771491e-09
TBLA0B037308.698ON693771491e-09
KLLA0C09823g8.698ON669771472e-09
TDEL0H032107.157ON411911453e-09
YOR254C (SEC63)8.698ON663871463e-09
Suva_8.3038.698ON664841463e-09
Kpol_499.307.157ON408911444e-09
Suva_12.1851.113ON168641374e-09
NCAS0A093201.297ON635941445e-09
Ecym_23748.698ON661851446e-09
CAGL0J07370g2.15ON623661436e-09
Skud_15.4208.698ON665841436e-09
ZYRO0D10934g8.698ON663841437e-09
SAKL0H05984g8.698ON658841437e-09
TDEL0G028002.350ON2251131387e-09
Skud_14.1102.15ON596831429e-09
Suva_14.1162.15ON600831411e-08
ZYRO0F15400g2.15ON525931401e-08
KAFR0C024507.217ON373911391e-08
KNAG0F008602.15ON6261191401e-08
KLTH0F09944g2.350ON2331171352e-08
YNL227C (JJJ1)2.15ON590851392e-08
CAGL0C04565g1.113ON175871312e-08
KLLA0D19602g2.15ON620681383e-08
Smik_14.1062.15ON593831374e-08
NCAS0I028301.185ON491651364e-08
KNAG0I008602.350ON219921324e-08
Kwal_26.88798.698ON656771374e-08
NDAI0H031802.350ON229671316e-08
Kpol_1027.131.297ON641681357e-08
KLTH0B08338g2.15ON590831347e-08
Suva_6.1481.297ON642681348e-08
Skud_10.1691.297ON6441021349e-08
NDAI0D005001.113ON190701271e-07
Kpol_529.212.15ON622661331e-07
Skud_10.3191.113ON168641251e-07
Ecym_14508.61ON492691321e-07
KNAG0A056502.350ON175861252e-07
Kwal_23.3578singletonOFF85611192e-07
KLTH0D11770g8.698ON652771312e-07
KLLA0E01629g2.350ON231671272e-07
Kpol_526.62.350ON228841272e-07
NDAI0K012308.698ON680771312e-07
NCAS0G013602.15ON616661302e-07
Smik_10.1681.297ON649721303e-07
ABL194C2.15ON552661303e-07
TDEL0C058801.113ON1591301223e-07
SAKL0E06050g2.350ON232671253e-07
TBLA0B093802.350ON2271131254e-07
AFL190C2.350ON235671254e-07
TBLA0G001702.15ON659661294e-07
KLTH0G18546gna 1ON283911264e-07
NDAI0F038002.15ON638821284e-07
NCAS0D009602.350ON224671235e-07
ADL327W3.350ON3051091256e-07
TPHA0C045902.350ON233671228e-07
YJL073W (JEM1)1.297ON645681268e-07
Ecym_56262.350ON243671228e-07
Ecym_11101.113ON156671198e-07
KLLA0D07656g8.61ON4712661258e-07
KAFR0A079502.15ON551661259e-07
Smik_10.3851.113ON172671191e-06
TDEL0D016401.297ON6041011251e-06
Kwal_23.44202.15ON592831241e-06
TPHA0I011101.297ON666691232e-06
AAL103W8.698ON669771232e-06
KAFR0A016201.297ON665691232e-06
CAGL0H02827g1.297ON656681232e-06
KLTH0F04906g1.185ON590641222e-06
Kwal_14.24521.297ON6071001222e-06
TPHA0O019402.15ON598661223e-06
KNAG0C024501.185ON544641213e-06
KAFR0F018101.185ON555641213e-06
KLLA0D06402g1.297ON631931213e-06
KLTH0H10032g1.297ON607661213e-06
ADR124C1.297ON611671213e-06
CAGL0H04499g2.350ON232671174e-06
SAKL0E14234g2.15ON678661204e-06
TDEL0C008708.61ON470691186e-06
Kwal_33.138601.185ON578711196e-06
KNAG0B052401.297ON668681196e-06
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23782
         (414 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...   829   0.0  
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...   682   0.0  
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...   443   e-154
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...   379   e-128
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...   375   e-127
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...   373   e-126
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...   369   e-124
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...   365   e-122
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264    350   e-117
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264    347   e-116
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...   305   e-100
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...   284   2e-91
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...   283   8e-91
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...   277   2e-88
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...   271   2e-86
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...   259   1e-81
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...   256   6e-81
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...   243   2e-75
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   208   2e-62
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...   207   4e-62
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...   206   1e-61
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   206   1e-61
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...   205   3e-61
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...   204   4e-61
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   203   2e-60
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...   202   2e-60
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...   201   1e-59
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...   201   1e-59
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...   199   5e-59
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...   199   6e-59
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...   197   3e-58
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...   196   7e-58
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   195   1e-57
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...   192   2e-56
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...   190   1e-55
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...   189   4e-55
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...   189   4e-55
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...   188   1e-54
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...   174   3e-49
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...   174   1e-48
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...   166   8e-46
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...   164   2e-45
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...   162   1e-44
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...   159   3e-43
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...   159   4e-43
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...   152   1e-41
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...   150   9e-41
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...   152   2e-40
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...   147   7e-40
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...   144   1e-38
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730      144   2e-38
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...   144   1e-37
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...   143   2e-37
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...   143   3e-37
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...   140   4e-37
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...   142   5e-37
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...   139   9e-37
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...   142   9e-37
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...   139   9e-37
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...   139   1e-36
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...   137   3e-36
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...   140   4e-36
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...   137   1e-35
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...   135   2e-35
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...   138   3e-35
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...   134   4e-35
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...   134   9e-35
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...   132   2e-34
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...   129   4e-33
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218    131   6e-33
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....   129   8e-33
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...   130   1e-32
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...   129   4e-32
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...   125   2e-31
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...   117   2e-28
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...   114   1e-27
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...   109   2e-25
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...   105   7e-24
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...   105   8e-24
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...   104   1e-23
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...    97   2e-21
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    97   4e-21
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    96   1e-20
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    92   2e-19
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    90   9e-19
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    89   2e-18
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    89   2e-18
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    89   3e-18
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    85   4e-17
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    76   2e-14
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    76   4e-14
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    74   1e-13
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    74   1e-13
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    73   2e-13
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    73   2e-13
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    73   3e-13
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    72   3e-13
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     72   3e-13
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    73   3e-13
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    72   4e-13
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    72   8e-13
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    71   8e-13
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...    70   1e-12
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    71   1e-12
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               71   1e-12
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    70   2e-12
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    70   2e-12
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...    70   2e-12
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    70   2e-12
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    70   2e-12
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             70   2e-12
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}               69   2e-12
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    70   2e-12
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    70   2e-12
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    70   3e-12
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    70   3e-12
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    70   3e-12
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...    69   3e-12
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...    69   3e-12
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    69   4e-12
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...    69   4e-12
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    69   4e-12
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...    69   5e-12
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...    69   5e-12
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...    68   6e-12
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    68   9e-12
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    68   1e-11
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    68   1e-11
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    67   1e-11
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    68   1e-11
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...    67   1e-11
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    67   1e-11
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...    67   2e-11
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...    67   2e-11
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...    67   2e-11
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...    67   2e-11
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    68   2e-11
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...    67   2e-11
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...    67   2e-11
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...    67   2e-11
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    66   2e-11
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    65   2e-11
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    67   3e-11
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...    67   3e-11
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    67   3e-11
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    67   3e-11
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    67   4e-11
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    64   4e-11
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    64   4e-11
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    66   4e-11
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    66   5e-11
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    66   6e-11
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    65   7e-11
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    66   8e-11
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    65   8e-11
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    65   9e-11
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    65   9e-11
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    65   1e-10
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    64   1e-10
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398      64   2e-10
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398     64   2e-10
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    64   2e-10
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...    63   3e-10
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    64   3e-10
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    63   4e-10
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    63   6e-10
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    60   7e-10
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    60   8e-10
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    62   9e-10
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     62   1e-09
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    62   1e-09
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    61   2e-09
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    60   3e-09
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    61   3e-09
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    61   3e-09
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    60   4e-09
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    57   4e-09
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    60   5e-09
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    60   6e-09
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    60   6e-09
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    60   6e-09
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    60   7e-09
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    60   7e-09
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    58   7e-09
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    59   9e-09
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    59   1e-08
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    59   1e-08
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    58   1e-08
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    59   1e-08
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    57   2e-08
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    58   2e-08
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    55   2e-08
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    58   3e-08
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    57   4e-08
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    57   4e-08
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    55   4e-08
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    57   4e-08
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      55   6e-08
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    57   7e-08
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    56   7e-08
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    56   8e-08
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    56   9e-08
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    54   1e-07
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    56   1e-07
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    53   1e-07
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    55   1e-07
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    53   2e-07
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    50   2e-07
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    55   2e-07
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    54   2e-07
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    54   2e-07
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    55   2e-07
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    55   2e-07
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    55   3e-07
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    55   3e-07
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    52   3e-07
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    53   3e-07
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    53   4e-07
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    53   4e-07
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    54   4e-07
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    53   4e-07
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      54   4e-07
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    52   5e-07
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    53   6e-07
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    52   8e-07
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    53   8e-07
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    52   8e-07
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    50   8e-07
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    53   8e-07
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    53   9e-07
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    50   1e-06
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    53   1e-06
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    52   1e-06
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    52   2e-06
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    52   2e-06
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    52   2e-06
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    52   2e-06
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    52   2e-06
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    52   2e-06
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    52   3e-06
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    51   3e-06
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    51   3e-06
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    51   3e-06
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    51   3e-06
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    51   3e-06
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    50   4e-06
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    51   4e-06
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    50   6e-06
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    50   6e-06
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    50   6e-06
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    48   7e-06
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    50   8e-06
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    50   9e-06
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    50   9e-06
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    50   9e-06
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    48   1e-05
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    50   1e-05
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    48   1e-05
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    49   1e-05
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    47   1e-05
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    49   2e-05
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    49   2e-05
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    49   2e-05
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    48   2e-05
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    48   3e-05
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    48   4e-05
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    47   4e-05
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    45   7e-05
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    46   7e-05
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    44   9e-05
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    46   1e-04
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    45   1e-04
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    45   1e-04
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    45   2e-04
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    45   2e-04
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    45   2e-04
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       45   3e-04
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    45   3e-04
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    45   3e-04
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    43   3e-04
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    44   3e-04
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    44   4e-04
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    44   5e-04
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    44   7e-04
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    42   7e-04
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    43   7e-04
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    44   7e-04
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    43   8e-04
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    42   8e-04
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    43   8e-04
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    43   8e-04
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    43   0.001
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    41   0.001
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    43   0.001
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    43   0.001
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    43   0.001
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    43   0.001
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    41   0.002
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    42   0.002
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    40   0.003
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    42   0.003
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    41   0.003
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    42   0.003
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    41   0.005
NCAS0F03900 Chr6 complement(783960..784901) [942 bp, 313 aa] {ON...    40   0.005
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    40   0.005
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    41   0.005
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    40   0.006
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    40   0.006
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    39   0.007
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    40   0.009
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    40   0.009
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    40   0.009
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    40   0.009
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    39   0.010
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    40   0.011
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    39   0.011
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    40   0.012
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    39   0.014
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    39   0.015
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    39   0.019
NDAI0B06200 Chr2 complement(1506799..1507749) [951 bp, 316 aa] {...    39   0.019
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    39   0.020
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    39   0.024
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    38   0.024
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    38   0.032
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    38   0.034
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    37   0.046
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    37   0.051
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    37   0.053
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         37   0.054
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    37   0.057
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    37   0.059
TDEL0C04920 Chr3 complement(889534..890448) [915 bp, 304 aa] {ON...    37   0.060
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    37   0.073
Smik_16.302 Chr16 complement(552646..553554) [909 bp, 302 aa] {O...    37   0.099
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    36   0.13 
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    35   0.15 
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    36   0.17 
KLTH0E15268g Chr5 complement(1353439..1354302) [864 bp, 287 aa] ...    36   0.17 
CAGL0C02123g Chr3 (215564..216457) [894 bp, 297 aa] {ON} similar...    35   0.19 
Kwal_14.1136 s14 complement(211335..212195) [861 bp, 286 aa] {ON...    35   0.27 
KLLA0A01133g Chr1 (103746..104579) [834 bp, 277 aa] {ON} similar...    35   0.27 
Suva_16.388 Chr16 complement(682753..683655) [903 bp, 300 aa] {O...    35   0.34 
SAKL0B07568g Chr2 complement(649545..650396) [852 bp, 283 aa] {O...    34   0.61 
Kpol_376.12 s376 complement(19211..20083) [873 bp, 290 aa] {ON} ...    33   0.93 
Skud_16.346 Chr16 complement(640855..641760) [906 bp, 301 aa] {O...    33   0.94 
NCAS0A11080 Chr1 complement(2203317..2204174) [858 bp, 285 aa] {...    33   1.1  
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    33   1.4  
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    33   1.7  
Skud_6.132 Chr6 complement(232394..233278) [885 bp, 295 aa] {ON}...    32   1.9  
YFR041C Chr6 complement(237368..238255) [888 bp, 295 aa] {ON}  E...    32   2.2  
KLLA0C02541g Chr3 complement(226721..227533) [813 bp, 270 aa] {O...    32   2.7  
Ecym_2578 Chr2 complement(1130625..1131521) [897 bp, 298 aa] {ON...    32   2.7  
NDAI0D03610 Chr4 (859564..860136) [573 bp, 190 aa] {ON} Anc_4.10...    32   2.8  
CAGL0D01584g Chr4 (167879..168781) [903 bp, 300 aa] {ON} similar...    31   4.2  
YPR061C Chr16 complement(675977..676882) [906 bp, 301 aa] {ON}  ...    31   4.6  
Suva_12.16 Chr12 (21243..22130) [888 bp, 295 aa] {ON} YFR041C (R...    31   4.6  
Smik_7.1 Chr7 complement(1571..3448) [1878 bp, 625 aa] {ON} YOR3...    32   4.7  
AFR246C Chr6 complement(883072..883938) [867 bp, 288 aa] {ON} Sy...    31   5.4  
ZYRO0D12804g Chr4 complement(1079076..1082225) [3150 bp, 1049 aa...    31   5.9  
Smik_7.361 Chr7 complement(598202..599089) [888 bp, 295 aa] {ON}...    31   6.2  

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {ON}
           YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig 173]
           FULL
          Length = 414

 Score =  829 bits (2142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/414 (96%), Positives = 401/414 (96%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNE 60
           MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNE
Sbjct: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNE 60

Query: 61  EKRRNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRTDDAHVSL 120
           EKRRNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRTDDAHVSL
Sbjct: 61  EKRRNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRTDDAHVSL 120

Query: 121 RLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGF 180
           RLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGF
Sbjct: 121 RLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGF 180

Query: 181 VTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEAD 240
           VTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEAD
Sbjct: 181 VTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEAD 240

Query: 241 EEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRL 300
           EEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRL
Sbjct: 241 EEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRL 300

Query: 301 KIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEALRNII 360
           KIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEALRNII
Sbjct: 301 KIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEALRNII 360

Query: 361 PQXXXXXXXXXXXXXEPDPVNTEMPTFDILKSAEELPNYLPDDAEQGGPQCSQQ 414
           PQ             EPDPVNTEMPTFDILKSAEELPNYLPDDAEQGGPQCSQQ
Sbjct: 361 PQSTSSSAASSSASAEPDPVNTEMPTFDILKSAEELPNYLPDDAEQGGPQCSQQ 414

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 414

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/415 (76%), Positives = 365/415 (87%), Gaps = 2/415 (0%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNE 60
           MDPY+TLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLR+ESEIKFKEVAAAYELLSNE
Sbjct: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNE 60

Query: 61  EKRRNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRTDDAHVSL 120
           EKR+NYDTYGDTNG+S  Y GFQDGDFASFFGNFAS RY+DE + ++   PRTDDAHV +
Sbjct: 61  EKRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTDDAHVPI 120

Query: 121 RLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGF 180
           RLTMQ+LYNGKT+RFQ+ RNVVCNRCEG G+R+RARHASAC+ CEGHGVKQRLRRLGPGF
Sbjct: 121 RLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHASACSQCEGHGVKQRLRRLGPGF 180

Query: 181 VTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEAD 240
           VTRE VQC KC+GLGKNLRSED+CKKCHGKRVTPE+KNLNVYIPRGSRH DR+VL+GEAD
Sbjct: 181 VTREIVQCDKCKGLGKNLRSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVLKGEAD 240

Query: 241 EEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRL 300
           EEPGK+ GDLVFDI+E+S +S+LERRGSDL+ KI ISLSDALTGFEKEVCTTLDGR L+L
Sbjct: 241 EEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLDGRLLKL 300

Query: 301 KIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEALRNII 360
           K+P GQV+RPGN++ + NEGWPLDD+G KFG+MYVQI+IEFPPDHW+SER ++++L+N++
Sbjct: 301 KVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVKSLQNLL 360

Query: 361 PQXXXXXXXXXXXXXEPDPVNTEMP-TFDILKSAEELPNYLPDDAEQGGPQCSQQ 414
           PQ               DP NTE P  F I+KSAEELP YL +++E  GPQC+QQ
Sbjct: 361 PQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEESEP-GPQCAQQ 414

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 435

 Score =  443 bits (1140), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 237/439 (53%), Positives = 307/439 (69%), Gaps = 36/439 (8%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGVAPDA+Q EIKKAYR+LALQHHPDKV+DE LREESE+KFKE+ AAYE+LS+E+ R
Sbjct: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64

Query: 64  RNYDTYGD--TNGYSDSYGGFQDGDFASFFGNFASGRYEDE-------EDFRAHARPRTD 114
           + YD YGD            F D DF +FF  +A G + DE       E+ R+    RT 
Sbjct: 65  KKYDVYGDDAPGASGGGGDPFGDDDFMNFFRTYAGGGFYDEPRQPYPEEENRS---VRTS 121

Query: 115 DAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKR----ARHASACTHCEGHGVK 170
           DA + L+L+M++LYNGKT +F+S RNV+C+RC+G+G+RK+     R    C  CEGHG K
Sbjct: 122 DARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHK 181

Query: 171 QRLRRLGPGFVTRETVQCTKCRGLGKNL--RSEDLCKKCHGKRVTPETKNLNVYIPRGSR 228
           +R++R+  GFV RETV+C +C G G+    + ED CKKCHGK V  E K L VYIPRGSR
Sbjct: 182 ERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGSR 241

Query: 229 HNDRIVLEGEADEEPGKLTGDLVFDISED-STTSNLERRGSDLHTKIIISLSDALTGFEK 287
           + D + LEGEAD+EP K+TGDL+F I E+  T++NLERRG DLHT++ ISLS+A+TGFEK
Sbjct: 242 NGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEK 301

Query: 288 EVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWY 347
            V TTLD R L+LKIP G+VIRPGNYI L+NEGWPLDD G KFG+MYVQ++IEFPPD+W+
Sbjct: 302 VVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPDNWF 361

Query: 348 SERGEIEALRNIIPQXXXXXXXXXXXXXEPDPVNTE-MPTFDILKSAEELPNYLP----- 401
           SE+ ++E LR ++P+               D  NTE +  + ++KSA+ELP+YL      
Sbjct: 362 SEKSDVEVLRTLLPEVPNARVADTG-----DLNNTETVIDYSVVKSADELPDYLSYEKGE 416

Query: 402 ---DDAEQGG---PQCSQQ 414
               + E G    PQC+QQ
Sbjct: 417 YQGQEQEYGAFEEPQCAQQ 435

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 432

 Score =  379 bits (972), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 206/444 (46%), Positives = 277/444 (62%), Gaps = 42/444 (9%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNE 60
           M  YDTLGV+ DATQ EIKKAYR+LALQHHPDKV+D+S+REESE++FKE+ AAYE+LS+E
Sbjct: 1   MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDE 60

Query: 61  EKRRNYDTYGDTNGYSDSYGGFQDGDFASFFGNFAS--GRYEDEEDFRAHARP---RTDD 115
           EKR  YDTYGDT    D    F+D  F +FF  F S  G           A+P   R+DD
Sbjct: 61  EKRSKYDTYGDTADGPD----FEDESFMNFFTQFNSGFGFNGGGGGGFPGAQPGDDRSDD 116

Query: 116 AHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARH---ASACTHCEGHGVKQR 172
             V L+++M D YNGK  +FQS R +VC +CEG+G R+R+      + C  C+G G K++
Sbjct: 117 VQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEGSGWRRRSGGPPPQTNCKSCQGRGYKEQ 176

Query: 173 LRRLGPGFVTRETVQCTKCRGLGKNLRS----EDLCKKCHGKRVTPETKNLNVYIPRGSR 228
           LRR+ PG V ++TV C  C G GK +      ++ CKKC G+ +  E K L V IPRGSR
Sbjct: 177 LRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSR 236

Query: 229 HNDRIVLEGEADEEPGKL-TGDLVFDISEDSTTSN---LERRGSDLHTKIIISLSDALTG 284
           H DRIV EGEAD+E GK  TGDL+F + E +       LERRG DL T I ISL++A+TG
Sbjct: 237 HGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITG 296

Query: 285 FEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPD 344
            ++ +  TLDGR L+L  P G+VI PG  I ++ EGWPL+    KFG++YV ++I FP D
Sbjct: 297 LDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRD 356

Query: 345 HWYSERGEIEALRNIIPQXXXXXXXXXXXXXEPDPVNTEMPTFDILKSAEELPNYLPDDA 404
           +W++E+ ++  +RNI+P              + DP NTE      +K  ++LP+Y+  + 
Sbjct: 357 NWFAEKSDLLKIRNILP------SEAANNDVKADPGNTEQ--VSDMKLVDQLPDYMGSNG 408

Query: 405 EQ--------------GGPQCSQQ 414
           +Q              G PQC+QQ
Sbjct: 409 DQYAHEGHASGAFPDDGTPQCAQQ 432

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
           similar to Ashbya gossypii AGR084C
          Length = 434

 Score =  375 bits (962), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 194/421 (46%), Positives = 275/421 (65%), Gaps = 16/421 (3%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y  LG+  +AT+ E+K+AYR LAL +HPDK+SDES R ESE KFKE++AAY++LS+E+
Sbjct: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63

Query: 62  KRRNYDTYGDTNGYSDSYGGFQDG------DFASFFGNFASGRYEDEEDFRAHARPRTDD 115
           KR  YD YG  +  S  +G F D       DF +FF  + +GRY   ED       +T D
Sbjct: 64  KRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFF-RYGAGRYGQYEDAEQKTSQKTKD 122

Query: 116 AHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHA--SACTHCEGHGVKQRL 173
             V L+L+ + LY GKT +F+  RNV+C++CEG G+RKRA H     C  C+G G K+R+
Sbjct: 123 FVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERV 182

Query: 174 RRLGPGFVTRETVQCTKCRGLGKNLRSE--DLCKKCHGKRVTPETKNLNVYIPRGSRHND 231
            R+ PGF++RE V C +C G G  +  +  D CKKCHGK V  E   L +Y+PRG RH D
Sbjct: 183 SRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHAD 242

Query: 232 RIVLEGEADEEPGKLTGDLVFDISEDST-TSNLERRGSDLHTKIIISLSDALTGFEKEVC 290
            I ++G+AD E GK TGDLVF+I E +   + LER+G+DLH  I ISL++ALTGF + V 
Sbjct: 243 TIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVA 302

Query: 291 TTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSER 350
            T D R LR+ IP+G+V+RPGNY+   NEGWP+++ G +FG++YV++NIEFP D+W +E+
Sbjct: 303 RTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINN-GSRFGDLYVKVNIEFPKDNWLNEK 361

Query: 351 GEIEALRNIIPQXXXXXXXXXXXXXEPDPVNTE-MPTFDILKSAEELPNYLPDDAEQGGP 409
            E+EA+++I+P                DP NTE + ++ +++ +  LP+YL  + +Q   
Sbjct: 362 SELEAIKHILPGLKNSSNSHQGDGD--DPANTEDINSYYVIQDSSRLPDYLAQEGQQRSN 419

Query: 410 Q 410
           Q
Sbjct: 420 Q 420

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR090W
           (XDJ1)
          Length = 427

 Score =  373 bits (957), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 200/433 (46%), Positives = 281/433 (64%), Gaps = 29/433 (6%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y+ LG+A  A++ E+K+AYR+LAL++HPDK+SDES RE SE KFKE++AAY +LS+E+
Sbjct: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQ 63

Query: 62  KRRNYDTYGDTN-GYSDSYGGFQDGDFASFFGNFASGRY---EDEEDFRAHARPRTDDAH 117
           KR  YD +G  + GY     G  D DF +FF  + +GR+    +E+DF      RT D+ 
Sbjct: 64  KRAEYDQFGTVDGGYGHDEFGHGDDDFMNFF-RYGAGRHGYQHEEDDFEEVG--RTADST 120

Query: 118 VSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKR--ARHASACTHCEGHGVKQRLRR 175
           V L+LT + LY GKT +F++ R V+C RC G+G+RKR  AR    C  CEG G K+R+ R
Sbjct: 121 VPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISR 180

Query: 176 LGPGFVTRETVQCTKCRGLGKNL--RSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRI 233
           +GPG ++RE V C  C G GK +   + D CKKC GK V  E   ++VY+PRGS+H DR+
Sbjct: 181 IGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRL 240

Query: 234 VLEGEADEEPGKLTGDLVFDISEDS-TTSNLERRGSDLHTKIIISLSDALTGFEKEVCTT 292
              G++D EPGK TGDLVF I E +  +S+LER+G+DL+  + ISL++ALTGF + V  T
Sbjct: 241 RYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRT 300

Query: 293 LDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGE 352
            D R LR+ IP G+V+RPGNY+   NEGWP++D G +FG+MYVQ+ IEFP D+W++E+ E
Sbjct: 301 FDERVLRINIPRGKVLRPGNYLKFTNEGWPIED-GARFGDMYVQVLIEFPKDNWFNEKAE 359

Query: 353 IEALRNIIPQXXXXXXXXXXXXXEPDPVNT-EMPTFDILKSAEELPNYL----------P 401
           ++A+RNI+P                DP NT E+  + I+ +   LP+YL           
Sbjct: 360 LDAIRNILPGLADAPSTKTE-----DPSNTEEVRAYSIIANHTGLPDYLDRENQGYSRQQ 414

Query: 402 DDAEQGGPQCSQQ 414
            ++  G P+C  Q
Sbjct: 415 HESTAGTPECPMQ 427

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.264
           YLR090W
          Length = 429

 Score =  369 bits (946), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 199/411 (48%), Positives = 265/411 (64%), Gaps = 26/411 (6%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV  DATQ EIKKAYR+ ALQHHPDKV+DESLREESE++FKE+AAAYE+L +EEKR
Sbjct: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEKR 64

Query: 64  RNYDTYGDTNGYSDSYGG---FQDGDFASFFGNFASGRYEDEEDFRAHARPRTDDAHVSL 120
             YD YGD +G SD + G   F+D  F +FF +F S      + +      R+ D  V L
Sbjct: 65  ARYDKYGDADG-SDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRSADVQVPL 123

Query: 121 RLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASA-----CTHCEGHGVKQRLRR 175
            ++M D YNGK+ +FQS R +VC+RC G+G R+R  H        C  C G G KQR+RR
Sbjct: 124 NVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRIRR 183

Query: 176 LGPGFVTRETVQCTKCRGLGKNLRS----EDLCKKCHGKRVTPETKNLNVYIPRGSRHND 231
           L PGF T E + C  C G GK        ++ CKKC G  VT E+K+L V +PRGSR +D
Sbjct: 184 LAPGFATTENITCPTCDGKGKCASKPNNDKNKCKKCVGTGVTTESKSLTVSLPRGSRQDD 243

Query: 232 RIVLEGEADEEPGK-LTGDLVFDISEDSTTS---NLERRGSDLHTKIIISLSDALTGFEK 287
           +IVL+GEAD+E GK  TG+LVF I E +      +L+R G DL T + +SL++A+TGF K
Sbjct: 244 QIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGFSK 303

Query: 288 EVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWY 347
            +  TLDGR L+L+IP G+VIRPGN I + +EGWP+D      G++YV ++IEFPPD+W+
Sbjct: 304 TLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS--GDLYVVVHIEFPPDNWF 361

Query: 348 SERGEIEALRNIIPQXXXXXXXXXXXXXEPDPVNTEMPTFDILKSAEELPN 398
           SER ++  ++N++P              E DP NTE  T   +   EE+P+
Sbjct: 362 SERSDLTQVKNVLP-----GETNNNAAVEDDPGNTE--TVTNINIVEEIPD 405

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score =  365 bits (938), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 194/421 (46%), Positives = 261/421 (61%), Gaps = 26/421 (6%)

Query: 3   PYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEK 62
           PYD LGV  DAT+ EI+KAYR+LAL++HPDK+ DE+ RE SE  FKEV AAYE+LS+ E 
Sbjct: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPEL 132

Query: 63  RRNYDTYGDT------NGYSDSYGGFQDGDFASFFGNFA------SGRYEDEEDFRAHAR 110
           +  YD YGD+      NG+ +    F D  F +FF  +          Y +   +     
Sbjct: 133 KSRYDMYGDSAFGSGGNGFPEDDHEFDD--FMNFFQQYQRQQHGPHASYSNRHQYGEPES 190

Query: 111 PRTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKR--ARHASACTHCEGHG 168
            RT D+ +S ++T + LY GKTV FQ  R  +C  C G G+RK+   +   +CT C G G
Sbjct: 191 KRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQG 250

Query: 169 VKQRLRRLGPGFVTRETVQCTKCRGLGKNLR--SEDLCKKCHGKRVTPETKNLNVYIPRG 226
            K+R+ RL  G++ ++   C  C+G G+  +  + D CK C GK +  E K+  VYIPRG
Sbjct: 251 FKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRG 310

Query: 227 SRHNDRIVLEGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFE 286
           SRH D   L   AD E GK TGD++  I EDS+ S+LER+ +DLHT + ISL DALTGF 
Sbjct: 311 SRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFS 370

Query: 287 KEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHW 346
             VC T D R LR+ +P G+VIRPGNY   K EGWPL + G  FG+MYVQINIEFP D+W
Sbjct: 371 TIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSN-GDSFGDMYVQINIEFPKDNW 429

Query: 347 YSERGEIEALRNIIPQXXXXXXXXXXXXXEPDPVNTE-MPTFDILKSAEELPNYLPDDAE 405
           ++E+ EI ALRNI+P              +PDP+NTE + ++ +L S +ELP+YL ++ E
Sbjct: 430 FNEKSEITALRNILP------GLKSKDTKDPDPLNTEDVLSYSVLHSHDELPDYLAEEKE 483

Query: 406 Q 406
           +
Sbjct: 484 K 484

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  350 bits (897), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 200/447 (44%), Positives = 273/447 (61%), Gaps = 50/447 (11%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y  LGV   AT  EIKKAYR+LALQ+HPDKV D + REE+EIKFKE+ +AYE+LS+EE
Sbjct: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62

Query: 62  KRRNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHA--RPRTDDAHVS 119
           KR +YD YGD N   + Y      DF +F          D+ D+ ++A    ++ D  + 
Sbjct: 63  KRAHYDLYGDAN--ENEYNNQNANDFFNF--------ETDQPDYDSYAFDNDKSKDVKIP 112

Query: 120 LRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRAR------HASACTHCEGHGVKQRL 173
           L+L++Q+LYNGKT +FQS RN++C +CEG G R+R        H   C  C G G K+R 
Sbjct: 113 LKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERT 172

Query: 174 RRLGPGFVTRETVQCTKCRGLG----KNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRH 229
           R L PGFVT + ++C  C G G    K    ++ CK CHGK +  E K L V +PRG ++
Sbjct: 173 RMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQN 232

Query: 230 NDRIVLEGEADEEPGKL-TGDLVFDISEDSTTSN---LERRGSDLHTKIIISLSDALTGF 285
            D I +E EAD+E GK  TGD++  I ED+T  +     R+G+D    + +SL++ALTGF
Sbjct: 233 KDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGF 292

Query: 286 -EKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPD 344
            +K +  +LDGR L L +P+G+VIRPGN I +K EGWP++ +  KFG++YV I IEFPPD
Sbjct: 293 KDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPD 352

Query: 345 HWYSERGEIEALRNIIPQXXXXXXXXXXXXXEPDPVNTE-MPTFDILKSAEELPNYLPD- 402
           +W+SE+ +I+ LRN++P                DP+NTE + TFDIL   EELP+ L + 
Sbjct: 353 NWFSEKSDIQLLRNVLPSGINGMMNSWKID---DPLNTETVTTFDIL---EELPDTLNES 406

Query: 403 ------------DAE---QGGPQCSQQ 414
                       DA    +G PQCSQQ
Sbjct: 407 NNRSAYDTGDQSDANYDREGPPQCSQQ 433

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  347 bits (890), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 199/446 (44%), Positives = 272/446 (60%), Gaps = 48/446 (10%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKV--SDESLREESEIKFKEVAAAYELLSN 59
           D Y  LGVA +AT  +IKKAYR+LALQHHPDKV  S+   RE SEIKFKE++AAYE+LS+
Sbjct: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62

Query: 60  EEKRRNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARP-RTDDAHV 118
           E+KR +YD YG           +    F SFF NF     +DEE  R +  P R+ D  +
Sbjct: 63  EDKRAHYDLYGSEEEQQRQQRQYDP--FESFF-NFE----QDEEPSRHYEDPKRSPDVKI 115

Query: 119 SLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASA------CTHCEGHGVKQR 172
            L++T+Q+LYNGKT +F+  RNV+C+ CEG G R+R            C  C+G G  ++
Sbjct: 116 PLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEK 175

Query: 173 LRRLGPGFVTRETVQCTKCRGLGKNL----RSEDLCKKCHGKRVTPETKNLNVYIPRGSR 228
           +R L PGF TRE  +C +C G GK+       ++ CKKCHG+ +  E+K L V +PRG R
Sbjct: 176 VRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLR 235

Query: 229 HNDRIVLEGEADEEPGK-LTGDLVFDISEDSTTS---NLERRGSDLHTKIIISLSDALTG 284
             D I +  EAD+E GK  TGDL+F I ED        LER+GS+  T++ ISL++ALTG
Sbjct: 236 DGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTG 295

Query: 285 F-EKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPP 343
           F +K V  T DGR L L IP G+VIRPGN I ++ EGWPL+ E  KFG++Y+ +NIEFPP
Sbjct: 296 FKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPP 355

Query: 344 DHWYSERGEIEALRNIIPQXXXXXXXXXXXXXEPDPVNTE-MPTFDILKSAEELPNYLPD 402
           D+W++E+ ++  ++NI+P+               DP+NTE +  F++L   E LP+ L +
Sbjct: 356 DNWFTEKSDLTQIKNILPRSTSDKTKLSD-----DPLNTELLLKFEVL---ETLPDTLKE 407

Query: 403 DAEQ--------------GGPQCSQQ 414
             +Q              G PQC+QQ
Sbjct: 408 GQDQGENNAESHGEYRGEGSPQCAQQ 433

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score =  305 bits (780), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/405 (42%), Positives = 236/405 (58%), Gaps = 37/405 (9%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y+ LGVA DAT +EIKK YR+LALQ+HPDK  DE  +  +EIKFK++ AAY+ LS+E+
Sbjct: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDED 71

Query: 62  KRRNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRTDDAHVSLR 121
           KR  YD   +   Y           F S F N   G Y       +  R R+ D  V L 
Sbjct: 72  KRNEYDNKKNFEPY-----------FESDFANNHDGNY------NSRYRSRSKDIKVELS 114

Query: 122 LTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHAS------ACTHCEGHGVKQRLRR 175
           L   +LYNGKT++F ++RN +C  C G G R +            C  C G G K    +
Sbjct: 115 LKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQ 174

Query: 176 LGPGFVTRETVQCTKCRGLGKNLRS----EDLCKKCHGKRVTPETKNLNVYIPRGSRHND 231
           L PGF T + V C+ C+G GK  +     ++ CK C+GK +      + V IPRGS + D
Sbjct: 175 LAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGD 234

Query: 232 RIVLEGEADEEPGKL-TGDLVFDISEDSTTSN-LERRGSDLHTKIIISLSDALTGFE-KE 288
            I+L+GEADEE GK   GDL+F+I+E   ++N LER G+ L     ISL++A+TGFE K 
Sbjct: 235 NIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENKF 294

Query: 289 VCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYS 348
           +  T D RDL L  P G+VIRPG+ + +KNEGWP+D  G  FGN+YV + IEFPPD+W +
Sbjct: 295 IVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWIN 354

Query: 349 ERGEIEALRNIIPQXXXXXXXXXXXXXEPDPVNTE-MPTFDILKS 392
           E+ +I  +RNI+P                DP+N+E + TF+I+KS
Sbjct: 355 EKNDIIKIRNILPNEKTKRNNIV------DPINSEYISTFEIVKS 393

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {ON}
           Anc_8.264 YLR090W
          Length = 439

 Score =  284 bits (727), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 172/451 (38%), Positives = 252/451 (55%), Gaps = 60/451 (13%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVS-----DESLREESEIKFKEVAAAYEL 56
           D Y  L V    TQDE+KK YR+LAL++HPDKV      ++ ++ E E+KFKE+ +AYE+
Sbjct: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70

Query: 57  LSNEEKRRNYD---TYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRT 113
           LS+EEKR+ YD    + D N  SD YG   DG   + FGN  S                 
Sbjct: 71  LSDEEKRKQYDLQKNFRDANQGSD-YG---DG-INTAFGNQTSK---------------- 109

Query: 114 DDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHA------SACTHCEGH 167
            D  + L++T++DLYNGK +R+   RNV+C +C G G R R          + C  C+G 
Sbjct: 110 -DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGA 168

Query: 168 GVKQRLRRLGPGFVTRETVQCTKCRGLGKNLR----SEDLCKKCHGKRVTPETKNLNVYI 223
           G KQ  +++ PGF T++ + C  C G G+  +    S++ C KC+GK +   ++++ V I
Sbjct: 169 GYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNI 228

Query: 224 PRGSRHNDRIVLEGEADEEPGKL-TGDLVFDISE-DSTTSNLERRG-SDLHTKIIISLSD 280
           PRGS   D I+++ +AD+E GK  TGDL+F + E D   + L+R G  DL T++ ISL+D
Sbjct: 229 PRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLAD 288

Query: 281 ALTGF-EKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINI 339
           A+TGF EK +  TLDGR LRL IP G+VIR G+ + ++ EGWPL+    + G++Y++ NI
Sbjct: 289 AITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNI 348

Query: 340 EFPPDHWYSERGEIEALRNIIPQXXXXXXXXXXXXXEPDPVNTEMPTFDI--LKSAEELP 397
           EFP D+W SE  +I  +RN++P              + D  N  M + DI      ++LP
Sbjct: 349 EFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVKDLP 408

Query: 398 NYLPDDAEQGG--------------PQCSQQ 414
           + +      G               P+CSQQ
Sbjct: 409 DIIDTSHNNGAEYGHNGDSANFTEMPECSQQ 439

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putative
           chaperone, homolog of E. coli DnaJ, closely related to
           Ydj1p; the authentic, non-tagged protein is detected in
           highly purified mitochondria in high-throughput studies
          Length = 459

 Score =  283 bits (724), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 163/392 (41%), Positives = 230/392 (58%), Gaps = 38/392 (9%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV  DAT  EIK AYR+LAL+HHPDK  D+  +E +EIKFKE+ AAYE+LS+ EK+
Sbjct: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKK 70

Query: 64  RNYDTYGDTNGYSDSYG--GFQDGD----------FASFFGNFASGRYEDEEDFRAHARP 111
            +YD YGD NG + S G  GF D D            S  GN   G Y+  E+  + +  
Sbjct: 71  SHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYDAYEEGNSTS-- 128

Query: 112 RTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRAR----HASACTHCEGH 167
            + D  + + LT++DLY GK ++F   R V+C +C G+G + + +    H   C  C G 
Sbjct: 129 -SKDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGK 187

Query: 168 GVKQRLRRLGPGFVTRETVQCTKCRGLGKNLR----SEDLCKKCHGKRVTPETKNLNVYI 223
           G K+RL+R GPG V  + V C KC G GK  +     ++ C  C G  +  + + + V +
Sbjct: 188 GSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNV 247

Query: 224 PRGSRHNDRIVLEGEADEEPGKLT-GDLVFDISEDSTTSNLERR-----------GSDLH 271
             G   ND I ++G ADEE  K T GDL F ++E     NLE++           G DL+
Sbjct: 248 APGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQ--ENLEQKQIFLKNFDDGAGEDLY 305

Query: 272 TKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWP-LDDEGKKF 330
           T I ISLS+ALTGFEK +  T D R L L +  G+V+RPG+ I + NEGWP LD+   + 
Sbjct: 306 TSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRC 365

Query: 331 GNMYVQINIEFPPDHWYSERGEIEALRNIIPQ 362
           G++YV ++IEFPPD+W++E+ E+ A++  +P 
Sbjct: 366 GDLYVFVHIEFPPDNWFNEKSELLAIKTNLPS 397

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
           (REAL)
          Length = 460

 Score =  277 bits (708), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 168/430 (39%), Positives = 238/430 (55%), Gaps = 42/430 (9%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV  DA+  EIK AYR+LAL+HHPDK  D++ +E +EIKFKE+ AAYE+LS+ EK+
Sbjct: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70

Query: 64  RNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPR----------- 112
            +YD YGD  G + S G   DG F           + +  D   +  PR           
Sbjct: 71  SHYDLYGDDYGTAGSTGA--DG-FGDDDFMNFFNNFFNSGDHEGNDFPREYDTYEEDKCK 127

Query: 113 -TDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRAR----HASACTHCEGH 167
            + D  + + LT++DLY GK ++F+  R +VC  C G+G + + +    H   C  C G 
Sbjct: 128 SSKDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGK 187

Query: 168 GVKQRLRRLGPGFVTRETVQCTKCRGLGKNLR----SEDLCKKCHGKRVTPETKNLNVYI 223
           G K+RL+R GPG V  + V C KC G GK ++     ++ C  C G  +  + + + V +
Sbjct: 188 GSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNV 247

Query: 224 PRGSRHNDRIVLEGEADEEPGK-LTGDLVFDISEDSTTSNLERR-----------GSDLH 271
             G   ND I ++G ADEE  K   GDL F + E     NLE++             DL+
Sbjct: 248 APGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQ--ENLEQKQIFLKNFDEGSAEDLY 305

Query: 272 TKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWP-LDDEGKKF 330
           T   ISLS+ALTGFEK +  T D R L L I  G+VIRPG+ I + NEGWP +DD   + 
Sbjct: 306 TSATISLSEALTGFEKFLTRTFDDRLLTLSIKPGRVIRPGDVIKITNEGWPIMDDPRGQR 365

Query: 331 GNMYVQINIEFPPDHWYSERGEIEALRNIIPQXXXXXXXXXXXXXEPD--PVNTE-MPTF 387
           G++YV I+IEFPPD+W++E+ E+ A++ ++P              E D  P+N E +  F
Sbjct: 366 GDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNETISNF 425

Query: 388 DILKSAEELP 397
            I+ + EELP
Sbjct: 426 QII-NMEELP 434

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
           (REAL)
          Length = 455

 Score =  271 bits (694), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 161/391 (41%), Positives = 222/391 (56%), Gaps = 38/391 (9%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           Y  LGV  DA   EIK AYR+LAL+HHPDK  D+  ++ +EIKFKE+ AAYE+LS+ EK+
Sbjct: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70

Query: 64  RNYDTYGDTNGYSDSYGGFQDG--------------DFASFFGNFASGRYEDEEDFRAHA 109
            +YD YGD NG ++  GG  DG              +     GN  S  Y+  ED   + 
Sbjct: 71  SHYDLYGDDNGTAN--GGGTDGFGNDDFMNFFNNFFNDGGHEGNGFSNEYKMYED---ND 125

Query: 110 RPRTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRAR----HASACTHCE 165
              + D  + + LTM+DLY GK +RF   R VVC +C G+G + + R    H   C  C 
Sbjct: 126 SASSKDIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCG 185

Query: 166 GHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRS----EDLCKKCHGKRVTPETKNLNV 221
           G G K+RL+R GPG V  + V C KC G GK  +S    ++ C  C G  +  + + + V
Sbjct: 186 GKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITV 245

Query: 222 YIPRGSRHNDRIVLEGEADEEPGKLT-GDLVFDISED-----STTSNLERRG----SDLH 271
            +  G   ND I +EG ADEE GK   GDL F ++E      +    L+  G     D +
Sbjct: 246 IVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSY 305

Query: 272 TKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWP-LDDEGKKF 330
             + ISLS+ALTGFEK +  T D R L L I  G+VIRPG+ + + NEGWP LDD   + 
Sbjct: 306 VSVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRC 365

Query: 331 GNMYVQINIEFPPDHWYSERGEIEALRNIIP 361
           G++YV I+IEFPPD+W++E+ E+  ++  +P
Sbjct: 366 GDLYVFIHIEFPPDNWFNEKSELLGIKTNLP 396

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
           (REAL)
          Length = 456

 Score =  259 bits (662), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 156/421 (37%), Positives = 236/421 (56%), Gaps = 28/421 (6%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV  +A+  EIK AYR+LAL+HHPDK  D+  +E +E KFKE+ AAYE+LS+ EK+
Sbjct: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70

Query: 64  RNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRYE------DEEDFRAHARPRTDDAH 117
            +YD YGD NG         D     F   F +G +E      + E +  +    + D  
Sbjct: 71  SHYDLYGDDNGTGGGDEFGDDDFMNFFNNFFNNGAHEANDFPNEHEMYEGNETTSSKDID 130

Query: 118 VSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRAR----HASACTHCEGHGVKQRL 173
           + L  TM+DLY GK ++F+  R ++C +C+G+G + + +    H   C  C G G K+RL
Sbjct: 131 IDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKERL 190

Query: 174 RRLGPGFVTRETVQCTKCRGLGKNLR----SEDLCKKCHGKRVTPETKNLNVYIPRGSRH 229
           +R GPG V  + V C KC G GK  +     ++ C  C    +  + + + V +P G   
Sbjct: 191 KRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGHHF 250

Query: 230 NDRIVLEGEADEEPGK-LTGDLVFDISE-----DSTTSNLERRG----SDLHTKIIISLS 279
           ND + ++G ADEE  K + GDL+F + E           +++ G     DL+  I +SLS
Sbjct: 251 NDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVSLS 310

Query: 280 DALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGK-KFGNMYVQIN 338
           +ALTGFEK +  T D R L L I  G+VIRPG+ I + NEGWP+ D  + + G++YV ++
Sbjct: 311 EALTGFEKFLTRTFDDRLLTLSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYVFVD 370

Query: 339 IEFPPDHWYSERGEIEALRNIIPQXXXX-XXXXXXXXXEPDPVNTE-MPTFDILKSAEEL 396
           IEFPPD+W++E+ E+ A++  +P               +  P+N+E +  F I+ S ++L
Sbjct: 371 IEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNFQIIHS-DDL 429

Query: 397 P 397
           P
Sbjct: 430 P 430

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.264
           YLR090W
          Length = 432

 Score =  256 bits (655), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 146/383 (38%), Positives = 216/383 (56%), Gaps = 31/383 (8%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNE 60
           ++PYD LGV  D+T DEI+KAYR+LAL+ HPDKV D   +  +E+KFKE+  AYE+LSN 
Sbjct: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNG 63

Query: 61  EKRRNYDTYGDTNGYSDSYGGFQDGDFASFFGN----FASGRYEDEEDFRAHARPRTDDA 116
           E     +   +  GY  ++G     DF +FF         G +   ED         +  
Sbjct: 64  EYVEEMEEEYEGQGYGFNFGD----DFMNFFNEGRNAHPMGGHPQRED-----ESTNEAT 114

Query: 117 HVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARH------ASACTHCEGHGVK 170
            + + +T++DLYNGK V+FQ TRNV+C  C+G   R+R           +CT C+G G  
Sbjct: 115 QIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYV 174

Query: 171 QRLRRLGPGFVTRETVQCTKCRGLG----KNLRSEDLCKKCHGKRVTPETKNLNVYIPRG 226
           +RL    P F   + + C KC G G    K    ++ CK CHG+ +  E + L V IPRG
Sbjct: 175 ERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRG 234

Query: 227 SRHNDRIVLEGEADEEP-GKLTGDLVFDISEDSTTSN------LERRGSDLHTKIIISLS 279
           S +++ I+ + + DE+   +  GD+VF +      +       + + G+DLH  I I L 
Sbjct: 235 SENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLI 294

Query: 280 DALTGFEKEVCT-TLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQIN 338
           +A++G +    T T D R L+L +P G+V+RPG+ I +K EGWP    G +FG+M+V +N
Sbjct: 295 EAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVN 354

Query: 339 IEFPPDHWYSERGEIEALRNIIP 361
           +EFPPD+W SER +I  L N++P
Sbjct: 355 VEFPPDNWISERNDITTLTNVLP 377

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
           similar to uniprot|Q12014 Saccharomyces cerevisiae
           YLR090w
          Length = 452

 Score =  243 bits (621), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 169/461 (36%), Positives = 232/461 (50%), Gaps = 56/461 (12%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREES-----EIKFKEVAAAYE 55
           MD Y  LGV  DA+QDEIK+AYR+LAL+HHPDK       E+S     ++ FKEV AAY+
Sbjct: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60

Query: 56  LLSNEEKRRNYDT--------YGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRA 107
           +LS+   R  YD         YGD + + + + GF  G        F SG        R 
Sbjct: 61  VLSDASLRAEYDQKLAFEAQPYGDDD-FMNFFSGFNGGSHPGHRSGFDSG--------RG 111

Query: 108 HARPRTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRAR---------HA 158
             R ++DD  + L++   +LY GK V F   R   C RC+G G +  A            
Sbjct: 112 ARRYKSDDIEIDLKVKTSELYRGKKVNFNLKRKKKCQRCDGTGWKSHASIVKKKTAKFFW 171

Query: 159 SACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGK--NL-RSE-DLCKKCHGK---R 211
           + C  CEG GV+QRLR+L PGFVT E ++C +C G GK  NL +SE + C  C       
Sbjct: 172 NVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVG 231

Query: 212 VTPETKNLNVYIPRGSRHNDRIVLEGEADEE-PGKLTGDLVFDISE-DSTTSNLERRGSD 269
           +  E K + + I +G+   D+IVL+GEADE+      GDLV  I E      ++ R G D
Sbjct: 232 MVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYD 291

Query: 270 LHTKIIISLSDALTGF-EKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGK 328
           L  K  I L+DA+ GF EK +  T DGR L+     G+VIRP + + ++NEGWP  ++  
Sbjct: 292 LIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDAN 351

Query: 329 ------KFGNMYVQINIEFPPDHWYSERGEIEALRNIIPQXXXXXXXXXXXXXEPDPVNT 382
                 K G++YV ++I FPPD+W  E  +  A+RNIIP                +  N 
Sbjct: 352 DNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVENI 411

Query: 383 -------EMPTFDILKSAEELPNYLPDDAEQ--GGPQCSQQ 414
                  E+P  D L   ++  +   D  E     P CSQQ
Sbjct: 412 NVSEIVKEIPNCDELPKFQDTYDNTNDKGESPFWTPNCSQQ 452

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064c YDJ1
          Length = 407

 Score =  208 bits (529), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 134/365 (36%), Positives = 202/365 (55%), Gaps = 27/365 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YDTLGV+P A+  EIKKAYR+ AL++HPDK    +  EE+  KFKEV++AYE+LS+ +KR
Sbjct: 8   YDTLGVSPGASDAEIKKAYRKSALKYHPDK----NPSEEAAEKFKEVSSAYEILSDSQKR 63

Query: 64  RNYDTYGDTNGYSDSYGGFQDGD-------FASFFGNFASGRYEDEEDFRAHARPRTDDA 116
             YD +G+  G S + G    G        F+ FFG    GR       R   R R  D 
Sbjct: 64  EVYDQFGE-EGLSGNGGAGFPGGFGFGEDIFSQFFGGATGGRP------RGPQRGR--DI 114

Query: 117 HVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRL 176
              +  ++++LY G+T +    + ++C  CEG G ++ A     C+ C G G+K   R++
Sbjct: 115 KHEMAASLEELYKGRTAKLALNKQILCKSCEGRGGKEGA--VKKCSSCNGQGIKFVTRQM 172

Query: 177 GPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLE 236
           GP  + R   +C  C G G  + ++D CK C+GK+V  E K L V I  G +   +IV +
Sbjct: 173 GP-MIQRFQTECDVCHGTGDIIDAKDRCKSCNGKKVDNERKILEVRIEPGMKDGQKIVFK 231

Query: 237 GEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGR 296
           GEAD+ P  + GD+VF ISE     + +R G DL  +  I L  AL G +  +   + G 
Sbjct: 232 GEADQAPDVIPGDVVFVISE-KPHKHFQRAGDDLIYEAEIDLLTALAGGQFAL-EHVSGD 289

Query: 297 DLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEAL 356
            L++ I  G+VI PG    ++ +G P+   G  +GN+ ++ NI+FP +H+ SE   ++ L
Sbjct: 290 WLKVDIVPGEVIAPGARKIVEGKGMPIQKYG-GYGNLLIKFNIKFPENHFTSEE-NLKKL 347

Query: 357 RNIIP 361
             I+P
Sbjct: 348 EEILP 352

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
           YDJ1Type I HSP40 co-chaperone involved in regulation of
           the HSP90 and HSP70 functions; involved in protein
           translocation across membranes; member of the DnaJ
           family
          Length = 409

 Score =  207 bits (527), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 145/422 (34%), Positives = 217/422 (51%), Gaps = 31/422 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV   AT  EIKKAYR+ AL++HPDK    +  EE+  KFKE +AAYE+LS+ EKR
Sbjct: 8   YDILGVPVTATDVEIKKAYRKCALKYHPDK----NPSEEAAEKFKEASAAYEILSDPEKR 63

Query: 64  RNYDTYGDTNGYSDSYGGFQ---------DGDFASFFGNFASGRYEDEEDFRAHARPRTD 114
             YD +G+ +G S + G            D  F+ FFG  A G        R     R  
Sbjct: 64  DIYDQFGE-DGLSGAGGAGGFPGGGFGFGDDIFSQFFG--AGGAQ------RPRGPQRGK 114

Query: 115 DAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLR 174
           D    +  ++++LY G+T +    + ++C  CEG G +K A     CT C G G+K   R
Sbjct: 115 DIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGA--VKKCTSCNGQGIKFVTR 172

Query: 175 RLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIV 234
           ++GP  + R   +C  C G G  +  +D CK C+GK+V  E K L V++  G +   RIV
Sbjct: 173 QMGP-MIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIV 231

Query: 235 LEGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLD 294
            +GEAD+ P  + GD+VF +SE    S  +R G DL  +  I L  A+ G E  +   + 
Sbjct: 232 FKGEADQAPDVIPGDVVFIVSERPHKS-FKRDGDDLVYEAEIDLLTAIAGGEFAL-EHVS 289

Query: 295 GRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIE 354
           G  L++ I  G+VI PG    ++ +G P+   G  +GN+ ++  I+FP +H+ SE   ++
Sbjct: 290 GDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYG-GYGNLIIKFTIKFPENHFTSEE-NLK 347

Query: 355 ALRNIIPQXXXXXXXXXXXXXEPDPVNTEMPTFDILKSAEELPNYLPDDAEQGGP--QCS 412
            L  I+P              E    + +   ++  +++    NY  D+ EQGG   QC+
Sbjct: 348 KLEEILPPRIVPAIPKKATVDECVLADFDPAKYNRTRASRGGANYDSDEEEQGGEGVQCA 407

Query: 413 QQ 414
            Q
Sbjct: 408 SQ 409

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  206 bits (524), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 142/422 (33%), Positives = 217/422 (51%), Gaps = 31/422 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+  AT  EIKKAYR+ AL++HPDK    +  EE+  KFKE ++AYE+LS+ EKR
Sbjct: 8   YDILGVSVTATDVEIKKAYRKCALKYHPDK----NPSEEAAEKFKEASSAYEILSDSEKR 63

Query: 64  RNYDTYGDTNGYSDSYGGFQ---------DGDFASFFGNFASGRYEDEEDFRAHARPRTD 114
             YD +G+  G S + G            D  F+ FFG  A G        R     R  
Sbjct: 64  EVYDQFGE-EGLSGAGGAGGFPGGGFGFGDDIFSQFFG--AGGAQ------RPRGPQRGK 114

Query: 115 DAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLR 174
           D    +  ++++LY G+T +    + ++C  CEG G +K A     C+ C G G+K   R
Sbjct: 115 DIKHEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGA--VKKCSSCNGQGIKFVTR 172

Query: 175 RLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIV 234
           ++GP  + R   +C  C G G  +  +D CK C+GK+V  E K L V++  G +   RIV
Sbjct: 173 QMGP-MIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIV 231

Query: 235 LEGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLD 294
            +GEAD+ P  + GD+VF +SE     N +R G DL  +  I L  A+ G E  +   + 
Sbjct: 232 FKGEADQAPDVIPGDVVFIVSE-RPHKNFKRDGDDLVYEAEIDLLTAIAGGEFAL-EHVS 289

Query: 295 GRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIE 354
           G  L++ I  G+VI PG    ++ +G P+   G  +GN+ ++  I+FP +H+ +E   ++
Sbjct: 290 GDWLKVGIVPGEVISPGMRKVIEGKGMPIPKYG-GYGNLVIKFTIKFPENHFTTEE-NLK 347

Query: 355 ALRNIIPQXXXXXXXXXXXXXEPDPVNTEMPTFDILKSAEELPNYLPDDAEQGGP--QCS 412
            L  I+P              E    + +   ++  +++    NY  D+ EQGG   QC+
Sbjct: 348 KLEEILPPRIVPAIPKKATVDECVLADFDPAKYNRTRASRGGANYDSDEEEQGGEGVQCA 407

Query: 413 QQ 414
            Q
Sbjct: 408 SQ 409

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 409

 Score =  206 bits (523), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 129/365 (35%), Positives = 195/365 (53%), Gaps = 28/365 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+P A  ++IKKAYR+ AL+ HPDK    +  EE+  KFKE+ +AYE+LS+ +KR
Sbjct: 8   YDLLGVSPGADDNQIKKAYRKSALKFHPDK----NPSEEAAEKFKEITSAYEILSDSQKR 63

Query: 64  RNYDTYGDTNGYSDSYGGFQDGD-------FASFFGNFASGRYEDEEDFRAHARPRTDDA 116
             YD +G   G S    G   G        F+ FFG  +S         R     +  D 
Sbjct: 64  EVYDQFG-LEGLSGQGAGGPGGFGGFGEDLFSQFFGGGSS---------RPRGPQKGRDI 113

Query: 117 HVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRL 176
              +  T++ L+ G+T +    + ++C  CEG G ++ +     CT C G G K   R++
Sbjct: 114 RHEIPATLEQLFKGRTAKLALNKQLICKSCEGRGGKEGS--VKKCTACSGQGFKFVTRQM 171

Query: 177 GPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLE 236
           GP  + R  V+C  C G G+ +  +  CK C GK+V  E K L V I  G +   RIV +
Sbjct: 172 GP-MIQRFQVECESCHGAGEIIDPKGRCKVCSGKKVVNERKVLEVNIEPGMKDGQRIVFQ 230

Query: 237 GEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGR 296
           GEAD+ PG + GD+VF +SE       +R G+DLH    I L  A+ G +  V   + G 
Sbjct: 231 GEADQSPGIIPGDVVFVVSEQPHPV-FKRDGNDLHYDAEIDLLSAIAGGQFAV-KHVSGE 288

Query: 297 DLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEAL 356
            L+++I  G+VI PG+   ++ +G P+   G  +GN+ ++ NI+FPP H+  +   ++ L
Sbjct: 289 YLKVEIVPGEVISPGSVKVIEGKGMPIPKYG-GYGNLLIKFNIKFPPAHFTDDE-TLKKL 346

Query: 357 RNIIP 361
             I+P
Sbjct: 347 EEILP 351

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {ON}
           YNL064C (REAL)
          Length = 410

 Score =  205 bits (521), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 139/422 (32%), Positives = 217/422 (51%), Gaps = 30/422 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+  AT  EIKKAYR+ AL++HPDK    +  EE+  KFKE ++AYE+LS+ EKR
Sbjct: 8   YDILGVSVTATDVEIKKAYRKCALKYHPDK----NPSEEAAEKFKEASSAYEILSDSEKR 63

Query: 64  RNYDTYGDTNGYSDSYGGFQ---------DGDFASFFGNFASGRYEDEEDFRAHARPRTD 114
             YD +G+ +G S + G            D  F+ FFG     +       R     R  
Sbjct: 64  DVYDQFGE-DGLSGAGGAGGFPGGGFGFGDDIFSQFFGGAGGAQ-------RPRGPQRGK 115

Query: 115 DAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLR 174
           D    +  ++++LY G+T +    + ++C  CEG G +K A     C+ C G G+K   R
Sbjct: 116 DIKHEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGA--VKKCSSCNGQGIKFVTR 173

Query: 175 RLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIV 234
           ++GP  + R   +C  C G G  +  +D CK C+GK+V  E K L V++  G +   RIV
Sbjct: 174 QMGP-MIQRFQTECDVCHGTGDIVDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIV 232

Query: 235 LEGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLD 294
            +GEAD+ P  + GD+VF +SE    S  +R G DL  +  I L  A+ G E  +   + 
Sbjct: 233 FKGEADQAPDVIPGDVVFLVSERPHKS-FKRDGDDLVYEAEIDLLTAIAGGEFAL-EHVS 290

Query: 295 GRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIE 354
           G  L++ I  G+VI PG    ++ +G P+   G  +GN+ ++  ++FP +H+ +E   ++
Sbjct: 291 GDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYG-GYGNLIIKFTVKFPENHFTAEE-NLK 348

Query: 355 ALRNIIPQXXXXXXXXXXXXXEPDPVNTEMPTFDILKSAEELPNYLPDDAEQGGP--QCS 412
            L  I+P              E    + +   ++  +++    NY  D+ EQGG   QC+
Sbjct: 349 KLEEILPPRTVPAIPKKATVDECVLADFDPAKYNRARASRGGANYDSDEEEQGGEGVQCA 408

Query: 413 QQ 414
            Q
Sbjct: 409 SQ 410

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {ON}
           Anc_2.243
          Length = 411

 Score =  204 bits (520), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 130/366 (35%), Positives = 195/366 (53%), Gaps = 25/366 (6%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+P A+  EIKKAYR+ AL++HPDK    +  EE+  KFKE +AAYE+LS++EKR
Sbjct: 8   YDILGVSPSASSSEIKKAYRKFALKYHPDK----NPSEEAAEKFKEASAAYEVLSDDEKR 63

Query: 64  RNYDTYGDTNGYSDSYGGFQ--------DGDFASFFGNFASGRYEDEEDFRAHARPRTDD 115
             YD +G         G           D  F+ FFG   +G        R        D
Sbjct: 64  EMYDQFGPEGMNGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGPQRGR------D 117

Query: 116 AHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRR 175
               L  T+++LY G+T +    + ++C  CEG G +K A     C+ C G GVK   R+
Sbjct: 118 IKHELSATLEELYKGRTAKLALNKQILCKTCEGRGGKKGA--VKKCSSCNGQGVKFVTRQ 175

Query: 176 LGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVL 235
           +GP  + R   +C  C G G  +  +D CK C+ K+VT E K L V+I  G +   ++V 
Sbjct: 176 MGP-MLQRFQAECEVCHGTGDIIDPKDRCKTCNAKKVTNERKILEVHIEPGMKDGQKVVF 234

Query: 236 EGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDG 295
           +GEAD+ P  + GD++F +S+     + +R G DL  +  I L  A+ G E  +   + G
Sbjct: 235 KGEADQAPDIIPGDVIFVVSQ-KPHEHFQRAGDDLVYEAEIDLLTAIAGGEFAI-KHVSG 292

Query: 296 RDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEA 355
             L++ I  G+VI PG    + ++G P+   G  +GN+ V+ NI+FPP+H+  E   ++ 
Sbjct: 293 EWLKVAIVPGEVISPGARKIISDKGMPIPKYG-GYGNLIVKFNIKFPPNHFTDEES-LKK 350

Query: 356 LRNIIP 361
           L  I+P
Sbjct: 351 LEEILP 356

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {ON}
           Anc_2.243 YNL064C
          Length = 410

 Score =  203 bits (516), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 128/367 (34%), Positives = 195/367 (53%), Gaps = 28/367 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+P A++ EIKK YR+ AL++HPDK    +   E+  KFKE +AAYE+LS+ EKR
Sbjct: 8   YDILGVSPTASESEIKKGYRKAALKYHPDK----NPTAEAAEKFKECSAAYEVLSDPEKR 63

Query: 64  RNYDTYGDTNGYSDSYGGFQ---------DGDFASFFGNFASGRYEDEEDFRAHARPRTD 114
             YD YG+    S   GG           D  F+ FFG  AS R    +  R        
Sbjct: 64  DVYDQYGEEGLSSGGPGGPGGFGGFGGFGDDIFSQFFGGGASQRPRGPQKGR-------- 115

Query: 115 DAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLR 174
           D    +  T+++LY G+T +    + ++C  CEG G   +A     C+ C G G+K   +
Sbjct: 116 DIKHEIAATLEELYKGRTAKLALNKQILCKSCEGRG--GKADAVKKCSSCGGQGIKFVTK 173

Query: 175 RLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIV 234
           ++GP  + R   +C  C G G  +  +  CK CHGK++  E K L V I  G +   RIV
Sbjct: 174 QMGP-MIQRFQTECDVCHGTGDIIDPKGRCKSCHGKKIANERKILEVKIEPGMKDGQRIV 232

Query: 235 LEGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLD 294
            +GE+D+ P  + GD+VF ++E     + +R G+DL     I L  A+ G E  +   + 
Sbjct: 233 FKGESDQAPDIIPGDVVFVVNE-KPHKHFQRSGNDLVYLAEIDLLTAIAGGEFAL-EHVS 290

Query: 295 GRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIE 354
           G  L++ I  G+VI PG    ++ +G P+   G  +GN+ +Q NI+FP +H +++   ++
Sbjct: 291 GEWLKIAIVAGEVIAPGAKKVIEGKGMPILKYG-GYGNLIIQFNIKFPENH-FTDESNLK 348

Query: 355 ALRNIIP 361
            L  I+P
Sbjct: 349 KLEEILP 355

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  202 bits (515), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 139/422 (32%), Positives = 218/422 (51%), Gaps = 31/422 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+  AT  EIKKAYR+ AL+ HPDK    +  EE+  KFKE ++AYE+LS+ EKR
Sbjct: 8   YDILGVSVTATDVEIKKAYRKCALKFHPDK----NPSEEAAEKFKEASSAYEVLSDSEKR 63

Query: 64  RNYDTYGDTNGYSDSYGGFQ---------DGDFASFFGNFASGRYEDEEDFRAHARPRTD 114
             YD +G+ +G S + G            D  F+ FFG   + R +  +        R  
Sbjct: 64  EVYDQFGE-DGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPKGPQ--------RGR 114

Query: 115 DAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLR 174
           D    +  ++++LY G+T +    + ++C  CEG G +K A     CT C G G+K   R
Sbjct: 115 DIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGA--VKKCTGCNGQGIKFVTR 172

Query: 175 RLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIV 234
           ++GP  + R   +C  C G G  +  +D CK C+GK++  E K L V++  G +   +IV
Sbjct: 173 QMGP-MIQRFQTECDACHGTGDIVDPKDRCKSCNGKKIENERKILEVHVEPGMKDGQKIV 231

Query: 235 LEGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLD 294
            +GEAD+ P  + GD+VF +SE     + +R G DL  +  I L  A+ G E  +   + 
Sbjct: 232 FKGEADQAPDVIPGDVVFLVSE-RPHKHFKRDGDDLVYEAEIDLLTAIAGGEFAL-EHVS 289

Query: 295 GRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIE 354
           G  L++ I  G+VI PG    ++ +G P+   G  +GN+ V+  I+FP +H+ +E   ++
Sbjct: 290 GDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYG-GYGNLIVKFTIKFPENHFTTEE-NLK 347

Query: 355 ALRNIIPQXXXXXXXXXXXXXEPDPVNTEMPTFDILKSAEELPNYLPDDAEQGGP--QCS 412
            L  I+P              E    + +   ++  +++    NY  D+ EQGG   QC+
Sbjct: 348 KLEEILPPRATPTIPKKATVDECVLADFDPAKYNRTRASRGGANYDSDEEEQGGEGVQCA 407

Query: 413 QQ 414
            Q
Sbjct: 408 SQ 409

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  201 bits (510), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 126/366 (34%), Positives = 200/366 (54%), Gaps = 28/366 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+P A+  EIKKAYR+ AL++HPDK    +  EE+  KFKE ++AYE+LS+ EKR
Sbjct: 8   YDILGVSPTASDSEIKKAYRKQALKYHPDK----NPSEEAAEKFKEASSAYEVLSDSEKR 63

Query: 64  RNYDTYGDTNGYSDSYGGFQDGD--------FASFFGNFASGRYEDEEDFRAHARPRTDD 115
             YD +G  +G S + G              F+ FFG   + R       R   R R  D
Sbjct: 64  DIYDQFG-QDGLSGNGGMPGGAGGFGFGEDLFSQFFGGAGASRP------RGPQRGR--D 114

Query: 116 AHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRR 175
               + +++++LY GKT +    + ++C  CEG G +K A     C+ C G G+K   R+
Sbjct: 115 IKHEISVSLEELYKGKTSKLALNKQILCKTCEGRGGKKGA--VKKCSSCNGQGIKFVTRQ 172

Query: 176 LGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVL 235
           +GP  + R   +C  C G G  + ++D CK CHGK++  E K L V +  G ++  ++V 
Sbjct: 173 MGP-MIQRFQTECDVCHGTGDIIDAKDRCKDCHGKKIANERKILQVNVDPGMKNGQKVVF 231

Query: 236 EGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDG 295
           +GEAD+ P  + GD++F ISE     + +R G DL  +  I L  A+ G E  +   + G
Sbjct: 232 KGEADQAPDIIPGDVIFVISE-KPHKHFQRVGDDLIYEAEIDLLTAVAGGEFAL-EHVSG 289

Query: 296 RDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEA 355
             L++ I  G+VI P     ++ +G P+   G  +GN+ ++ +I+FP +H +++   ++ 
Sbjct: 290 EWLKVSIVPGEVIAPNMRKVVEGKGMPIQKYG-GYGNLIIKFSIKFPENH-FADEDTLKK 347

Query: 356 LRNIIP 361
           L  I+P
Sbjct: 348 LEEILP 353

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL064C
           (YDJ1)
          Length = 410

 Score =  201 bits (510), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 125/367 (34%), Positives = 191/367 (52%), Gaps = 28/367 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+PDA   +IKKAYR+ AL++HPDK    +  EE+  KFK++  AYE+LS+ +KR
Sbjct: 8   YDLLGVSPDANDAQIKKAYRKSALKYHPDK----NPSEEAADKFKQITGAYEILSDSQKR 63

Query: 64  RNYDTYGDTNGYSDSYGGFQDGD---------FASFFGNFASGRYEDEEDFRAHARPRTD 114
             YD +G+        GG              F+ FFG   + R    +  R        
Sbjct: 64  EMYDQFGEEGLNGGGQGGPGGFGGFGGFGEDIFSQFFGGGGASRPRGPQKGR-------- 115

Query: 115 DAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLR 174
           D    +  T+++LY G+  +    + V+C RCEG G   +A     CT C G GVK   R
Sbjct: 116 DIRHDISCTLENLYKGRAAKLALNKTVLCKRCEGRG--GKAGSVKKCTSCNGQGVKFVTR 173

Query: 175 RLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIV 234
            +GP  + R    C  C G G  + + D CK C GK++  E K L V I  G +H  +IV
Sbjct: 174 HMGP-MIQRFQTTCEVCNGEGDVIPAADRCKDCDGKKIASERKILEVNIQPGMKHGQKIV 232

Query: 235 LEGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLD 294
            +GEAD++PG++ GD+VF ++E        R G +LH +  I L  A+ G +  +   + 
Sbjct: 233 FQGEADQQPGQIPGDVVFVVNEQE-HPRFVRNGDNLHYEAEIDLLTAIAGGQFAL-EHVS 290

Query: 295 GRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIE 354
           G  L++ I  G+VI PG    ++ +G P+   G  +G++ ++ N++FP  H+  E   ++
Sbjct: 291 GDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKYG-SYGDLLIKFNVKFPKSHFADEEA-LK 348

Query: 355 ALRNIIP 361
            L  I+P
Sbjct: 349 KLEAILP 355

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {ON}
           highly similar to gnl|GLV|CAGL0J09966g Candida glabrata
           CAGL0J09966g and similar to YNL064C uniprot|P25491
           Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
           (nuclear envelope protein) heat shock protein
          Length = 412

 Score =  199 bits (506), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 130/370 (35%), Positives = 194/370 (52%), Gaps = 33/370 (8%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+  A++ EIKKAYR+ AL++HPDK    +  EE+  KFKE ++AYE+L + EKR
Sbjct: 8   YDLLGVSATASETEIKKAYRKTALKYHPDK----NPSEEAAEKFKEASSAYEVLMDAEKR 63

Query: 64  RNYDTYGDTNGYSDSYGGFQ------------DGDFASFFGNFASGRYEDEEDFRAHARP 111
             YD +G+  G S +                 D  F+ FFG  AS         R     
Sbjct: 64  EAYDQFGE-EGLSGAGAAGGGFGGFGGFGGFGDDLFSQFFGGGAS---------RPRGPQ 113

Query: 112 RTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQ 171
           R  D    + +T+++LY G+T +    + ++C  CEG G ++ A     CT C G GVK 
Sbjct: 114 RGRDIKHEITVTLEELYKGRTSKLALNKQILCKTCEGRGGKEGA--VKKCTSCNGQGVKF 171

Query: 172 RLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHND 231
             R++GP  + R   +C  C G G  +  +D CK C GK+V  E K L V++  G +   
Sbjct: 172 ITRQMGP-MIQRFQTECDACDGTGDIINPKDRCKACSGKKVANERKILEVHVDPGMKDGQ 230

Query: 232 RIVLEGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCT 291
           +IV +GEAD+ P  + GD++F +SE     +  R   DL  +  I L  A+ G E  +  
Sbjct: 231 KIVFKGEADQAPDIIPGDVIFVVSE-RPHKHFRRDSDDLVYEADIDLLTAIAGGEFAI-E 288

Query: 292 TLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERG 351
            + G  L+++I  G+VI PG    ++ +G P+   G  FGN+ V+ NI FP DH+ S   
Sbjct: 289 HVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVLKYG-GFGNLLVKFNIVFPKDHFTSLE- 346

Query: 352 EIEALRNIIP 361
            ++ L  I+P
Sbjct: 347 NMKKLEEILP 356

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.243
           YNL064C
          Length = 409

 Score =  199 bits (505), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 125/367 (34%), Positives = 197/367 (53%), Gaps = 28/367 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+  AT  EIKKAYR++AL+ HPDK    +  EE+  KFKE ++AYE+LS+ +KR
Sbjct: 8   YDVLGVSVTATDVEIKKAYRKMALKFHPDK----NPSEEAAEKFKEASSAYEVLSDADKR 63

Query: 64  RNYDTYGDTNGYSDSYGGFQ--------DGDFASFFGNFASGRYEDEEDFRAHARPRTDD 115
             YD +G   G S + G           D  F+ FFG   + R    +        R  D
Sbjct: 64  DTYDQFG-LEGLSGAGGMGGAGGGFGFGDDIFSQFFGGAGAQRPRGPQ--------RGRD 114

Query: 116 AHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRR 175
               + +T+++LY GKT +    + ++C  CEG G +K A     C+ C G G+K   R+
Sbjct: 115 IKHEINVTLEELYRGKTSKLALNKQILCKTCEGRGGKKGA--VKKCSSCNGQGIKFVTRQ 172

Query: 176 LGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVL 235
           +GP  + R   +C  C G G  +  +D CK C+GK+V  E K L V++  G ++  ++V 
Sbjct: 173 MGP-MIQRFQTECDVCHGAGDIVDPKDRCKSCNGKKVASERKILEVHVDPGMKNGQKVVF 231

Query: 236 EGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDG 295
           +GEAD+ P  + GD+VF I+E     + +R G +L  +  + L  A+ G E  +   + G
Sbjct: 232 KGEADQAPDVIPGDVVFVINE-KPHKHFQRSGDNLVYEAEVDLLTAIAGGEFAI-EHVSG 289

Query: 296 RDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEA 355
             L++ I  G+VI PG    +  +G P+   G  +GN+ ++  ++FP  H+ +E   ++ 
Sbjct: 290 DWLKVAIVPGEVIAPGARKVIDGKGMPVAKYG-GYGNLIIKFTVKFPEPHFTTEE-NLKK 347

Query: 356 LRNIIPQ 362
           L  I+PQ
Sbjct: 348 LEEILPQ 354

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {ON}
           YNL064C (YDJ1) - yeast dnaJ homolog (nuclear envelope
           protein); heat shock protein [contig 5] FULL
          Length = 411

 Score =  197 bits (500), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 137/423 (32%), Positives = 206/423 (48%), Gaps = 31/423 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+PDA   +IKKAYR+ AL+ HPDK    +  EE+  KFKE+  AYE+LS+ +KR
Sbjct: 8   YDLLGVSPDANDAQIKKAYRKQALKFHPDK----NPSEEAADKFKELTVAYEILSDSQKR 63

Query: 64  RNYDTYGDTNGYSDSYGGFQDGD---------FASFFGNFASGRYEDEEDFRAHARPRTD 114
             YD  G+        GG              F+ FFG   S R    +  R        
Sbjct: 64  DIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGGSQRPRGPQKGR-------- 115

Query: 115 DAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLR 174
           D    +  ++++LY G+T +    + ++C  CEG G   +A     C+ C G G+K   R
Sbjct: 116 DIKHEMSASLEELYKGRTAKLALNKQILCKTCEGRG--GKAGAVKKCSSCNGQGIKFITR 173

Query: 175 RLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIV 234
           ++GP  + R   +C  C G G  +  +D CK C+GK++  E K L V+I  G +   +IV
Sbjct: 174 QMGP-MIQRFQAECDVCSGTGDIIDPKDRCKSCNGKKIDNERKILEVHIEPGMKDGQKIV 232

Query: 235 LEGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLD 294
            +GEAD+ PG + GD+VF IS+     + ER+G DL  +  + L  A+ G E  +   + 
Sbjct: 233 FQGEADQAPGIIPGDVVFVISQ-RPHKHFERKGDDLLYQAEVDLLSAIAGGEFAI-EHVS 290

Query: 295 GRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIE 354
           G  L++ I  G+VI PG    ++ +G P+   G  +GN+ V   I FP +H+  E   ++
Sbjct: 291 GEWLKVSIVPGEVISPGMTKVIEGKGMPIQKYG-GYGNLIVTFKINFPTNHFADEE-SLK 348

Query: 355 ALRNIIPQXXXXXXXXXXXXXEPDPVNTEMPTFDILKSAEELPNYLPDDAEQGGP---QC 411
            L  I+P              E    + +       +S     NY  D+ E GG    QC
Sbjct: 349 KLEEILPPRSKPSIPKSAEVEECILTDFDHSKHSGKQSNGRGANYDSDEEEHGGAEGVQC 408

Query: 412 SQQ 414
           + Q
Sbjct: 409 ASQ 411

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL257C
          Length = 409

 Score =  196 bits (498), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 121/366 (33%), Positives = 196/366 (53%), Gaps = 27/366 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+ DA   +IKKAYR+ AL++HPDK    +   E+  KFK++ AAYE+LS+ +KR
Sbjct: 8   YDLLGVSADANDAQIKKAYRKAALKYHPDK----NPSSEAADKFKQMTAAYEILSDSQKR 63

Query: 64  RNYDTYGDTNGYSDSYGGFQDGD--------FASFFGNFASGRYEDEEDFRAHARPRTDD 115
             YD +G+        G    G         F+ FFG   + R    +  R        D
Sbjct: 64  EVYDQFGEEGLNGGGGGPGGFGGFGGFGEDIFSQFFGGGGASRPRGPQKGR--------D 115

Query: 116 AHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRR 175
               +  T+++LY G+T +    + V+C  CEG G   ++     C+ C GHGVK   R+
Sbjct: 116 IKHDISCTLENLYKGRTAKLALNKTVLCKSCEGRG--GKSGSVKKCSSCGGHGVKFVTRQ 173

Query: 176 LGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVL 235
           +GP  + R    C  C G G  +  +D C++C GK+++ E K L V I  G ++  ++V 
Sbjct: 174 MGP-MIQRFQTTCEACNGEGDVIDPKDRCRECSGKKISNERKILEVNIEPGMKNGQKVVF 232

Query: 236 EGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDG 295
           +GEAD++PG++ GD+VF ++E        R G +LH +  I L  A+ G +  +   + G
Sbjct: 233 QGEADQQPGQIPGDVVFVVNEQEHP-KFVRNGDNLHYEAQIDLLTAVAGGQFAL-EHVSG 290

Query: 296 RDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEA 355
             L++ I  G+VI PG    ++ +G P+   G  +GN+ ++ N++FP  H+ S+  +++ 
Sbjct: 291 DWLKVDIVPGEVIAPGMVKVIEGKGMPIQKYG-SYGNLLIKFNVKFPKSHFASD-ADLKK 348

Query: 356 LRNIIP 361
           L  I+P
Sbjct: 349 LEEILP 354

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {ON}
           complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  195 bits (496), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 120/365 (32%), Positives = 197/365 (53%), Gaps = 26/365 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+P+A++ EIKK YR+ AL++HPDK    +  +E+  KFKE + AYE+LS+ +KR
Sbjct: 8   YDLLGVSPNASESEIKKGYRKAALKYHPDK----NPTDEAAEKFKECSGAYEVLSDSQKR 63

Query: 64  RNYDTYGD-------TNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRTDDA 116
             YD YG+              +GGF D  F+ FFG   + R             R  D 
Sbjct: 64  EIYDQYGEEGLSGGGPGAGFGGFGGFGDDIFSQFFGGAGASR--------PRGPQRGKDI 115

Query: 117 HVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRL 176
              ++ T+++LY G+T +    + ++C  CEG G ++ A     C+ C G GVK   R++
Sbjct: 116 RHEIQNTLEELYKGRTAKLALNKQILCKGCEGRGGKEGA--VKKCSSCGGQGVKFVTRQM 173

Query: 177 GPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLE 236
           GP  + R   +C  C G G  +  +D CK+C G +V  E K L V++  G R   ++  +
Sbjct: 174 GP-MIQRFQTECDVCHGSGDIIDPKDRCKECKGNKVANERKVLEVHVEPGMREGQKVTFK 232

Query: 237 GEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGR 296
           GEAD+ P  + GD++F ++E     + +R G DL  +  + L  A+ G +  +   + G 
Sbjct: 233 GEADQAPDIIPGDVIFVVTE-KPHKHFKRSGDDLLYEAEVDLLTAIAGGDFAI-EHVSGD 290

Query: 297 DLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEAL 356
            L++ I  G+VI PG    +  +G P+   G  +GN+ +   I+FP +H +++  +++AL
Sbjct: 291 WLKVTIVPGEVISPGVRKVIDGKGMPVQKYG-GYGNLIITFKIKFPENH-FADEAKLKAL 348

Query: 357 RNIIP 361
            +I+P
Sbjct: 349 EDILP 353

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {ON}
           Anc_2.243 YNL064C
          Length = 407

 Score =  192 bits (489), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 125/365 (34%), Positives = 195/365 (53%), Gaps = 26/365 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+P+A++ EIKK YR+ AL++HPDK    +  EE+  KFKE +AAYE+LS+ +KR
Sbjct: 8   YDLLGVSPNASETEIKKGYRKQALKYHPDK----NPSEEAAEKFKECSAAYEVLSDSQKR 63

Query: 64  RNYDTYGDTNGYSDSYGGFQ-------DGDFASFFGNFASGRYEDEEDFRAHARPRTDDA 116
             YD YG+        GGF        D  F+ FFG   + R    +        R  D 
Sbjct: 64  EVYDQYGEEGLNGGGAGGFPGGGFGFGDDIFSQFFGGAGAQRPSGPQ--------RGRDI 115

Query: 117 HVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRL 176
              ++ T+++LY G+T +    + ++C  CEG G   +A     CT C G G+K   R++
Sbjct: 116 KHEIQNTLEELYKGRTAKLALNKQILCKTCEGRG--GKAGAVKKCTSCNGQGIKFVTRQM 173

Query: 177 GPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLE 236
           GP  + R   +C  C G G  +  +D CK C GK++  E K L V++  G R   +IV +
Sbjct: 174 GP-MIQRFQTECDVCHGSGDIIDPKDRCKDCKGKKIANERKVLEVHVEPGMREGQKIVFK 232

Query: 237 GEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGR 296
           GEAD+ P  + GD++F + E     + +R G DL  +  I L  A+ G E  +   + G 
Sbjct: 233 GEADQAPDVIPGDVIFVVVE-KPHKHFKRAGDDLLYEAEIDLLTAIAGGEFAI-QHVSGD 290

Query: 297 DLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEAL 356
            L++    G+VI  G    ++ +G P+   G  +GN+ V   I+FP +++ +E  +++ L
Sbjct: 291 WLKVSTVPGEVISSGMKKVIEGKGMPVPKYG-GYGNLIVTFKIKFPENNFATED-KLKEL 348

Query: 357 RNIIP 361
            NI+P
Sbjct: 349 ENILP 353

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
           to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
           yeast dnaJ homolog (nuclear envelope protein) heat shock
           protein
          Length = 411

 Score =  190 bits (482), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 127/366 (34%), Positives = 197/366 (53%), Gaps = 26/366 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD +GV+P A   +IKKAYR+ AL++HPDK    +  EE+  KFKE+++AYE+LS+ +KR
Sbjct: 8   YDLIGVSPGADDAQIKKAYRKAALKYHPDK----NPTEEAAEKFKEISSAYEILSDSQKR 63

Query: 64  RNYD--------TYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRTDD 115
             YD          G   G    +GGF D  F+ FFG             R     +  D
Sbjct: 64  EMYDQFGEEGLNGGGAGAGGFGGFGGFGDDIFSQFFGGAGGSS-------RPRGPQKGRD 116

Query: 116 AHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRR 175
               +  T+++LY G+T +    + ++C  CEG G   +A     C+ C G G K   R+
Sbjct: 117 IRHEISATLEELYKGRTAKLALNKQILCKSCEGRG--GKAGAVKKCSSCNGQGFKFITRQ 174

Query: 176 LGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVL 235
           +GP  + R   +C  C G G  + ++D CK C+GK++  E K L V+I  G +   +IV 
Sbjct: 175 MGP-MIQRFQAECDACNGTGDIIDAKDRCKACNGKKIANERKILEVHIEPGMKDGQKIVF 233

Query: 236 EGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDG 295
           +GEAD+ P  + GD+VF +SE        R+G DL+ +  + L  A+ G E  V   + G
Sbjct: 234 QGEADQAPDVVPGDVVFVVSE-RPHERFNRKGDDLYYEAEVDLLTAIAGGEFAV-QHVSG 291

Query: 296 RDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEA 355
             L+++I  G+VI PG    ++ +G P+   G  FGN+ V+  I+FPP+H +++   ++ 
Sbjct: 292 DWLKVEIVPGEVIAPGATKIIEGKGMPVQKYG-GFGNLIVKFKIKFPPNH-FADEASLKQ 349

Query: 356 LRNIIP 361
           L NI+P
Sbjct: 350 LENILP 355

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  189 bits (479), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 127/366 (34%), Positives = 194/366 (53%), Gaps = 26/366 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+  AT+ EIKKAYR+ AL++HPDK    +   E+  KFKEV++AYE+LS+ EKR
Sbjct: 8   YDLLGVSVSATEIEIKKAYRKSALKYHPDK----NPSAEAAEKFKEVSSAYEVLSDSEKR 63

Query: 64  RNYDTYGDTNGYSDSYGGFQ--------DGDFASFFGNFASGRYEDEEDFRAHARPRTDD 115
           + YD +G+      + G           D  F+ FFG    G        R     R  D
Sbjct: 64  QVYDQFGEEGLSGGAGGAGGFGGFGGYGDDIFSQFFGGAPGGG-------RPRGPQRGRD 116

Query: 116 AHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRR 175
               + +T+++LY G+T +    + ++C  C G G ++ A     C+ C G G K   R+
Sbjct: 117 IKHEIAVTLEELYKGRTAKLALNKQILCKGCNGRGGKEGA--VKKCSSCNGQGYKFVTRQ 174

Query: 176 LGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVL 235
           +GP  + R   +C  C G G  +  +D CK C+GK+V  E K L V++  G +   +IV 
Sbjct: 175 MGP-MIQRFQTECEACAGTGDIIDPKDRCKSCNGKKVANERKILEVHVDPGMKDGQKIVF 233

Query: 236 EGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDG 295
           +GEAD+ P  + GD++F +SE     N +R G DL  +  I L  A+ G E  +   + G
Sbjct: 234 KGEADQAPDVIPGDVIFVVSE-KPHKNFQRVGDDLVYEAEIDLLTAVAGGEFSL-EHVSG 291

Query: 296 RDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEA 355
             L++ I  G+VI PG    ++ +G P+   G  +GN+ V   I FPP+H+ S+   ++ 
Sbjct: 292 DWLKVAIVPGEVISPGMRKVVEGKGMPIAKFG-GYGNLLVTFKINFPPNHFTSDE-NLKK 349

Query: 356 LRNIIP 361
           L  I+P
Sbjct: 350 LEEILP 355

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 411

 Score =  189 bits (479), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 137/429 (31%), Positives = 205/429 (47%), Gaps = 43/429 (10%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV  DA   +IKK YR+ AL+ HPDK    +   E+  KFKE+  AYE+LS+ +KR
Sbjct: 8   YDLLGVPVDANDAQIKKGYRKQALKFHPDK----NPSAEAADKFKELTVAYEVLSDSQKR 63

Query: 64  RNYDTYGDTNGYSDSYGGFQDGD---------FASFFGNFASGRYEDEEDFRAHARPRTD 114
             YD  G+        GG              F+ FFG  AS         R     +  
Sbjct: 64  DIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGAS---------RPRGPQKGR 114

Query: 115 DAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLR 174
           D    +  ++++LY G+T +    + V+C  CEG G ++ A     C  C G GVK   R
Sbjct: 115 DIKHEMSASLEELYKGRTAKLALNKQVLCKTCEGRGGKEGA--VKKCASCNGQGVKFITR 172

Query: 175 RLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIV 234
           ++GP  + R   +C  C G G  +  +D CK C+GK++  E K L V+I  G +   +IV
Sbjct: 173 QMGP-MIQRFQAECDACNGTGDIVDPKDRCKTCNGKKIDNERKILEVHIEPGMKDGQKIV 231

Query: 235 LEGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLD 294
            +GEAD+ PG + GD++F IS+     + ER+G +L+ +  + L  A+ G E  +   + 
Sbjct: 232 FQGEADQAPGVIPGDVIFVISQ-RPHKHFERKGDNLYYQAEVDLLSAIAGGEFAI-EHVS 289

Query: 295 GRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIE 354
           G  L++ I  G+VI PG    ++ +G P+   G  FG++ V   + FP +H+  E   ++
Sbjct: 290 GEWLKVGIVPGEVISPGMTKVIEGKGMPVQKYG-GFGDLIVTFKVNFPTNHFADEE-SLK 347

Query: 355 ALRNIIPQXXXXXXXXXXXXXEPDPVNTEMPTFDILKSAEELPN------YLPDDAEQGG 408
            L  I+P              E       M  +D  K +    N      Y  DD EQGG
Sbjct: 348 KLEEILPPRAKPSFPKSADVEE-----CVMNDYDPAKHSGRQSNGRGASSYDSDDEEQGG 402

Query: 409 P---QCSQQ 414
               QC+ Q
Sbjct: 403 AEGVQCASQ 411

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {ON}
           Anc_2.243
          Length = 410

 Score =  188 bits (477), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 128/367 (34%), Positives = 191/367 (52%), Gaps = 26/367 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+P A   EIKKAYR+ AL++HPDK    +  EE   KFKEV+AAYE+LS+ EKR
Sbjct: 8   YDVLGVSPTAGDSEIKKAYRKSALKYHPDK----NPTEEGAEKFKEVSAAYEILSDSEKR 63

Query: 64  RNYD---------TYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRTD 114
             YD               G    +GGF D  F+ FFG   +G        R        
Sbjct: 64  EIYDQFGEEGLNGGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGPQRGR------ 117

Query: 115 DAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLR 174
           D    +  T+++LY G+T +    + ++C  CEG G +K A     C+ C G GVK   R
Sbjct: 118 DIKHEIAATLEELYKGRTAKLALNKQILCKTCEGRGGKKGA--VKKCSSCNGQGVKFVTR 175

Query: 175 RLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIV 234
           ++GP  + R   +C  C G G  +  +D CK C+ K+VT E K L V+I  G +    IV
Sbjct: 176 QMGP-MIQRFQAECDVCSGTGDIIDPKDRCKTCNAKKVTNERKILEVHIEPGMKDGQNIV 234

Query: 235 LEGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLD 294
            +GEAD+ P  + GD++F +++     + +R G DL  +  I L  A+ G E  +   + 
Sbjct: 235 FKGEADQAPDVIPGDVIFVVAQ-KPHKHFQRSGDDLVYEAEIDLLTAIAGGEFAL-EHVS 292

Query: 295 GRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIE 354
           G  L++ I  G+VI PG+   ++ +G P+   G   GN+ V   ++FP  H +++   ++
Sbjct: 293 GDWLKVSILPGEVISPGSKKVIEGKGMPIPKYG-GHGNLIVHFTVKFPQKH-FADEDSLK 350

Query: 355 ALRNIIP 361
            L  I+P
Sbjct: 351 KLEEILP 357

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 462

 Score =  174 bits (442), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 123/392 (31%), Positives = 199/392 (50%), Gaps = 49/392 (12%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+  A++ +IKKAYR  AL+HHPDK       EES++KF+++  AYE+L +E KR
Sbjct: 10  YDILGVSASASRQDIKKAYRVNALKHHPDK---NGHSEESKLKFQQICKAYEILKDERKR 66

Query: 64  RNYDTYGDTN-----GYSDSY---GGFQDGD-FASFFGNFAS--GRYEDEEDF-----RA 107
             YD +G  +       S SY    G   GD FA FFG  ++    + D+  F      A
Sbjct: 67  EMYDRFGTADESQWHTESTSYQEQSGMSAGDLFAQFFGGGSTTGSFFNDDMSFFGKRQGA 126

Query: 108 HARP------RTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASAC 161
           H  P      R  D    L+ T++++Y+GK  +    R  +C +C+G G  K    AS C
Sbjct: 127 HTAPSRRELPRGPDIKHYLKCTLEEVYHGKRAKLALKRTRLCKKCKGEGGLK----ASQC 182

Query: 162 THCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNV 221
             C G G++   +R GP  V   +  C+ C G G  ++ +D+C+ C+G+    E +  ++
Sbjct: 183 YTCGGRGIRTETKRHGP-MVQTWSSTCSDCAGRGSFMKQKDICRDCNGQGCIRERRIFDI 241

Query: 222 YIPRGSRHNDRIVLEGEADEEPGK-------LTGDLVFDISEDSTTSNLERRGSDL---H 271
            + +G  +   +VL GEADE  G        + GD++  + +    +    R + L   H
Sbjct: 242 EVHKGMENGQEVVLPGEADEVVGSELGSEHVIPGDVIIILEQLPHKAFWRHRDASLVLDH 301

Query: 272 TKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFG 331
            K  + L  +L G    V +   G+ L++ +  G++++PG   C++  G P    G +FG
Sbjct: 302 CK--VDLKTSLCGGPVWVDSHPSGKLLKIDVLPGEILKPGAIKCVEGMGMP--KSGGRFG 357

Query: 332 NMYVQINIEFPPDHWYSERGE-IEALRNIIPQ 362
           N+Y++ ++ FP     S + E +EALR  + Q
Sbjct: 358 NLYIRFDVAFPE----SLKPETVEALRAALGQ 385

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {ON}
           similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and weakly similar to YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 495

 Score =  174 bits (440), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 128/406 (31%), Positives = 193/406 (47%), Gaps = 82/406 (20%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD L V   AT+ EIKKAYR+ AL+HHPDK +  +   ES   F++++ AYE LSN  KR
Sbjct: 8   YDILEVNTTATEQEIKKAYRKKALKHHPDKNNHSA---ESIKLFQDISHAYETLSNSNKR 64

Query: 64  RNYDTYGD-------------------TNGYSDSYGGFQDGD-FASFFG----------- 92
             YD YG                    +NG S  +     GD FA FFG           
Sbjct: 65  ELYDQYGTVDEGEISEIIAKQNMGNTGSNGNSHPFSAHTAGDLFAQFFGGRGSSGTGASG 124

Query: 93  -----------------NFASGRYEDEEDFRAHARPRTDDAHVSLRLTMQDLYNGKTVRF 135
                            +F      D ED  +H          +L+  + DL++GK  + 
Sbjct: 125 FGFMRGMVNGPFQSFSHDFNMNSMADFEDDGSHEMASGPGIRHNLKCNLYDLFHGKRAKL 184

Query: 136 QSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLG 195
              R  +C RC+G G +K    A+ C  C+G G+    +R+GP   T +T  C +C G G
Sbjct: 185 ALNRTRLCQRCQGYGGKK----ATQCRGCQGTGLFTTTKRMGPMVQTWQTT-CKECSGTG 239

Query: 196 KNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEADE----EPGK---LTG 248
           K +RS+D C +C G     E K  +V +  G R+ + I+L GEADE    E GK   + G
Sbjct: 240 KYIRSKDACTECSGNGFIKERKFFDVEVLPGMRNGNEIILPGEADEVINTEYGKERVIPG 299

Query: 249 DLVFDISEDSTTSNLERRGSDLHTKIIISLSD-ALTGFEKEVCTTL-----------DGR 296
           D++  I     T N E   S++  K ++   D  L  FE ++ T+L            G 
Sbjct: 300 DVIITI---QLTRNEE---SNMRYKYLVHDHDLILDNFEVDLKTSLCGGTIIIEDHPSGN 353

Query: 297 DLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342
             ++++ +G++++PG   C++N+G P+D  G  FGN+Y++  ++FP
Sbjct: 354 PFKIEVLSGELLKPGCIKCVENKGMPVDSNG-NFGNLYIRFRVKFP 398

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.218
           YNL077W
          Length = 462

 Score =  166 bits (419), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 121/375 (32%), Positives = 181/375 (48%), Gaps = 46/375 (12%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD L V+P+A+  EI+KAYR LAL+HHPDK    +  EES+ KF EV  AYE+L +E+KR
Sbjct: 8   YDVLNVSPEASAVEIRKAYRLLALKHHPDK---NNHSEESKSKFLEVNEAYEILIDEKKR 64

Query: 64  RNYDTYG--DTNGYSDS-------YGGFQD-------------GD-FASFFGNFASGRYE 100
             YD YG  D N    S          F +             GD FASFF   +S  + 
Sbjct: 65  SLYDQYGTIDENAIQQSMPQEDPVMSSFFNTGSPMGMGMGMSAGDLFASFFDKMSSPSFG 124

Query: 101 DEEDFRAHARPRTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASA 160
            ++  ++       D    L+ T+  LY GK  +    R  VC  C+G G  K       
Sbjct: 125 GKKTKKSMD--HGPDIKHDLKCTLSSLYEGKNTKLGLNRRRVCKACKGRGSMK----VRT 178

Query: 161 CTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLN 220
           C  C G G + R R++GP   T  T  C+ C G+G   +  D+C+ C G+    E K  +
Sbjct: 179 CKACRGRGQQSRSRQMGPMMQTW-TQTCSDCNGMGTFTKDSDVCRDCEGEGCIRERKIFD 237

Query: 221 VYIPRGSRHNDRIVLEGEADE-------EPGKLTGDLVFDISE--DSTTSNLERRGSDLH 271
           V +  G     +I+L GEADE           + GD++  I +  D     + R G DL 
Sbjct: 238 VEVKPGMCQGQQIILPGEADEVIKTRFGNETVIPGDVIITIIQIKDPKFQRVNRNGCDLM 297

Query: 272 TK-IIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKK- 329
            +   I L  +L G +  +    +G+ + + I  G++I+P ++  ++N G P  +E +  
Sbjct: 298 VRNCKIPLVTSLCGGKLSIDGHPNGKLINVTILPGELIKPNHFKSIENLGMPRYEEKRAP 357

Query: 330 --FGNMYVQINIEFP 342
             +GN+Y+Q  +EFP
Sbjct: 358 EGYGNLYIQFQVEFP 372

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score =  164 bits (416), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 116/364 (31%), Positives = 172/364 (47%), Gaps = 33/364 (9%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV P  +  E+KK+Y+  AL++HPDK       E S+ +F+++A AY +L +E  R
Sbjct: 8   YDVLGVQPGVSAAELKKSYKLAALRYHPDK---NGHSEASKQRFQQIADAYRVLGDERLR 64

Query: 64  RNYDTYGDTN---------GYSDSYGGFQDGD-FASFFGN------FASGRYEDEEDFRA 107
           + YD YG  +               GG   GD FA FFG+      FA          R 
Sbjct: 65  KIYDRYGTVDEGEVAAMAAAERRHAGGITPGDLFAHFFGDGQGLGSFAIFGESGASSARC 124

Query: 108 HARPRTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGH 167
               R  D    LR T+++LY GK VR   TR  +C  C G G       AS CT C G 
Sbjct: 125 SRVSRGPDIKHKLRCTLEELYGGKVVRLALTRTRLCTLCAGRG----GSRASTCTACSGQ 180

Query: 168 GVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGS 227
           G+  + +R G   V   +  C  C G G  ++  D C  C G     E K   V I  G 
Sbjct: 181 GICSQTKRQGS-LVQTWSSTCRVCSGSGTIVKDCDTCTSCGGAGYLRERKVFEVEIRPGM 239

Query: 228 RHNDRIVLEGEADEEP----GK---LTGDLVFDISEDSTTSNLERRGSD--LHTKIIISL 278
           R    +V  GEADE      GK   L GDL   I E +  +  + RG    L T++ + L
Sbjct: 240 RAGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEEATPATRYQCRGDANLLLTELHVDL 299

Query: 279 SDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQIN 338
             +L G    +     G+ ++L+I  G+++ PG   C+++ G P  D+  ++G+++++ +
Sbjct: 300 RTSLCGGTVYIEDHPSGKLIQLEIIPGELLEPGAIKCIEHLGMPHPDDPSQYGHLFIKFH 359

Query: 339 IEFP 342
           ++FP
Sbjct: 360 VDFP 363

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {ON}
           YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score =  162 bits (410), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 113/377 (29%), Positives = 188/377 (49%), Gaps = 51/377 (13%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D YDTLGVA +A++ EIKKAYR  AL+HHPDK       E+S++KF+++  AYE+L +++
Sbjct: 8   DLYDTLGVAANASRQEIKKAYRLKALKHHPDK---NGHSEQSKLKFQQICKAYEILGDDK 64

Query: 62  KRRNYDTYG---DTNGYSDSY-----GGFQDGDFAS------------------FFGNFA 95
           KR  YD +G   +T  ++++       G   GD  S                  FFG   
Sbjct: 65  KREMYDRFGTADETQWHTEATNYEEPSGMSAGDLFSQFFGGGSTTGGFFSEGMDFFG--- 121

Query: 96  SGRYEDEEDFRAHARPRTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRA 155
           S R    +  R  A  R  D    L+ T++++YNGK  +    R  +C  C+G G +K  
Sbjct: 122 SSRGFRAQGSRRSAPQRGPDIKHYLKCTLEEMYNGKRAKLALKRTRLCQTCQGEGSKK-- 179

Query: 156 RHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPE 215
             A++C  C G G++ + +R GP   T  +  C  C G G  ++  D+C  CHG+    E
Sbjct: 180 --ATSCYACRGKGMQTQTKRQGPIMQTWSST-CGTCGGSGTIVKPSDICNGCHGQGWVRE 236

Query: 216 TKNLNVYIPRGSRHNDRIVLEGEADE-------EPGKLTGDLVFDISEDSTTSNLERRGS 268
            K   + + +G  +   +V+  EADE           + GD++  I E     +L +RG 
Sbjct: 237 RKIFEIEVQKGMENGQTVVVPAEADEVVISKYGSERVIPGDVII-ILEQLPHRSL-KRGH 294

Query: 269 D---LHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDD 325
           D   L ++  + L  +L G    V +   G+ L++ +  G++++PG   C+++ G P   
Sbjct: 295 DSSLLLSECQVDLKTSLCGGTVWVDSHPSGKVLKIDVIPGELLKPGAIKCVQSMGMPKSK 354

Query: 326 EGKKFGNMYVQINIEFP 342
            G  +G+++++  + FP
Sbjct: 355 GG--YGDLFIKFKVIFP 369

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 461

 Score =  159 bits (401), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 116/377 (30%), Positives = 177/377 (46%), Gaps = 56/377 (14%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YDTL ++ DAT  EIKKAYR  AL+ HPDK    +  E+S+ KF+E+  AYE+L + +K+
Sbjct: 10  YDTLNISVDATPQEIKKAYRLAALKSHPDK---NNHSEDSKRKFQEICKAYEILGDAKKK 66

Query: 64  RNYDTYGDTN----------GYSDSYGGFQDGD-FASFFG----NFASGRYEDEEDFRAH 108
             YD YG  +          G      G   GD F+ FFG      AS  + D+  F   
Sbjct: 67  LLYDRYGTVDESVIQEQQQEGVYYGSSGMSAGDLFSQFFGGGSTTSASSFFNDDTMFFTG 126

Query: 109 AR------PRTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACT 162
            +       R  D   +LR ++++LY+GK  + +  R  +C  C+G G       +SAC 
Sbjct: 127 KKNSQRRVSRGPDIKHNLRCSLEELYHGKKSKLRLDRTRLCKTCKGNG----GTSSSACR 182

Query: 163 HCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVY 222
            C G G   + RR GP   T  T  C  C G G  +R +D+C +C G+    E K   + 
Sbjct: 183 ACNGQGFYTQTRRHGPMVQTWSTT-CQDCGGSGTFVRRKDVCSECKGQGCIKERKIFEIE 241

Query: 223 IPRGSRHNDRIVLEGEADE-----------EPGKLTGDL------VFDISEDSTTSNLER 265
           +  G  H   IVL  EADE            PG +   +      +F I  D+     + 
Sbjct: 242 VQPGMHHGQEIVLPEEADEIVYTTYGKEQVNPGDVIIIVQQVKHPLFQIHNDT-----DL 296

Query: 266 RGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDD 325
             +D H  +  SL       E   C    G  L++++  G++++PG   C+++ G P   
Sbjct: 297 VMNDCHVDLKTSLCGGEVLIENHPC----GSALKIEVLPGEILKPGCVKCVESMGMP-HP 351

Query: 326 EGKKFGNMYVQINIEFP 342
           + + FGN+Y++  ++FP
Sbjct: 352 QSQGFGNLYIRFQVDFP 368

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
           {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and some similarites with YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 491

 Score =  159 bits (401), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 123/397 (30%), Positives = 176/397 (44%), Gaps = 66/397 (16%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YDTL V+PDAT  EIK+AY+ +AL++HPDK       E+++ KF+EV  AYE+L++E+KR
Sbjct: 8   YDTLKVSPDATISEIKRAYKVMALKYHPDK---NHHSEDAKNKFQEVCKAYEILADEDKR 64

Query: 64  RNYDTYGDTNGYS-----DSYGG-----------FQDGD-FASFFGNFASGRYEDEEDFR 106
             YD YG  + Y+     +S G               GD FA FF NF          F 
Sbjct: 65  VMYDRYGTVDEYALQEQEESQGAPTTSSSFFGSSMSPGDLFAQFFDNFPGHSSFGRSPFG 124

Query: 107 AHAR-------------------------------PRTDDAHVSLRLTMQDLYNGKTVRF 135
           +                                   R  D   +L+ T+ +LY+GK  + 
Sbjct: 125 SAFGGGSPFGGGFPFGSSFSHHSGGGRSSYGGGRPSRGPDIKHNLKCTLAELYDGKITKL 184

Query: 136 QSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLG 195
              R  +C  C+G G  +R      C  C G G +   RR GP  V   T  C  C GLG
Sbjct: 185 GLNRRRMCQSCQGQGSLRR----RTCKTCRGQGQQTETRRTGP-MVQTWTQTCPDCNGLG 239

Query: 196 KNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEADE-------EPGKLTG 248
              +  D+C +C G+    E K  +V + +G  H   IVL GEADE           + G
Sbjct: 240 TYTKQADVCHECRGESYIKERKIFDVEVSKGMCHGQTIVLPGEADELIKTSFGVEKVIPG 299

Query: 249 DLVFDISE--DSTTSNLERRGSDL-HTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTG 305
           D+V  I +  DS    + R G DL      I LS +L G +  +     G+ L++ I  G
Sbjct: 300 DVVITIDQVKDSKFHRVNRYGCDLVMGSCSIDLSTSLCGGDIYIDGHPSGKLLKVSIVPG 359

Query: 306 QVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342
           ++I P     ++  G P        GN+Y+Q  +E+P
Sbjct: 360 ELIGPNCLKSIEGMGMPKYGHDGGKGNLYIQFQLEYP 396

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  152 bits (383), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 118/350 (33%), Positives = 176/350 (50%), Gaps = 18/350 (5%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y  LGV+  A   +IK AYR+L+ ++HPDK  D+   + +  KF EV  AYE+LS+ E
Sbjct: 20  DYYSILGVSKGAGDKDIKSAYRQLSKKYHPDKNPDD---DSAHNKFIEVGEAYEVLSDPE 76

Query: 62  KRRNYDTYG----DTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRTDDAH 117
           KR+ YD YG      NG      G + G F   F  F           R   R R  +  
Sbjct: 77  KRKIYDQYGAEALKNNGGQGGGQGPRGGGFHDPFDIFEQMFGGGGGGQRQRRRARGHNLE 136

Query: 118 VSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLG 177
               LT+++ Y G ++ F    N  C  CEG+G   +    + C  C+GHGV  ++ R+G
Sbjct: 137 TREELTLKEYYRGTSIDFNLNLNDFCEHCEGSG--SQDGKVTKCPDCKGHGVVVQIVRMG 194

Query: 178 PGFVTRETVQ-CTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLE 236
           P  VT++  Q C KC+G G  ++++  CK CHG++V  + K+ +V +P G+  N   V +
Sbjct: 195 P--VTQQIQQMCGKCQGRGSTIKNK--CKHCHGEKVVRKPKSFHVDVPPGAPRNFVEVKQ 250

Query: 237 GEADEEPGKLTGDLVFDISEDSTTS-NLERRGSDLHTKIIISLSDALT-GFEKEVCTTLD 294
           GE+D+ P    GDL    SE S  +    RRG DL     +SL +AL  G+E+E+     
Sbjct: 251 GESDKGPDFDAGDLFIKFSETSRDNLGYRRRGDDLFRTEALSLREALKGGWEREIEFLDA 310

Query: 295 GRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPD 344
            R +++K  +  V   G    +   G P   E  KFG++Y+   +  P D
Sbjct: 311 KRKVKIKRASSMVTNNGEIERIPGFGMP--KEHNKFGDLYIDYVVIVPDD 358

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
           Ashbya gossypii AER346W
          Length = 374

 Score =  150 bits (378), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 117/359 (32%), Positives = 181/359 (50%), Gaps = 29/359 (8%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y  LGV   A+  +IK AYR+L+ ++HPDK   +   E++  +F EV  AYE LS+ E
Sbjct: 21  DYYAILGVGRGASDKDIKSAYRQLSKKYHPDKNPGD---EDAHNRFIEVGEAYEALSDPE 77

Query: 62  KRRNYDTYG--------DTNGYSDSYGGFQD--GDFASFFGNFASGRYEDEEDFRAHARP 111
           KR+ YD +G        D  G   + GGF D    F   FG  A  R+      R   R 
Sbjct: 78  KRKIYDQFGAEALKNGGDRAGGGGAGGGFHDPFDIFDQMFGGGAGSRFHGGGGQRRKQRG 137

Query: 112 RTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHG-VK 170
           ++    V   L ++  Y+G ++ F  + N  C+ C+G+G   +      C  C G G V 
Sbjct: 138 QS--LQVQDELNLKKFYHGTSIEFTMSLNDFCDACDGSG--SQDGKVEKCGQCGGRGMVV 193

Query: 171 QRLRRLGPGFVTRETVQ-CTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRH 229
           Q +R+   GF+T++  Q C KC G G+ ++++  CK CHG +V  + K+ +V +P G+  
Sbjct: 194 QVIRQ---GFITQQIQQMCQKCEGRGEVIKNK--CKTCHGSKVVKKNKSFHVDVPAGAPR 248

Query: 230 NDRIVLEGEADEEPGKLTGDLVFDISEDSTTSNL--ERRGSDLHTKIIISLSDALTGFEK 287
           +   V+ GEA++ P    GD+   + E S   N+   RRG DL    ++SL++AL G   
Sbjct: 249 DFVAVIRGEAEKSPDTEPGDIYVKVVE-SPVQNMGYRRRGPDLFRTEVLSLTEALKGGWV 307

Query: 288 EVCTTLDG-RDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDH 345
                LD  + + L    G  ++ G   C+K  G PL + G K+G++YV   I  P  +
Sbjct: 308 RELEFLDSKKKVVLSRSKGTPVQHGEVECIKGFGMPL-ESGTKYGDLYVDYVIVMPSKY 365

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
           Ashbya gossypii AER427W
          Length = 503

 Score =  152 bits (383), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 117/404 (28%), Positives = 185/404 (45%), Gaps = 62/404 (15%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD L V+P  +  E+KK+Y+  AL++HPDK       E ++  F+++  AY +LS+E KR
Sbjct: 8   YDLLNVSPTVSPQELKKSYKLAALRYHPDK---NGHSESAKQAFQQITEAYGILSDERKR 64

Query: 64  RNYDTYG--DTNGYSDSYGG-------------------FQDGDF--------------A 88
           + YD YG  D N                              GD                
Sbjct: 65  KIYDRYGVSDENEIVAILASQKRAAAAAAPAATAARNMEMTPGDLFAHFFGDGFGAGGEF 124

Query: 89  SFF-GNFASG-RYEDEEDFRAH-ARPRTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNR 145
           SF  GN     R+      +A   + R  D   +L+  +++LY+GK  +   TR  +C+R
Sbjct: 125 SFLQGNLGGHCRFNSAAKDKARDGKSRGPDIKHNLKCELKELYSGKVAKLGLTRTRLCHR 184

Query: 146 CEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCK 205
           C G G    +  +S C  C G GV  + RR GP  V   +  C  C G G  ++S D+C+
Sbjct: 185 CSGHG----SMTSSVCGECRGQGVYSQTRRHGP-LVQTWSSSCRNCSGAGTFVKSNDVCQ 239

Query: 206 KCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEADE-------EPGKLTGDLVFDISEDS 258
            C G     E K   V I  G  +   I+L GEAD+       +   + GD++  + E  
Sbjct: 240 TCRGTGYIRERKIFEVEIKPGLSNKSEIILPGEADQVISTVYGKQQVIPGDVIIIVQEQC 299

Query: 259 TTSNLER-RGSDL-HTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICL 316
           +T    R R SDL  T+ ++ L  +L G    +     GR ++L++  G+++ PG+  C+
Sbjct: 300 STGRYRRFRESDLVLTRCVVDLRTSLCGGSIYIDDHPSGRPIKLEVIPGELLNPGSIKCV 359

Query: 317 KNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEALRNII 360
           +N G P  D   ++G++Y++  + FP      ER E E + N+I
Sbjct: 360 ENLGMPKRDNPSQYGDLYIKFCVNFP------ERLEPETM-NVI 396

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  147 bits (372), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 108/356 (30%), Positives = 175/356 (49%), Gaps = 26/356 (7%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y  LGV  DA   EIK AYR+L+ ++HPDK   +   EE+  KF EV  AY++LS+ E
Sbjct: 22  DYYKILGVNKDANDKEIKSAYRQLSKKYHPDKNPGD---EEAHNKFIEVGEAYDVLSDSE 78

Query: 62  KRRNYDTYG--------DTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRT 113
           KR  YD YG        +          F D  F  F   F    +          R R 
Sbjct: 79  KRNIYDQYGADAIKNGGNGQRPGGGGSPFHD-PFEMFEKMFNGNPFGGAARGGPGGRGRP 137

Query: 114 DDAHVSLR--LTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQ 171
              ++ LR  +++ D YNG+  ++    N  C +C G G   +    + C  C+G GV  
Sbjct: 138 RGQNLLLREEVSLMDFYNGREFKYNLQLNDFCEKCHGTG--SKDGKVTRCPDCQGRGVIV 195

Query: 172 RLRRLGPGFVTRETVQ--CTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRH 229
           ++ ++G   +  + +Q  C +C G G+ +++   C  CHG +V    K   V +P G++ 
Sbjct: 196 QVIQMG---IMTQQIQHVCDRCSGSGEIIKNP--CPHCHGHKVAKMDKEFTVKLPNGAQR 250

Query: 230 NDRIVLEGEADEEPGKLTGDLVFDISEDSTTS-NLERRGSDLHTKIIISLSDALT-GFEK 287
           N   +  GEA++      GDL+F+  E+S  +    RRG  L+   ++S+ +AL  G+E+
Sbjct: 251 NYVDIKHGEAEKGADFDAGDLMFEFRENSMNNMGYRRRGDHLYRTEVLSVQEALKGGWER 310

Query: 288 EVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWP-LDDEGKKFGNMYVQINIEFP 342
           E+      ++++LK    QV+  G   C+   G P L+ +G+KFG++++   I  P
Sbjct: 311 ELEFFDKDKNVKLKRDANQVVITGEIECVPGFGMPILNSQGRKFGDLFIDYVILMP 366

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
           several homologs of bacterial chaperone DnaJ, located in
           the ER lumen where it cooperates with Kar2p to mediate
           maturation of proteins
          Length = 377

 Score =  144 bits (363), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 111/353 (31%), Positives = 174/353 (49%), Gaps = 24/353 (6%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y  L +  DAT+ EIK AYR+L+ ++HPDK    +  EE+  KF EV  AY++LS+ E
Sbjct: 23  DYYAILEIDKDATEKEIKSAYRQLSKKYHPDK---NAGSEEAHQKFIEVGEAYDVLSDPE 79

Query: 62  KRRNYDTYG---------DTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPR 112
           K++ YD +G                  GGF D  F  F   F  G       F    R R
Sbjct: 80  KKKIYDQFGADAVKNGGGGGGPGGPGAGGFHD-PFDIFERMFQGGHGGPGGGFGQRQRQR 138

Query: 113 TDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQR 172
                V  +L+++  Y+G ++ F    N  C+ C G+G        + C  C+G GV  +
Sbjct: 139 GPMIKVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSG--SADGKLAQCPDCQGRGVIIQ 196

Query: 173 LRRLGPGFVTRETVQ-CTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHND 231
           + R+G   +T++  Q C +C G G+ +++E  CK CHGK+VT + K  +V +P G+  N 
Sbjct: 197 VLRMG--IMTQQIQQMCGRCGGTGQIIKNE--CKTCHGKKVTKKNKFFHVDVPPGAPRNY 252

Query: 232 RIVLEGEADEEPGKLTGDLVFDISE-DSTTSNLERRGSDLHTKIIISLSDALTGFEKEVC 290
                GEA++ P    GDLV +  E D+      RRG +L+   ++S ++AL G  +   
Sbjct: 253 MDTRVGEAEKGPDFDAGDLVIEFKEKDTENMGYRRRGDNLYRTEVLSAAEALYGGWQRTI 312

Query: 291 TTLD-GRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342
             LD  + ++L  P   V+  G    +K  G P   +G  +G++Y+   +  P
Sbjct: 313 EFLDENKPVKLSRPAHVVVSNGEVEVVKGFGMPKGSKG--YGDLYIDYVVVMP 363

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score =  144 bits (362), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 106/356 (29%), Positives = 175/356 (49%), Gaps = 23/356 (6%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y  LG+A DAT  EIK AYR+L+ + HPDK       E++  KF EV  AYE+LS+ +
Sbjct: 21  DYYQILGIAKDATDKEIKSAYRQLSKKFHPDK---NPGNEDAHQKFIEVGEAYEVLSDPQ 77

Query: 62  KRRNYDTYG------DTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRTDD 115
           KR+ +D +G         G       F D  F  F   F               +PR  +
Sbjct: 78  KRQTFDQFGADAVKNGGQGQPGGGAQFHD-PFDIFEQMFGGQGGGGNPFGGQRQKPRGPN 136

Query: 116 AHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRR 175
                 ++++D Y G  + F    N +C+ C G G        + C  C+G GV  +L R
Sbjct: 137 IMAREEISLKDYYTGYELNFTLNVNDLCDHCHGTG--SDDGKLTPCPDCQGRGVIIQLIR 194

Query: 176 LGPGFVTRETVQ-CTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIV 234
           +G   +T++  Q C +C G G+  + +  C+KCHG +V P+ K   V +P+G++ +   V
Sbjct: 195 MG--MMTQQIQQMCGRCGGKGQLFKKQ--CRKCHGNKVMPQKKEFQVKLPKGAKRHYMDV 250

Query: 235 LEGEADEEPGKLTGDLVFDISE-DSTTSNLERRGSDLHTKIIISLSDALT-GFEKEVCTT 292
             GEAD+ P    GDL+ + +E D +     RRG +L+   ++++++AL  G+++E+   
Sbjct: 251 KHGEADKNPDLEAGDLLIEFNENDKSNMGYRRRGQNLYRTEVLNVTEALYGGWQREIPFL 310

Query: 293 LDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKK--FGNMYVQINIEFPPDHW 346
              + L++   +  V+  G    +   G P   +GKK  FG++++   +   P  W
Sbjct: 311 DPKKKLQVGRESNIVVSHGEVERIPGFGMPT-GKGKKETFGDLFIDY-VVIMPKQW 364

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
           (REAL)
          Length = 532

 Score =  144 bits (364), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 128/427 (29%), Positives = 184/427 (43%), Gaps = 107/427 (25%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD+L V   A+  EIKKAYR  AL++HPDK    +  EES+ KF+E+  AYE L +   R
Sbjct: 8   YDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYETLKDNHLR 64

Query: 64  RNYDTYGDTN---------------------------GYSDSYGGFQD---GD-FASFFG 92
             YD YG T+                           G+      F D   GD FA FF 
Sbjct: 65  SLYDQYGTTDEVLIQEQQAQTQSQRQRQQASVFSPSAGFGTGGMSFPDLSPGDLFAQFFN 124

Query: 93  N--------------------------FASG-----------RYEDEEDFRAHARPRTDD 115
           +                          F SG           RY  E + R H     D 
Sbjct: 125 SSASASSNGSKDNFNFSFDGSTTPNFPFGSGGGMNNLYSPPSRYNSEGEGR-HLNRGPDI 183

Query: 116 AHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRR 175
            H +L+ T+++LY GKT +    R  +C  C+G G  K+     AC  C+G GV+ +  R
Sbjct: 184 KH-NLKCTLKELYMGKTAKLGLNRTRICQVCDGHGGLKKY----ACKTCKGQGVQTQTNR 238

Query: 176 LGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVL 235
           +GP  V   +  C  C G G  + S+D+C++C G     + K L V +  GS HN  IVL
Sbjct: 239 MGP-LVQSWSQTCADCGGAGIFVESKDICQQCQGLGFVKQRKILQVAVQPGSCHNQLIVL 297

Query: 236 EGEADEEPGK--------LTGDLV----------FDISEDSTTSNLERRGSDLHTKIIIS 277
            GE DE            + GD+V          F I +D    NL      ++ K  + 
Sbjct: 298 TGEGDEVISSKGGGHEKIIPGDVVITILRLKDPRFQIVDD---YNL------IYKKCKVD 348

Query: 278 LSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKK--FGNMYV 335
           L  +L G    +     G+ ++L I  G+V++PG +  ++N G P    G +  FG+MYV
Sbjct: 349 LMTSLCGGVVYIEGHPSGKLIKLDIIPGEVLKPGCFKTVENMGMPKFINGVRSGFGHMYV 408

Query: 336 QINIEFP 342
           +  + +P
Sbjct: 409 KFEVTYP 415

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {ON}
           Anc_2.218 YNL077W
          Length = 460

 Score =  143 bits (360), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 113/354 (31%), Positives = 170/354 (48%), Gaps = 32/354 (9%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGVA DA+Q EIKKAYR+LAL++HPDK + +   E+    F++++ AY +L +  +R
Sbjct: 5   YDVLGVASDASQSEIKKAYRKLALRYHPDKNNGD---EKCHEAFQKISHAYGVLGDVAQR 61

Query: 64  RNYDTYGDTNGYSDSYGGFQDGDFASFF--GNFASGRYEDEEDFRAHARPRTDDAHVSLR 121
           + YD  GD N      G      F+SFF  G                     +  H  L+
Sbjct: 62  QRYDQSGDENESLQPTGSNAADLFSSFFNGGGVYPSGSSGGPGPSRGPSRGPNIIH-ELK 120

Query: 122 LTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGFV 181
            T+QDLY GK ++    R   C RC           A+ C+ C G G   R+ R+GP   
Sbjct: 121 CTLQDLYRGKVIKLALRRTAPCERCSLGA-------ANVCSSCNGSGNITRIERVGPLTQ 173

Query: 182 TRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEADE 241
           T  +  C  C+G G+   S D C +C G +   E     V++  G      IVL+GEAD+
Sbjct: 174 TWSST-CNACQGQGR--MSVD-CSQCGGAQYLNERVVFKVHVKPGMHDGQTIVLDGEADQ 229

Query: 242 ----EPGKLT----GDLVFDISEDSTT----SNLERRGSDLHTKIIISLSDALTGFEKEV 289
                 G LT    GD+V  I E +      S L +R +    ++ + L+ ALTG    +
Sbjct: 230 CVRDRLGHLTVAESGDVVIVIRELADAKFKRSALNKRENLFVDQVKVDLTTALTGGNVLL 289

Query: 290 CTTLDGRDLRLKIPTGQVIRPGNYI-CLKNEGWPLDDEGKKFGNMYVQINIEFP 342
                G  +++ I  G+ + P N I C++  G P+DD G++ G++Y++     P
Sbjct: 290 EDHPSGNLMKINILPGEFL-PENCIKCVEGLGMPIDDTGQR-GDLYIRFCTHSP 341

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putative
           chaperone of the HSP40 (DNAJ) family; overexpression
           interferes with propagation of the [Psi+] prion; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 528

 Score =  143 bits (360), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 114/412 (27%), Positives = 178/412 (43%), Gaps = 81/412 (19%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD+L V   A+  EIKKAYR  AL++HPDK    +  EES+ KF+E+  AYE+L +   R
Sbjct: 8   YDSLNVTAAASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEILKDNRLR 64

Query: 64  RNYDTYGDTNGY--------------------------SDSYGGFQDGD-FASFFGN--- 93
             YD YG T+                            + S+     GD FA FF +   
Sbjct: 65  ALYDQYGTTDEVLIQEQQAQAQRQQAGPFSSSSNFDTEAMSFPDLSPGDLFAQFFNSSAT 124

Query: 94  -----------------------FASGR-----YEDEEDFRA----HARPRTDDAHVSLR 121
                                  F +G      Y     + +    H   R  D   +L+
Sbjct: 125 PSSNGSKSSFNFSFNNSSTPSFSFVNGSGVNNLYSSSAKYNSNDEDHHLDRGPDIKHNLK 184

Query: 122 LTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGFV 181
            T+++LY GKT +    R  +C+ C+G G  K+      C  C+G G++ + RR+GP  V
Sbjct: 185 CTLKELYMGKTAKLGLNRTRICSVCDGHGGLKKC----TCKTCKGQGIQTQTRRMGP-LV 239

Query: 182 TRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEADE 241
              +  C  C G G  ++++D+C++C G     E K L V +  GS HN  IVL GE DE
Sbjct: 240 QSWSQTCADCGGAGVFVKNKDICQQCQGLGFIKERKILQVTVQPGSCHNQLIVLTGEGDE 299

Query: 242 EPGKLTGDLVFDISEDSTTSNLERRGSDLHT---------KIIISLSDALTGFEKEVCTT 292
                 G     I  D   + L  +  +            K  I    +L G    +   
Sbjct: 300 VISTKGGGHEKVIPGDVVITILRLKDPNFQVINYSNLICKKCKIDFMTSLCGGVVYIEGH 359

Query: 293 LDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKK--FGNMYVQINIEFP 342
             G+ ++L I  G++++PG +  +++ G P    G +  FG++YV+ ++ +P
Sbjct: 360 PSGKLIKLDIIPGEILKPGCFKTVEDMGMPKFINGVRSGFGHLYVKFDVTYP 411

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
           (REAL)
          Length = 378

 Score =  140 bits (353), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 111/354 (31%), Positives = 171/354 (48%), Gaps = 25/354 (7%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y  L V  DA++ EIK AYR+L+ ++HPDK S     EE+  KF EV  AY++LS+ E
Sbjct: 23  DYYAILEVDKDASEKEIKSAYRQLSKKYHPDKNSGS---EEAHHKFIEVGEAYDVLSDPE 79

Query: 62  KRRNYDTYG----------DTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARP 111
           K++ YD +G                   GGF D  F  F   F  G       F    R 
Sbjct: 80  KKKIYDQFGADAVKNGGGGGGGAGGPGGGGFHD-PFDIFEHMFQGGHGGPGGGFGQRQRQ 138

Query: 112 RTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQ 171
           R     V  +L+++  Y+G ++ F  + N  C+ C G+G        + C  C+G GV  
Sbjct: 139 RGPMIKVQEKLSLKQFYSGTSIEFTLSLNDECDVCHGSG--SADGKLAQCPDCQGRGVII 196

Query: 172 RLRRLGPGFVTRETVQ-CTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHN 230
           ++ R+G   +T++  Q C +C G G+ ++++  CK CHGK+V  + K  +V +P G+  N
Sbjct: 197 QVLRMG--IMTQQIQQMCGRCGGTGQIIKNQ--CKTCHGKKVIKKNKFFHVDVPPGAPRN 252

Query: 231 DRIVLEGEADEEPGKLTGDLVFDISE-DSTTSNLERRGSDLHTKIIISLSDALTGFEKEV 289
                 GEA++ P    GDLV +  E D+      RRG +L+   ++S  +AL G  +  
Sbjct: 253 YLDTRAGEAEKGPDFDAGDLVIEFKEKDTENMGYRRRGDNLYRTEVLSAEEALYGGWQRT 312

Query: 290 CTTLD-GRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342
               D  + ++L  P   V+  G    LK  G P    GK  G++Y+   +  P
Sbjct: 313 IEFFDENKPVKLSRPAHVVVSNGEIEVLKGFGMP--KSGKGHGDLYIDYVVIMP 364

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
           {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077w
          Length = 479

 Score =  142 bits (357), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 123/394 (31%), Positives = 172/394 (43%), Gaps = 65/394 (16%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD L V  DA+Q  IKKA+   AL+ HPDK    +  EES+ +F+E++ AYE+LS+ + R
Sbjct: 8   YDLLNVECDASQVTIKKAFHAAALRCHPDK---NNHSEESKKQFQEISKAYEVLSDPKSR 64

Query: 64  RNYDTYGDTN------------GYSDSYG-------GFQDGD-FASFFG-------NFAS 96
             YD YG T+            G S   G       G   GD FA FF        +F  
Sbjct: 65  EMYDRYGTTDESAIASQEPFGEGMSFYSGGNPMHMFGTSAGDLFAQFFNSSGDAGPSFGF 124

Query: 97  GRYEDEEDFRAHARPRTD-------DAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGA 149
           G   D     A A    D       D    L+  + DLY GK  +    R  VC+ C+G 
Sbjct: 125 GSRFDGFGNSAQAHGARDGHMRTGPDIKHYLKCNLSDLYQGKKTKLGLNRMRVCSSCDGK 184

Query: 150 GIRKRARHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHG 209
           G        ++C  C+G G   + RR+GP  V   +  C  C G G  ++  DLC  C G
Sbjct: 185 G----GMRVASCRTCKGQGEVVKTRRVGP-MVQTMSSTCNSCHGTGTFIKDSDLCFVCKG 239

Query: 210 KRVTPETKNLNVYIPRGSRHNDRIVLEGEADE----EPGKLT---GDLVFDISEDSTTSN 262
             V+ E K  +V +  G  HN  IVL GEADE      G +    GD+V  I     T  
Sbjct: 240 SGVSKERKIFDVEVKAGMTHNQVIVLPGEADEVIETSHGLIKVQPGDVVIVIDLVKNTQF 299

Query: 263 LERRGSDLHTKII-ISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGW 321
                 DL  K   + L   L G E  +     G+ ++L I   ++++P  +  ++  G 
Sbjct: 300 QVVNDHDLVLKNCEVPLKTCLCGGEIMIEGHPSGKIIKLSIIPNELLKPSCFKTVEGLGM 359

Query: 322 P-------------LDDEGKKFGNMYVQINIEFP 342
           P              D +G  +GN+YVQ  ++FP
Sbjct: 360 PKVIANSDHANIAGTDIDG--YGNLYVQFQVKFP 391

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  139 bits (350), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 105/351 (29%), Positives = 175/351 (49%), Gaps = 22/351 (6%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y  L +  DA++ EIK AYR+L+ ++HPDK    +  +E+  KF E+  AYE+LS+ E
Sbjct: 23  DYYAILDIGKDASEKEIKSAYRQLSKKYHPDK---NAGSDEAHHKFIEIGEAYEVLSDPE 79

Query: 62  KRRNYDTYG-------DTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRTD 114
           K++ YD +G                GGF D  F  F   F  G+      F    R R  
Sbjct: 80  KKKIYDQFGADAVKNGGGGAGGPGGGGFHD-PFDIFERMFQGGQGGPGGGFGQRQRQRGP 138

Query: 115 DAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLR 174
              V   L+++  Y+G ++ F  + N  C+ C G+G        + C  C+G G+  ++ 
Sbjct: 139 TIKVHENLSLKQFYSGTSIEFTLSLNDECDGCHGSG--SADGKLAQCPDCQGRGIIVQVV 196

Query: 175 RLGPGFVTRETVQ-CTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRI 233
           R+G   +T++  Q C +C G G+ ++++  CK CHGK+VT + K  +V +P G+  N   
Sbjct: 197 RMG--IMTQQIQQICGRCAGTGQVIKNQ--CKTCHGKKVTKKNKFFHVDVPPGAPRNYMD 252

Query: 234 VLEGEADEEPGKLTGDLVFDISE-DSTTSNLERRGSDLHTKIIISLSDALT-GFEKEVCT 291
              GEA++ P    GDLV +  E D+      RRG +L+   ++S ++AL  G+E+ +  
Sbjct: 253 TRAGEAEKGPDFDAGDLVIEFREMDTENMGYRRRGHNLYRTEVLSAAEALYGGWERTIEF 312

Query: 292 TLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342
             + + ++L  P   V+  G    +K  G P     +  G++Y+   +  P
Sbjct: 313 LDENKPVKLSRPAHAVVSTGEIEVVKGFGMP--KGSRDHGDLYIDYVVVMP 361

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
           (REAL)
          Length = 536

 Score =  142 bits (358), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 118/424 (27%), Positives = 180/424 (42%), Gaps = 95/424 (22%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD+L V   A+  EIKKAYR  AL++HPDK    +  EES+ KF+E+  AYE+L +   R
Sbjct: 8   YDSLNVTTTASTSEIKKAYRNAALRYHPDK---NNHTEESKRKFQEICQAYEVLKDNHLR 64

Query: 64  RNYDTYGDTN---------------------------GYSDSYGGFQDGD---------- 86
             YD YG T+                           G   S  GF  G           
Sbjct: 65  SLYDQYGTTDEVLIQEQHQAQAQAQAQQQQQQQQQQAGIFSSSAGFDTGGVTFPDLSPGS 124

Query: 87  -FASFFG------------------------NFASG-------------RYEDEEDFRAH 108
            FA FF                         NF  G             +Y  ++D   H
Sbjct: 125 LFAQFFNSSASASSNGSKNNFSFSFNGSSTPNFPFGNGGGMNNLQSPPSKYGSDDD--EH 182

Query: 109 ARPRTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHG 168
              R  D   +L+ T+++LY GKT +    R  +C+ CEG G  ++      C  C+G G
Sbjct: 183 HLNRGPDIKHTLKCTLRELYMGKTAKLGLNRTRICHVCEGHGGLQKY----TCKTCKGQG 238

Query: 169 VKQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSR 228
           V+ + + +GP  V   +  C  C G G  + S+D+C++C G     + K L V +  G+ 
Sbjct: 239 VQTQTKCMGP-LVQSWSQTCADCGGAGIFVESKDICQQCQGLGFIKQRKILQVTVQPGTS 297

Query: 229 HNDRIVLEGEADEEPGK-------LTGDLVFDISE-DSTTSNLERRGSDLHTKIIISLSD 280
           HN  IVL GE DE   K       + GD+V  I         +    S ++ K  + L  
Sbjct: 298 HNQLIVLTGEGDEVISKGGGHEKVIPGDVVITILRLKDPKFQVTDNCSLIYKKCKVDLMT 357

Query: 281 ALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKK--FGNMYVQIN 338
           +L G    +     G+ ++L I  G+V++P  +  ++  G P    G +  FG++YV+ +
Sbjct: 358 SLCGGIVYIEGHPSGKLIKLDIIPGEVLKPSCFKTIEGMGMPKFINGVRSGFGHLYVKFD 417

Query: 339 IEFP 342
           + +P
Sbjct: 418 VSYP 421

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  139 bits (350), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 107/358 (29%), Positives = 168/358 (46%), Gaps = 22/358 (6%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y  LGV   A++ EIK AYR+L+ ++HPDK       +E+   F EV  AY++LS+ E
Sbjct: 20  DYYAILGVDKQASEKEIKSAYRQLSKKYHPDK---NPGNDEAHHHFIEVGEAYDVLSDPE 76

Query: 62  KRRNYDTYG------DTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRTDD 115
           KR+ YD +G         G      GF D  F  F   F S  Y      RA  +PR  +
Sbjct: 77  KRQIYDRHGADALKNGHPGGPGGGNGFHD-PFDLFEQMFGSNMYN-----RARGKPRGQN 130

Query: 116 AHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRR 175
             V+  ++++  Y G    F    N +C+ C+G+G          C  C G G   ++ R
Sbjct: 131 LQVNHDISLKTFYLGTEFEFTLNLNDICDACDGSG--SEDGKTETCPDCGGSGQIMKVFR 188

Query: 176 LGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVL 235
            GP    R    C++C+G G+ ++   +CKKC G +V  ++K     +  G   N   V+
Sbjct: 189 AGP-IEQRVRQPCSRCQGRGQLIKH--VCKKCKGVKVVQKSKVFTAKVEPGMERNHIHVM 245

Query: 236 EGEADEEPGKLTGDLVFDISEDSTTS-NLERRGSDLHTKIIISLSDALT-GFEKEVCTTL 293
           +G++++ P    GDL     E    S    RRG+ L+   I+S  +AL  G+E+ +    
Sbjct: 246 QGQSEKHPDIEPGDLYQYFRESEKDSMGYRRRGNTLYRTEILSFKEALQGGWERNIEFFD 305

Query: 294 DGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERG 351
             + L L  P G  ++ G    +K+ G P+     KFG++ +   I  P +   S +G
Sbjct: 306 KEKSLVLSRPVGHTVQNGETEVIKSFGMPIPSATDKFGDLIIDYVILLPGEWSTSSKG 363

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score =  139 bits (349), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 106/357 (29%), Positives = 170/357 (47%), Gaps = 28/357 (7%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDK-VSDESLREESEIKFKEVAAAYELLSNE 60
           D Y  LG+  DA+  ++K AYR+L+ ++HPDK   DES  +    +F EV  AYE+LS+ 
Sbjct: 19  DYYSILGLNKDASDKDVKSAYRQLSKKYHPDKNPGDESAHQ----RFIEVGEAYEVLSDP 74

Query: 61  EKRRNYDTYGDTNGYSD----------SYGGFQD--GDFASFFGNFASGRYEDEEDFRAH 108
           EKR  +D YG  +G  +           +GGF D    F   F     G          H
Sbjct: 75  EKRGIFDQYG-ADGLKNGAGGGGGPGGGFGGFHDPFDIFEQMFNRGGGGGGFGGGFGGMH 133

Query: 109 ARPRTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHG 168
            R +     V   L+++D Y+G  V F+   N +C+ CEG+G          C  C G G
Sbjct: 134 -RGKGPSLRVHEELSLKDYYSGTGVEFELMLNDICDHCEGSG--SEDGKVETCPDCGGQG 190

Query: 169 VKQRLRRLGPGFVTRETVQ-CTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGS 227
           +  ++ R+  G +T+   Q C +C G G  ++++  CK C G +V  + K+  V +P G+
Sbjct: 191 ILIQIIRM--GIMTQRIQQPCGRCSGRGHIIKNQ--CKACGGHKVVKKPKSFQVEVPAGA 246

Query: 228 RHNDRIVLEGEADEEPGKLTGDLVFDISE-DSTTSNLERRGSDLHTKIIISLSDALT-GF 285
             +   V   EAD+      GD+  + +E D       RRG  L    ++S  +AL  G+
Sbjct: 247 PRDHVEVRHQEADQSTDMEAGDIFVEFTESDKNNMGYRRRGDHLFRTEVLSAREALAGGW 306

Query: 286 EKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342
            +E+    D + ++L+ P G ++  G    +   G P    GK FG+++V+  +  P
Sbjct: 307 SREIEFLDDAKKVKLQRPKGNIVHHGEIEQIPGFGMPKGSSGKSFGDLFVEYAVVMP 363

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  137 bits (346), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 108/351 (30%), Positives = 172/351 (49%), Gaps = 22/351 (6%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y  L +   A++ EIK AYR+L+ + HPDK +     EE+  KF EV  AY++LS+ E
Sbjct: 23  DYYAILEIDKGASEKEIKSAYRQLSKKFHPDKNAGS---EEAHQKFIEVGEAYDVLSDPE 79

Query: 62  KRRNYDTYG-------DTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRTD 114
           K++ YD +G                GGF D  F  F   F  G       F    R R  
Sbjct: 80  KKKIYDQFGAEAVKNGGDGAGGPGAGGFHD-PFDIFERMFQGGHGGTGGGFGQRQRQRGP 138

Query: 115 DAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLR 174
              V  +L+++  Y+G ++ F  + N  C+ C G+G        + C  C+G GV  ++ 
Sbjct: 139 MIKVQEKLSLKQFYSGSSIEFTLSLNDECDVCHGSG--SADGKLAQCPDCQGRGVIIQVL 196

Query: 175 RLGPGFVTRETVQ-CTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRI 233
           R+G   +T++  Q C +C G G+ +++E  CK CHG +VT   K  +V +P G+  N   
Sbjct: 197 RMG--IMTQQIQQMCGRCGGTGQVIKNE--CKTCHGNKVTKRNKFFHVDVPPGAPRNYMD 252

Query: 234 VLEGEADEEPGKLTGDLVFDISE-DSTTSNLERRGSDLHTKIIISLSDALT-GFEKEVCT 291
              GEA++ P    GDLV +  E DS      RRG +L+   ++S+ +AL  G+E+ +  
Sbjct: 253 TRAGEAEKGPDFDAGDLVIEFKEKDSENMGYRRRGDNLYRTEVLSIEEALYGGWERTIEF 312

Query: 292 TLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342
             + + ++L  P    +  G    +K  G P    GK +G++Y+   +  P
Sbjct: 313 LDENKPVKLSRPAYVGVSNGEIEVMKGFGMP--KGGKGYGDLYIDYVVIMP 361

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
           (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score =  140 bits (352), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 117/405 (28%), Positives = 181/405 (44%), Gaps = 74/405 (18%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD L ++ +A   +IKKAYR LAL++HPDK    +  EES++ F++++ AYE+L + EKR
Sbjct: 8   YDILNISSNADAKDIKKAYRVLALKYHPDK---NNHSEESKVMFQKISEAYEVLIDVEKR 64

Query: 64  RNYDTYGDTNGY-----------------------SDSYGGFQ----------DGD-FAS 89
           + YD YG  +                         SD +G              GD FA 
Sbjct: 65  KLYDQYGTVDESVIEQMKERKRKSEFMQQRQGMYPSDPFGNVNPLFGSDLAASAGDLFAQ 124

Query: 90  FFGNFA--SGRYE--------------DEEDFRAHARPRTDDAHVSLRLTMQDLYNGKTV 133
           FFGN    S R+                 E+  +    R  D   +LR +++DLY GK  
Sbjct: 125 FFGNSNKNSSRFNPFGNMKPNFSNFNNTFENTASVELERGPDIKHTLRCSLKDLYYGKKT 184

Query: 134 RFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRG 193
           + +  R  +C  C G G  K+++    C  C G G   + RR+GP  +   +  C  C+G
Sbjct: 185 KLRLDRTRLCVLCMGQGSMKKSK----CFTCNGLGSLTQTRRMGP-MIQTFSQSCPDCQG 239

Query: 194 LGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEADE----EPGK---L 246
            G  ++  D C+ C G     E K  +V I  G  +   I+L GEADE      GK   +
Sbjct: 240 SGMFVKRSDTCQSCSGNGYVEERKIFDVEIQPGMVNGQVIILPGEADEVVNTSFGKQKVI 299

Query: 247 TGDLVFDISEDSTTSNLERRGSDLHT-KIIISLSDALTGFEKEVCTTLDGRDLRLKIPTG 305
            GD+V  I++    +       DL      ++LS AL G    +     G  +++ I  G
Sbjct: 300 AGDIVLTINQLKDNNFEVINDCDLLLDNFSVNLSKALCGGTIFISNHPSGNLIKIDIIPG 359

Query: 306 QVIRPGNYICLKNEGWPLDDE--------GKKFGNMYVQINIEFP 342
           +++ PG    + N G P +++            GN+YV+ +I+FP
Sbjct: 360 EILSPGVIKTVANLGMPKEEKRDPDVSIINISKGNLYVKFDIKFP 404

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.218
           YNL077W
          Length = 448

 Score =  137 bits (346), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 116/406 (28%), Positives = 194/406 (47%), Gaps = 67/406 (16%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           Y+ L + P A+Q +IKKAYR  AL++HPDK ++ES  EES+ KF++++ AY +L +E +R
Sbjct: 8   YNALNIPPTASQSDIKKAYRVQALRYHPDK-NNES--EESKKKFQDISEAYSILRDENQR 64

Query: 64  RNYDTYGDTN-------------GYSDSYGGFQDGDFASFFG--NFASGRYEDE------ 102
           + YD YG  N              ++D +G      F+ FF   N  SG+          
Sbjct: 65  KMYDKYGTVNPTEIQQQNQRTNVPFTDPFGMSAADLFSQFFDTQNHNSGQSNSSPPFGFP 124

Query: 103 --------------------EDFRAHARP--RTDDAHVSLRLTMQDLYNGKTVRFQSTRN 140
                               + F   +RP  +  D + +L+ T++DLY GK  + +  R+
Sbjct: 125 FNSSRNGNGNNNRAADGVFGDFFNTKSRPLQKGPDINHNLKCTIKDLYRGKRSKLRLERS 184

Query: 141 VVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRS 200
            +C+ C+G G  KR    S C  C G G      RLGP   T  T  C  C G G  + S
Sbjct: 185 KLCSICKGDGGVKR----SMCNQCHGDGNITETTRLGPMLQTF-THTCNICNGNGWVIIS 239

Query: 201 EDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEADEEPGK---LTGDLVFDISED 257
           ++ C+ C+G     E K  +V I  G +   +IV   E DE   K   + G+++  I+E 
Sbjct: 240 QETCQGCNGVGFYNEMKIFDVEIYPGMKDGTQIVFNNEGDEIVNKRRVIPGNVIIHINE- 298

Query: 258 STTSNLERR---GSDLHT-KIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNY 313
               N  +R   G DL+     I L  +L G    +    + + +++ I  G++I  G+ 
Sbjct: 299 -IEDNKFKRVNDGQDLYYWNYEIDLFTSLCGGVIYIKGHPNNKLIKVDILPGEIIESGSV 357

Query: 314 ICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEALRNI 359
             +++ G P  ++G ++G +Y+Q  +++P      E+  +E+++ I
Sbjct: 358 KGVESLGMP-KNKGNEYGILYIQFQVKYP------EKLNMESIKAI 396

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  135 bits (341), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 109/374 (29%), Positives = 184/374 (49%), Gaps = 33/374 (8%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y  LGVA DA++ +IK AYR+++ + HPDK + +   +E+  KF E+  AYE+LS+ E
Sbjct: 19  DYYAILGVAKDASEKDIKSAYRQMSKKWHPDKNAGD---DEAHHKFIEIGEAYEVLSDSE 75

Query: 62  KRRNYDTYG---------DTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPR 112
           KR  YD +G            G+   +GG    D    F       +   ++ R  +   
Sbjct: 76  KRATYDRFGADALKNGGGGGGGHPGGFGGGGFHDPFDLFNQMFGDSHPGGQNVRKGSNLI 135

Query: 113 TDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQR 172
             D+     +T+   Y+G         N  C  C G+G        + C  C+G GV  +
Sbjct: 136 VKDS-----VTLNGFYHGFYANLTLDLNDDCEHCHGSGAEDN--QFATCETCQGRGVIIQ 188

Query: 173 LRRLGPGFVTRETVQ-CTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHND 231
           + ++G  F+T++  Q C  C+G GK ++   +CK C G RV    K   + +P G++ N 
Sbjct: 189 VIQMG--FMTQQIQQVCGACQGKGKTIKH--VCKICRGARVVKTPKTFEISVPAGAQRNY 244

Query: 232 RIVLEGEADEEPGKLTGDLVFDISEDSTTSNL--ERRGSDLHTKIIISLSDALT-GFEKE 288
            +V  G+A++ P   +GDLVF + E+++  NL   RRG  L+   ++   +AL  G+E+ 
Sbjct: 245 NVVKSGQAEKVPDMQSGDLVF-VFEENSHENLGYRRRGDHLYRTEVLHWKEALLGGWERR 303

Query: 289 VCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWP-LDDEGKK---FGNMYVQINIEFPPD 344
           +    D + + +K     V  PG    + N G P L+ +GK    +G+++++  I   P 
Sbjct: 304 IAFFDDQKQVVVKRDKNVVTAPGEIERVPNLGMPKLNSKGKSTNAYGDLFIEYVI-VSPK 362

Query: 345 HWYSERGEIEALRN 358
            + S +G  E +R+
Sbjct: 363 EFPSGKGSPEIIRD 376

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {ON}
           Anc_2.218
          Length = 530

 Score =  138 bits (347), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 128/448 (28%), Positives = 198/448 (44%), Gaps = 106/448 (23%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           Y  L V   AT  EIK AY++LAL++HPDK    +  EES++KF+E+  AYE+L +++K+
Sbjct: 15  YSILQVPTAATLFEIKNAYKKLALKYHPDK---NNHSEESKLKFQEICKAYEVLHDKDKK 71

Query: 64  RNYDTYGDTN--------GYSDSYGGFQD-----GD-FASFF------------------ 91
             YDTYG  +        G +D    F       GD FA FF                  
Sbjct: 72  LLYDTYGTLDESLIDKQRGNNDQKDDFDTTELSPGDLFAKFFDKSSRVNNNNYNSNSSPF 131

Query: 92  ---------GNFASGRYEDEEDFRAHARPRT-------------DDAHVSLRLTMQDLYN 129
                     N A  R+  +    A   P T             D  HV L  T+++LY 
Sbjct: 132 NNVPSTNTNTNSAGNRFMTQ----ALNSPSTTGTLFEKGLSRGPDIKHV-LNCTLKELYQ 186

Query: 130 GKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGFVTRETVQCT 189
           GK  +    R   C+ C G G      +   C  C+G G+    + LGP  V   +  C 
Sbjct: 187 GKKCKLGLNRTRSCHSCNGMG----GMNTIICNECQGKGINTETKMLGP-MVQSWSSTCF 241

Query: 190 KCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEADEE--PGKLT 247
            C G+G  + S+  CK+C G+    E     V +  G R+N +IVL+GEAD+    GKL 
Sbjct: 242 NCSGMGYFIDSQSGCKECQGEGYLRERTIFTVTVKPGMRNNQKIVLKGEADQVMLVGKLN 301

Query: 248 ------GDLVFDISE--------DSTTSNLERRGSDLHTKII-----------ISLSDAL 282
                 GD++  I++        DS     E +    H +II           I L  +L
Sbjct: 302 KEKVIPGDVIIVINQIEGKSWKNDSNIDQGENKNK-FHFEIINEKDLLLRNCQIDLITSL 360

Query: 283 TGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWP--LDDE---GKKF---GNMY 334
            G E  +     G+ ++L I   ++++P    C++N G P  ++DE   G+++   G++Y
Sbjct: 361 CGGEIYIKNHPSGKLIKLDIIPSEILKPDCLKCVENLGMPRYIEDETNNGEEYLPNGDLY 420

Query: 335 VQINIEFPPDHWYSERGEIEALRNIIPQ 362
           +Q  +++P      E   I+ LR+I+ +
Sbjct: 421 IQFKVKYPTK---LENETIDKLRSILSE 445

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {ON}
           Anc_8.730 YMR214W
          Length = 373

 Score =  134 bits (338), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 109/361 (30%), Positives = 179/361 (49%), Gaps = 24/361 (6%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y  LG+  DA+  EIK +YR+L+ + HPDK   +   EE+  KF E+  AYE+LS+ E
Sbjct: 21  DYYAILGLNKDASDKEIKSSYRQLSKKFHPDKNPGD---EEAHHKFIEIGEAYEVLSDPE 77

Query: 62  KRRNYDTYG-------DTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRTD 114
           KR+ +D YG          G     GGF D  F  F   F  G       F    RPR  
Sbjct: 78  KRKIFDQYGADALKNGGPGGPGGGGGGFND-PFDIFEQMFNRGGGGGGGGFGRMQRPRGH 136

Query: 115 DAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLR 174
           +  V  +L++++ Y G T+ F    N +C+ C+G G        + C+ C+G GV  ++ 
Sbjct: 137 NLKVREQLSLKEYYTGATLEFTLALNDICDHCDGTG--SADGKVAKCSDCQGRGVVIQVI 194

Query: 175 RLGPGFVTRETVQ-CTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRI 233
           R+G   +T++  Q C +C G G  +++   CK CHG +V  + K  +V +P G+  +   
Sbjct: 195 RMG--MMTQQIQQMCGRCGGKGSVIKNH--CKTCHGSKVVKKQKPFHVEVPPGAARHYTE 250

Query: 234 VLEGEADEEPGKLTGDLVFDISEDSTTSNL--ERRGSDLHTKIIISLSDALTG-FEKEVC 290
              GE+D+      GD+  + +E  TT+NL   RRG  L+   ++S  +AL G +++EV 
Sbjct: 251 TRSGESDKGADFDAGDVFIEFNE-KTTNNLGYRRRGPHLYRTEVLSAREALKGDWQREVE 309

Query: 291 TTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSER 350
              + + +++      V+  G    +   G P  +    FG+++++  +  P  H  S+ 
Sbjct: 310 FLDEKKKVKIARAKNVVVHNGEVERIPGFGMPQPNGKHAFGDLFIEYVVVMP--HEISKS 367

Query: 351 G 351
           G
Sbjct: 368 G 368

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {ON}
           Anc_8.730
          Length = 376

 Score =  134 bits (336), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 100/351 (28%), Positives = 173/351 (49%), Gaps = 20/351 (5%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y  L +  DAT  +I+ AYR+L+ ++HPDK  ++   E++  KF EV  AYE+LS+ E
Sbjct: 22  DYYKILELDKDATDKDIRSAYRQLSKKYHPDKNPND---EDAHHKFIEVGQAYEILSDPE 78

Query: 62  KRRNYDTYG-----DTNGYSDSYGGFQD--GDFASFFGNFASGRYEDEEDFRAHARPRTD 114
           KR+ YD +G       NG      GF D    F   FG            F+   R R  
Sbjct: 79  KRQRYDQFGPEGVNGQNGGGPGGAGFHDPFDIFEQMFGGGGGMGGHGGNPFQQQ-RQRGQ 137

Query: 115 DAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLR 174
           +       ++++ YNG  ++F    N +C+ C G+G       ++ C  C+G GV  ++ 
Sbjct: 138 NVVARESTSLKNYYNGYVLKFSINLNDICDHCHGSG--SNDGKSTKCPDCQGRGVTVQVI 195

Query: 175 RLGPGFVTRETVQ-CTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRI 233
           R+G   +T++  Q C KC G G+ +++   CK CHG +V  + K+  + +P G+      
Sbjct: 196 RMG--MMTQQIQQVCGKCGGKGQIIKNP--CKTCHGSKVVQKPKDFEIELPAGAPRKFVH 251

Query: 234 VLEGEADEEPGKLTGDLVFDISE-DSTTSNLERRGSDLHTKIIISLSDALT-GFEKEVCT 291
              G AD+ P   +GD+  + +E D       RRG  L+   +++ ++AL  G+E+++  
Sbjct: 252 AEHGAADKHPDYDSGDVYIEFTENDKDNMGYRRRGPHLYRTEVLNATEALYGGWERQLAF 311

Query: 292 TLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342
               + + +K    ++I+ G    +   G PL +  K FG++++   +  P
Sbjct: 312 LDSSKIVTIKREPNKIIQNGETERIAGFGMPLGNGRKGFGDLFIDYVVVMP 362

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214w SCJ1
          Length = 361

 Score =  132 bits (332), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 102/344 (29%), Positives = 174/344 (50%), Gaps = 16/344 (4%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y  LG++ DA+  EIK AYR+L+ ++HPDK   +   EE+  KF EV  AY++L + E
Sbjct: 20  DYYAILGLSKDASDKEIKSAYRQLSKKYHPDKNPGD---EEAHHKFIEVGEAYDILGDPE 76

Query: 62  KRRNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRTDDAHVSLR 121
           KR+ YD +G  + + +   G + G F   F  F          FR     R+ +  V  +
Sbjct: 77  KRKTYDVHG-ADAFKNGGQGQRGGGFHDPFDMFEQMFGRQGGGFRQTQ--RSQNYQVRNQ 133

Query: 122 LTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGFV 181
           +++++ Y+G  V F+   N +C+ C G+G          C  C+G GV  ++ R+GP   
Sbjct: 134 VSLKEFYSGGEVEFEIPLNDICDSCHGSG--SADGKVKVCPACQGRGVVVQVIRMGP--- 188

Query: 182 TRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEADE 241
             + +Q    +  GK    E+ CK C G +V  + K  +   P G   N      GE+D+
Sbjct: 189 ITQQIQQQCGQCGGKGKTIENPCKTCKGHKVVRKNKPFHFEFPGGIPRNHIDKKSGESDK 248

Query: 242 EPGKLTGDLVFDISEDSTTSNL--ERRGSDLHTKIIISLSDALT-GFEKEVCTTLDGRDL 298
            P   +GD++ + +E S   NL   RRG++L+   II+ ++A+  G+ +E+    + + +
Sbjct: 249 SPDMESGDIIIEYNE-SEKENLGYRRRGNNLYRTEIITANEAINGGWTREIEFLDEKKKV 307

Query: 299 RLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342
           +L  P G ++  G+   +K  G P+    K FG++Y+   +  P
Sbjct: 308 KLSRPKGSIVNNGDIERIKGFGMPIMGS-KNFGDLYIDYVVLVP 350

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score =  129 bits (325), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 100/366 (27%), Positives = 166/366 (45%), Gaps = 40/366 (10%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y  LG+  +A++  IK AYR+L+ ++HPDK  ++   EE+   F E+  AYE+LS+ E
Sbjct: 29  DYYKILGIPKEASEKAIKSAYRQLSKKYHPDKNQND---EEAHNHFIEIGEAYEVLSDPE 85

Query: 62  KRRNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHA------------ 109
           KRR YD +G     SD++     G           G ++  + F                
Sbjct: 86  KRRTYDQFG-----SDAFQNGGQGQGGPGGPGGPGGFHDPFDLFNQMFGGNKGNFGGFGG 140

Query: 110 ----------RPRTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHAS 159
                     R +     V+  L++++ + G  V FQ      C+ C+G+G         
Sbjct: 141 FGGGGFADDRRRKAQSIQVTYPLSLREYFTGANVNFQMDFKDTCDHCKGSG--SEDGKVD 198

Query: 160 ACTHCEGHGVKQRLRRLGPGFVTRET-VQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKN 218
            C  C G+G   ++ R+GP  VT++   QC KC G G  +++   CKKCHG+++  ++K 
Sbjct: 199 KCKECGGNGFVVQVIRMGP--VTQQMHTQCPKCHGAGSTIKNH--CKKCHGQKLVTKSKE 254

Query: 219 LNVYIPRGSRHNDRIVLEGEADEEPGKLTGDLVFDISEDSTTS-NLERRGSDLHTKIIIS 277
           +NV +P G+  +   ++E   D+E     GDL+    E +  +    RRG+DL     + 
Sbjct: 255 INVKVPAGAPRDFLKIVENGGDKELNAEAGDLLVQFQEIAQNNLGYRRRGNDLFRTEALV 314

Query: 278 LSDALTGFEKEVCTTLD-GRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQ 336
             DA+ G         D  RD+++    G  +       L   G P+     +FG++Y+ 
Sbjct: 315 FKDAMEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGMPIQGS-DRFGDLYID 373

Query: 337 INIEFP 342
             I  P
Sbjct: 374 YVIIVP 379

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218
          Length = 494

 Score =  131 bits (329), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 111/392 (28%), Positives = 186/392 (47%), Gaps = 62/392 (15%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           Y+TL V   AT  +IKKAY++LAL++HPDK    +  E+S+ KF+ V  AYE+L++++ R
Sbjct: 8   YETLNVPITATTLDIKKAYKKLALKYHPDK---NNHSEDSKTKFQAVCQAYEILNDKQSR 64

Query: 64  RNYDTYGDTN-------------------GYSDSYGGFQDGD-FASFFGNFASGRYEDEE 103
             YD  G T+                   G      G   GD FA FF N  +   +  +
Sbjct: 65  AIYDALGITDEALIEQQKKQQQQQHQQQGGMEFPPMGMSPGDLFAQFFDNNNNAAKQPSQ 124

Query: 104 DFRAHARPR-TDDAHVS-----------------LRLTMQDLYNGKTVRFQSTRNVVCNR 145
             + HA P    ++HV+                 L+ T+++LYNGK  +    R  +C  
Sbjct: 125 S-QMHAYPNFKSESHVTNGKADHPLHRGPDIKHVLKCTLRELYNGKMAKLALNRTRLCLP 183

Query: 146 CEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCK 205
           C G G  +R    + C  C+G G + + RR+GP  V   T  C  C G G  ++  D+C 
Sbjct: 184 CNGFGGLQR----TTCESCQGDGFQTQTRRMGP-MVQTWTQTCASCDGAGCFIKPNDVCP 238

Query: 206 KCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEADE-------EPGKLTGDLVFDISEDS 258
            CHG+    E K  +V +  G +    ++++GEADE       +   + GD+V  I +  
Sbjct: 239 HCHGEGFIRERKIFHVEVKPGFQDGKDVIMQGEADEIMLNNLVKEKVIPGDVVITIKQSR 298

Query: 259 TTSNLERRGSD---LHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYIC 315
             +N  +  ++   L     + L  +L G E  +     G+ ++L I  G++++P  +  
Sbjct: 299 DENNCFQMINNKDLLMNGCPVDLVTSLCGGEVYIDNHPSGKLIKLDIIPGEILKPNCFKI 358

Query: 316 LKNEGWPLDDEGK-----KFGNMYVQINIEFP 342
           ++  G P  ++GK     + G++Y+Q  I++P
Sbjct: 359 IEGLGMPYLEDGKDDTMLRRGDLYIQFKIQYP 390

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
           (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score =  129 bits (323), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 102/355 (28%), Positives = 165/355 (46%), Gaps = 30/355 (8%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y  LG++ +  + EIK AYR+L+ + HPDK  ++   E++  KF E+  AYE+LS+ E
Sbjct: 23  DYYKILGLSKNCNEKEIKSAYRQLSKKFHPDKNPND---EDAHNKFIEIGEAYEVLSDPE 79

Query: 62  KRRNYDTYG----------------DTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDF 105
           KRR YD +G                   G+ D +  F+        G F           
Sbjct: 80  KRRMYDQFGADAVKNGGPGGPGGPGGPGGFHDPFDLFEQMFGGGHGGGFGGFGGFGGFGG 139

Query: 106 RAHARPRTDDAHVSLR--LTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTH 163
               + +     + +R  LT++D YNG ++ F    N  C+ C G+G          C  
Sbjct: 140 GQQHQGKQRGQSIKVRHALTLKDYYNGGSISFSLLLNDNCDHCHGSG--SEDGKVKKCPD 197

Query: 164 CEGHGVKQRLRRLGPGFVTRETVQ-CTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVY 222
           C G GV  ++ R+G   VT++  Q C +C G G+ ++++  CK C G +V  + K+++V 
Sbjct: 198 CGGRGVVIQVIRMG--IVTQQVQQRCNRCAGSGEIIQNK--CKVCSGAKVQKKEKDISVS 253

Query: 223 IPRGSRHNDRIVLEGEADEEPGKLTGDLVFDISE-DSTTSNLERRGSDLHTKIIISLSDA 281
              G   N   V +GEA++ PG   GDL+ +  E         RRG DL    +++L +A
Sbjct: 254 FDSGIERNHISVQQGEAEKGPGIEPGDLIVEFFEVPEANMGYRRRGKDLFRTEVLTLQEA 313

Query: 282 LTGFEKEVCTTLD-GRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYV 335
           + G        LD  + L+LK     ++  G    +   G P+     KFG++Y+
Sbjct: 314 INGDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFGMPILGSKGKFGDLYI 368

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
           YFL016C
          Length = 500

 Score =  130 bits (327), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 126/416 (30%), Positives = 189/416 (45%), Gaps = 75/416 (18%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           DPY  LGV   A+Q EIKKAY +LA Q+HPD ++ E+    +E KF ++  AYE+LS+E 
Sbjct: 35  DPYGVLGVKSSASQGEIKKAYYKLAKQYHPD-INKEA---GAEKKFHDLQNAYEILSDES 90

Query: 62  KRRNYD-----TYGDTNGYSDSYGGFQDGD----FASF-------FGNFASGRYED---- 101
           KR+ +D      +G   G      G+  G     FAS+       FG+F    +ED    
Sbjct: 91  KRKQFDQFGPAAFGAGAGAGGPGSGYPQGQGFNPFASYTSSSSSPFGDFGGINFEDLFGA 150

Query: 102 ------------------------EEDFRAHARPRTDDAHVSLRLTMQDLYNGKT-VRFQ 136
                                      +R +   + D  HVS  ++ +D   GK+ V+ +
Sbjct: 151 AFSGSGGAGGAKAGGAGASRNPFSSSGYRQY---KGDSVHVSYNMSFKDAVFGKSGVKLK 207

Query: 137 STRNVVCNRCEGAGIRKRA-RHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLG 195
                 C+ C G+GI+K A RH   C  C+G G K  +R    GF    T  C +C+G G
Sbjct: 208 FNVFDPCDTCSGSGIKKGASRHQ--CPGCQGSGTKIHVRG---GFQMMST--CNECQGEG 260

Query: 196 KNLRSEDLCKKCHGKRV-TPETKNLNVYIPRGSRHNDRIVLEG-----EADEEPG----- 244
             + S DLC  CHG+ V     K + V +P G +  D I + G     E   +P      
Sbjct: 261 TTVNSSDLCGACHGEGVHFHRGKEITVDLPHGLQDGDVIRIPGQGSYPEVALDPSLAGSV 320

Query: 245 KLT-GDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIP 303
           KLT GD++ ++  +   +   R  SD+   + I ++ A  G   +V  T+DG  +RLK+ 
Sbjct: 321 KLTRGDVLVNVRVEEDPTFTIRDKSDIWYTMEIPITTAALGGTVQV-PTVDGSHIRLKVA 379

Query: 304 TGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEALRNI 359
            G   + G+ I + N G P  +  +  G M VQ  I         E+   EAL ++
Sbjct: 380 PG--TQSGDVITVPNMGVPRSNLTRSRGAMKVQYRIVIKKPSSEVEKCLWEALADV 433

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score =  129 bits (323), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 119/398 (29%), Positives = 181/398 (45%), Gaps = 53/398 (13%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           DPY TLGV+ DA+  +IK+AY +LA ++HPD ++ E   +++   F  +  AYE+LS+E+
Sbjct: 48  DPYKTLGVSRDASPSDIKRAYYKLAKKYHPD-INKEPGADKT---FHNLQNAYEILSDEK 103

Query: 62  KRRNYDTYG----DTNGYSDSYGGFQ---DGDFASFFGNFASGRYED---EEDFRAHARP 111
           K+  YD YG    D NG ++  GGF     G  AS F +F    +ED       R+  R 
Sbjct: 104 KKLQYDQYGSSAFDQNGNANGAGGFNPFGGGASASGFADFGGLNFEDLFGAAFGRSGFRN 163

Query: 112 RTDDAHVSLRLTMQDLYNGKTVRFQ---STRNVV---------------CNRCEGAGIRK 153
             D    + R  +   Y G ++  Q   S ++ V               C  C G+G++ 
Sbjct: 164 GGDAGGFNGRANIVREYQGDSIEIQHVVSFKDAVFGLNNVSLKYKSLDPCGTCHGSGLKN 223

Query: 154 RARHA-SACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRV 212
             +H    C++C G G +  ++    GF    T  C  C G G  +  ED C  C G  V
Sbjct: 224 GEQHKRKTCSYCNGTGTQVHVK---SGFQMAST--CMHCHGEGTTIAREDTCSACDGDGV 278

Query: 213 TPET-KNLNVYIPRGSRHNDRIVLEGEA---------DEEPGKLT-GDLVFDISEDSTTS 261
              + K+LNV  P G    D I + GE          +++  KL+ GDL+  I   S   
Sbjct: 279 KINSKKSLNVNFPSGLSDGDVIRIPGEGSYPNIAVGENDKSIKLSRGDLLVRIRVKSDPK 338

Query: 262 NLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGW 321
              +   D+ T   I ++ A  G   E+  T+DG+++RLK+ +G   +      + N G 
Sbjct: 339 FFVKNKYDIWTIKEIPITTAALGGTVEI-ETVDGKNIRLKVISG--TQHDQVTSIPNMGI 395

Query: 322 PLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEALRNI 359
           P  + G   GNM VQ  I         ER   E L ++
Sbjct: 396 PYRN-GTGRGNMNVQYKIVIKKPQSNIERCLWEGLADV 432

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} similar
           to uniprot|P25303 Saccharomyces cerevisiae YMR214W SCJ1
           dnaJ homolog
          Length = 375

 Score =  125 bits (313), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 108/359 (30%), Positives = 172/359 (47%), Gaps = 37/359 (10%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNE- 60
           D Y  LGV+ DA++ EIK AYR+L+ ++HPDK   +   E +  KF EV  AYE+LS++ 
Sbjct: 24  DYYAILGVSKDASEKEIKSAYRQLSKKYHPDKNPGD---ETAHHKFIEVGEAYEVLSDDQ 80

Query: 61  ----------EKRRNYDTYGDTNGYSDSYGGFQDGD----FASFFGNFASGRYEDEEDFR 106
                     E  +N    G          G    D    F   FG  A          R
Sbjct: 81  KRQIYNQYGAEALKNGGPGGSGGPGGPGGFGGGFHDPMDIFEQMFG--AQRGGGGRGRPR 138

Query: 107 AHARPRTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEG 166
            H     ++      +T+++ Y G ++ F    N  C+ C+G G   +    + C+ C+G
Sbjct: 139 GHNLEAREE------ITLKEYYQGTSLDFTLNLNDFCDNCKGTG--SQDGKTTRCSDCQG 190

Query: 167 HGVKQRLRRLGPGFVTRETVQ-CTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPR 225
            GV  ++ R+GP  +T++  Q C  C+G G+ ++++  CK+CHG +V  +TK+ +V +P 
Sbjct: 191 QGVVIQIIRMGP--ITQQIQQMCGACQGKGQIIKNK--CKQCHGAKVERKTKHFHVDVPA 246

Query: 226 GSRHNDRIVLEGEADEEPGKLTGDLVFDISEDSTTS-NLERRGSDLHTKIIISLSDALTG 284
           G+  +   V  GEAD+ P    GD+    SE S  +    RRG  LH   +++L +AL G
Sbjct: 247 GAPRDFVDVKNGEADKGPDFDAGDVYIKFSESSRDNMGYRRRGVHLHRTEVLTLKEALQG 306

Query: 285 FEKEVCTTLD-GRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342
             K     LD  + ++L    G  +R G    +   G P D  G+ FG+++V   +  P
Sbjct: 307 GWKREIEFLDHTKKVKLHRDAGVPVRHGETERVPGFGMPKD--GRHFGDLFVDYVVLTP 363

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {ON}
           Anc_8.730 YMR214W
          Length = 384

 Score =  117 bits (292), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 100/362 (27%), Positives = 168/362 (46%), Gaps = 32/362 (8%)

Query: 2   DPYDTLGVAPD-ATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNE 60
           D Y  LG+  +   + EIK AYR+L+ ++HPDK  ++   ++++  F +V  AY++L + 
Sbjct: 24  DYYKILGINKNYKYEKEIKSAYRKLSKKYHPDKNKND---KDAQQNFIKVGEAYDVLGDP 80

Query: 61  EKRRNYDTYGDTNGYSDS----------YGGFQDGDFASFFGNFASGRYEDEEDFRAHAR 110
           +K+R YD  G     +++             F D  F  F   F  G       F  +  
Sbjct: 81  DKKRQYDQMGHDAFVNNAQHGGPEGGPGGQPFHD-PFDMFEKMFHGGGPGGGNPFGGNPF 139

Query: 111 PRTD------DAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHC 164
                        V  +L+++  Y G   +F    +  C+ C G G          C  C
Sbjct: 140 GGGGGQRRGPSLKVEQQLSLKQYYQGFDFQFALNLHDDCDHCHGTG--SEDGKTKVCPDC 197

Query: 165 EGHGVKQRLRRLGPGFVTRETVQ-CTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYI 223
           +G G+  ++ R+G   +T++  Q C +CRG G  ++  + CK C+G +V  + K+  VY+
Sbjct: 198 KGSGIIIQIIRMG--MMTQQIQQPCGRCRGQGHLIK--NFCKVCNGAKVQQKLKDFKVYV 253

Query: 224 PRGSRHNDRIVLEGEADEEPGKLTGDLVFDISEDSTTSNL--ERRGSDLHTKIIISLSDA 281
           P GS  N   V  G+A++ P    GD++ + +E     NL   RRG++L     ISL++A
Sbjct: 254 PPGSPRNHVEVKAGQAEKNPNYEPGDVIIEFNE-LPLDNLGYRRRGNNLFRTEYISLNEA 312

Query: 282 LTGFEKEVCTTLDGRD-LRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIE 340
           L G  +     LD +  + LK      I  G    LK  G P+ ++  KFG++Y+   + 
Sbjct: 313 LYGNWERTLDFLDPKKRINLKRSPNVTIYDGEIEILKGFGMPIPNKKNKFGDLYIDYKVI 372

Query: 341 FP 342
            P
Sbjct: 373 IP 374

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score =  114 bits (285), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 105/347 (30%), Positives = 158/347 (45%), Gaps = 17/347 (4%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y  LGV  +AT+ +IK AYR+L+ ++HPDK   ++    +   F EV  AYE LS+ E
Sbjct: 21  DYYAILGVDREATEKDIKSAYRQLSKKYHPDKNPGDTTAHHN---FIEVGEAYEALSDPE 77

Query: 62  KRRNYDTYGDTNGYSDSYGGFQDGDFASFFGNFAS-GRYEDEEDFRAHARPRTDDAHVSL 120
           KRR YD YG     +        G F   F  F                R R+    V  
Sbjct: 78  KRRIYDQYGAEALKNGGGAEGGHGGFHDPFDIFEQMFGGGARFGGGQRRRQRSQSLQVQE 137

Query: 121 RLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGF 180
            LT++  Y+G  V F  + N  C+ C   G   +      CT C   GV  ++ R   GF
Sbjct: 138 ELTLRQYYHGTAVEFTLSLNDHCDHCGATG--SQDGKVERCTQCSVRGVIVQVGR--QGF 193

Query: 181 VTRETVQ-CTKCRG-LGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGE 238
           +T++  Q C +  G   K L  +  CK C G +   + K+  V +P G+  +   V +GE
Sbjct: 194 MTQQFQQVCPRLLGPWPKALPKK--CKVCQGHKAIKKNKSFRVEVPPGAPRDFVAVQQGE 251

Query: 239 ADEEPGKLTGDLVFDISEDSTTSNL--ERRGSDLHTKIIISLSDALTGFEKEVCTTLD-G 295
           A++ P    GD+   + E+ T  N+   R+G++L    ++SL +AL G  K     LD  
Sbjct: 252 AEKVPDMDPGDIYVKVFEN-TRDNMGYRRQGANLFRTEVLSLKEALHGDWKRELEFLDPS 310

Query: 296 RDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342
           + +      GQ ++ G    +   G PL D    FG++YV   +  P
Sbjct: 311 KKVPFSRKKGQTVQHGEVERVPGFGMPLPDSA-GFGDLYVDYVVILP 356

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
           (REAL)
          Length = 533

 Score =  109 bits (273), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/293 (26%), Positives = 135/293 (46%), Gaps = 30/293 (10%)

Query: 70  GDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRA----HARPRTDDAHVSLRLTMQ 125
           G  N ++ S+ G    +F    G+  +  Y     +      H   R  D   +L+ T++
Sbjct: 136 GAKNSFNFSFNGSSTPNFPFGNGSGMNSLYSPSSKYNTTGEEHHLNRGPDIKHNLKCTLK 195

Query: 126 DLYNGKTVRFQSTRNVVCNRCEG-AGIRKRARHASACTHCEGHGVKQRLRRLGPGFVTRE 184
           +LY GKT +    R  +C+ C+G  G+RK       C  C+G G++ + +R+GP  V   
Sbjct: 196 ELYMGKTAKLGLNRTRICHVCDGHGGLRKYT-----CKPCKGQGIQTQTKRMGP-LVQSW 249

Query: 185 TVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEADEEPG 244
           +  C  C G G  ++++D+C++C G     + K L V +  GS HN  IVL GE DE   
Sbjct: 250 SQTCADCGGAGTFVKNKDICEQCQGLGFIKQRKILQVTVQPGSCHNQLIVLTGEGDEVIS 309

Query: 245 K--------LTGDLVFDI-----SEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCT 291
                    + GD+V  I      +   T N +         ++ SL   +   E     
Sbjct: 310 TKGGGREKVIPGDVVITILRLKDPKFQITDNCDLICKKCEVDLMTSLCGGIVYIEGHP-- 367

Query: 292 TLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKK--FGNMYVQINIEFP 342
              G+ +++ I  G+V++PG +  ++N G P    G +  FG++YV+ ++ +P
Sbjct: 368 --SGKLIKIDIIPGEVLKPGCFKTVENMGMPKFINGVRSGFGHLYVKFDVTYP 418

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 45/70 (64%), Gaps = 3/70 (4%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD+L V   A+  EIKKAYR  AL++HPDK    +  EES+ KF+E+  AYE+L +   R
Sbjct: 8  YDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEVLKDNHLR 64

Query: 64 RNYDTYGDTN 73
            YD YG T+
Sbjct: 65 SLYDQYGTTD 74

>KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {ON}
           Anc_8.61 YFL016C
          Length = 498

 Score =  105 bits (261), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 110/402 (27%), Positives = 178/402 (44%), Gaps = 55/402 (13%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           DPY TLG+  +A+Q +IKKAY +LA ++HPD ++ E   E +E KF ++  AYE+LS+E+
Sbjct: 47  DPYKTLGINSNASQSDIKKAYYKLAKKYHPD-INKE---ENAEAKFHDLQNAYEILSDEQ 102

Query: 62  KRRNYDTYG--------DTNGYSDSYGG--FQDGDFASFFGNFASGRYED--EEDFRAHA 109
           KR+ YD +G        +T+G S+ +    F  G   + F +F    +ED     F+   
Sbjct: 103 KRKQYDQFGPSAFDPNINTSGNSNPFTSDPFGFGTTNNPFSDFGGINFEDLFGNAFKQQH 162

Query: 110 RP-------------RTDDAHVSLRLTMQD-LYNGKTVRFQSTRNVVCNRCEGAGIRKRA 155
                          + D  H++  L  +D ++  K V+        CN C G+G++  A
Sbjct: 163 SNNTSNSNRNFFREFKGDTIHLNYNLNFKDSVFGKKNVKLNFNSFDPCNTCNGSGLKHNA 222

Query: 156 RHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVT-P 214
            H S C  C G G +  +R    GF    T  C  C G G  +   D C  CHG  V   
Sbjct: 223 -HKSTCQTCNGTGTRVHIRG---GFQMMST--CNDCNGEGTKIDPNDYCNHCHGDGVEFK 276

Query: 215 ETKNLNVYIPRGSRHNDRIVLEGEA------------DEEPGKLT-GDLVFDISEDSTTS 261
             K + V +P   +  D I +  +             +    ++T GD++  I+  + T 
Sbjct: 277 RNKEITVDLPNALQDGDVIRVSNKGSYPQMAMDPDLINNNNVRMTRGDILIKINVINDTK 336

Query: 262 NLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTG----QVIRPGNYICLK 317
              R   D+   + I ++ A  G    +  ++DG ++RL++  G    Q+I   N    +
Sbjct: 337 FKIRDKYDIWYTMEIPITTAALGGIVTI-PSIDGTNVRLRVSPGTQNDQIISIPNMGVPR 395

Query: 318 NEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEALRNI 359
           +  +         GNM VQ  I        +E+   EAL +I
Sbjct: 396 SNIFSRSTNTTNRGNMKVQYKIIIKKPQSQAEKCLWEALADI 437

>NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {ON}
           Anc_8.61
          Length = 552

 Score =  105 bits (261), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 112/410 (27%), Positives = 178/410 (43%), Gaps = 66/410 (16%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           DPY  LGV   A+  EIKKAY +LA ++HPD     + + ++E KF ++  AYE+LS+E 
Sbjct: 79  DPYSVLGVNNSASTSEIKKAYYKLAKKYHPDI----NKQPDAEKKFHDLQNAYEILSDEN 134

Query: 62  KRRNYDTYGDT----------------------------------NGYSDSYGGFQDGDF 87
           KR+ YDT+G +                                  N ++D    F+D  F
Sbjct: 135 KRKQYDTFGPSAFQDAQQGGAGGPGGGPGGFPGGYPFGQTSSGSGNPFADFGINFEDL-F 193

Query: 88  ASFFGN--FASGRYEDEEDFRAHARPRTDDAHVSLRLTMQD-LYNGKTVRFQSTRNVVCN 144
            + FGN   A+G          +   + D   +   L  +D ++  + V  +      CN
Sbjct: 194 GAAFGNGPHATGGGRARRQSNIYREFKGDPIEIVHNLNFKDAVFGVQNVNLKFNSMDPCN 253

Query: 145 RCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLC 204
           +C G+G+ + A+  + C  C G G K  +R    GF    T  C  C G G  + S+D+C
Sbjct: 254 KCSGSGLNRNAKR-TTCPSCHGSGQKVHIRS---GFQMVST--CNHCHGEGTIIDSKDIC 307

Query: 205 KKCHGKRV-TPETKNLNVYIPRGSRHNDRIVLEGE-------ADEEPGKLT------GDL 250
             CHG  V     K+++V +P G +  D I + G+       A  +P  +       GDL
Sbjct: 308 SSCHGDGVELNHNKSIDVNLPNGLQDGDVIRVPGQGNYPQTGASIDPAMMNSIKLSRGDL 367

Query: 251 VFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRP 310
           +  +  +   +   R   D+     I ++ A+ G   ++  T+DG  +RLK+  G   + 
Sbjct: 368 LVRVRVNKDPNFSIRDKYDIWFTKQIPITTAILGGVVKI-PTVDGTQIRLKVSPG--TKH 424

Query: 311 GNYICLKNEGWPLDDEGK-KFGNMYVQINIEFPPDHWYSERGEIEALRNI 359
              I + N G P     K   GNM VQ  I        +E+   EAL ++
Sbjct: 425 DQIISIPNLGVPRSSINKDNRGNMKVQYKIIMKTPQSQAEKCLWEALADV 474

>TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {ON}
           Anc_8.61 YFL016C
          Length = 510

 Score =  104 bits (260), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 113/412 (27%), Positives = 172/412 (41%), Gaps = 67/412 (16%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           DPY  LG+  DA   EIKKAY +LA ++HPD   D+     S+ KF ++  AYE+LS+E+
Sbjct: 47  DPYKVLGLNKDAKASEIKKAYYKLAKKYHPDINKDKG----SDKKFHDITNAYEILSDEK 102

Query: 62  KRRNYDTYGD-----------------------TNGYSDSYG---GFQDGDFASFFGNFA 95
           K+  YD +G                         N ++++ G   GF   +F   FG   
Sbjct: 103 KKMQYDQFGSAAFDNSQGGGSGGFSGGNPFAGGANPFANAGGNPFGFGGINFEDLFGAAF 162

Query: 96  SGRYEDEEDFRA--------------HARPRTDDAHVSLRLTMQD-LYNGKTVRFQSTRN 140
           S                         ++  R D+  V   L+ +D ++  + V    +  
Sbjct: 163 SKANGAAGRGGGRSSGRGNGSPFGGFYSEVRGDNVEVIHTLSFKDAVFGSRNVTLNVSSI 222

Query: 141 VVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRS 200
             C  C G+G+ K   H S C+ C G G    +R    GF    T  C  C G G+N+  
Sbjct: 223 EQCKTCTGSGM-KPGSHRSECSSCHGTGTTVHVR---AGFQMAST--CMSCGGTGENIAR 276

Query: 201 EDLCKKCHGKRVTPE--TKNLNVYIPRGSRHNDRIVLEGEA----------DEEPGKLT- 247
           ED+C+ C G+   P    + + V +P G    D I + G+             +  K+T 
Sbjct: 277 EDVCRNCDGEGTEPRPVQRTVQVELPPGLVDGDVIRVAGQGGYPNIAIAPEQRDQVKVTR 336

Query: 248 GDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQV 307
           GDL+  I          R G++L     I ++ A+ G    V  TLDG  LRL++ +G  
Sbjct: 337 GDLLVRIRVKQDKVFSIRNGNELWQTREIPVTTAVLG-GNVVIPTLDGNQLRLRVRSG-- 393

Query: 308 IRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEALRNI 359
            R G  + +  +G P    G   G+M VQ  +         ER   EAL ++
Sbjct: 394 TRDGETVSVPGQGVPRGRGGLSRGDMKVQWRVPVRTPKTAVERCLWEALADV 445

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR214W
           (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 112/224 (50%), Gaps = 10/224 (4%)

Query: 122 LTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGFV 181
           LT++  Y G ++ F    N  C  C G+G   +    + C+ C G GV  ++ R+GP  +
Sbjct: 147 LTLKQYYQGTSLDFTLNLNDFCENCHGSG--SQDGKTTHCSECRGQGVVIQVVRMGP--L 202

Query: 182 TRETVQ-CTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEAD 240
           T++  Q C  C+G G+ ++++  CK+CHG +V  + K+ +V +P G+  +   V  GEAD
Sbjct: 203 TQKIQQMCGACQGKGQVIKNK--CKRCHGAKVERKAKHFHVDVPAGAPRDFVDVKAGEAD 260

Query: 241 EEPGKLTGDLVFDISEDS-TTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLD-GRDL 298
           + P   +GD+    SE S       RRG  L+   ++SL +AL G  K      D  + L
Sbjct: 261 KGPDFDSGDVFIKFSESSRDNMGYRRRGPHLYRTEVLSLKEALLGGWKREIEFFDPNKKL 320

Query: 299 RLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342
           +L+   G  +R G    +   G P    GK  G+++V   +  P
Sbjct: 321 KLQRGQGVPVRNGEIERVPGFGMPTGGHGKH-GDLFVDYVVVIP 363

>ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {ON}
           similar to uniprot|Q752R6 Ashbya gossypii AFR507W
           AFR507Wp and some similarites with YFL016C
           uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 462

 Score = 96.7 bits (239), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 116/399 (29%), Positives = 173/399 (43%), Gaps = 59/399 (14%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           DPYDTLGV   A+  EIKKAY +LA ++HPD   ++   +    KF ++  AYE+LS+ +
Sbjct: 33  DPYDTLGVGKSASPSEIKKAYYKLAKKYHPDINKEQGAGD----KFHDLQNAYEILSDAD 88

Query: 62  KRRNYD------TYGDTNGYSDSYGGFQDGDFASF--FGNFASGRYED------------ 101
           K+  YD            G      G   G F+ F  FGNF    +ED            
Sbjct: 89  KKSQYDQFGAAAFGQGGAGGGPGGPGAGYGGFSDFSGFGNFGGINFEDLFGAAFGGGGGR 148

Query: 102 --------EEDFRAHARPRTDDAHVSLRLTMQD-LYNGKTVRFQSTRNVVCNRCEGAGIR 152
                      FR +   R D   VS R+  +D ++  K V  +      C+ C+G+G++
Sbjct: 149 SSRGSPFGSSMFREY---RGDPIEVSYRMPFKDAVFGAKDVNLKFRALDPCHTCDGSGMK 205

Query: 153 KRARHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRV 212
             A+  S C  C G G    +R    GF    T  C +C G G   + EDLC  CHG  V
Sbjct: 206 TGAKPQS-CPSCHGTGTTVHVR---AGFQMATT--CQQCGGEGTTTKREDLCGSCHGDGV 259

Query: 213 -TPETKNLNVYIPRGSRHNDRIVLEGEAD----EEPGKLT-------GDLVFDISEDSTT 260
              + K++ V +P+G +  D + + G+        P ++        GD++  I  D   
Sbjct: 260 EWTKDKSVRVDLPQGLQDGDVVRVPGQGSYPNMAVPPEMKSSIRLRRGDVLVRIRVDKDP 319

Query: 261 SNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEG 320
               R   D+     I ++ A  G   +V  T+DG  +RL++  G   +    I + N G
Sbjct: 320 RFSIRDKWDIWFIQDIPITTAALGGTVQV-PTVDGSHVRLRVQPG--TQHDQIISIPNMG 376

Query: 321 WPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEALRNI 359
            P     +  G+M VQ  I+       +ER   EAL NI
Sbjct: 377 VPRVAGTR--GSMKVQYKIQVKKPQSKAERCLWEALANI 413

>NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {ON}
           Anc_8.61
          Length = 519

 Score = 95.5 bits (236), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 118/409 (28%), Positives = 169/409 (41%), Gaps = 68/409 (16%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           DPY  LG+   AT  EIKKAY +LA ++HPD ++ E   E+   KF ++  AYE+LS+E 
Sbjct: 51  DPYKVLGINKSATSSEIKKAYYKLAKKYHPD-INKEPTAEK---KFHDLQNAYEILSDET 106

Query: 62  KRRNYDTYGDTNGYSDSYGGFQDGD-----------------FASFFGNFA--------- 95
           K+  YDT+G      D  GG    +                 F  F  NF          
Sbjct: 107 KKSQYDTFGSAAFNQDGSGGASSANNPFAGGFSSSGGPGGNPFTDFGINFEDLFGAAFGG 166

Query: 96  ----------SGRYEDEEDFRAHARPRTDDAHVSLRLTMQDLYNG-KTVRFQSTRNVVCN 144
                     SG       +R     + D   ++ R+  +D   G   V  +      C+
Sbjct: 167 GAGTGPGGARSGGARRSNMYREF---KGDPLEITHRIPFKDAVFGLANVSLKYNVMDPCH 223

Query: 145 RCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLC 204
            C G+GI++ A+    C  C G G K  +R    GF    T  C +C G G  L + D C
Sbjct: 224 TCHGSGIKQGAQ-KHQCPSCHGSGQKVHIRS---GFQMVST--CNECHGEGTILNASDYC 277

Query: 205 KKCHGKRVT-PETKNLNVYIPRGSRHNDRIVLEGEAD----------EEPGKLT-GDLVF 252
             CHG  V      ++NV +P G +  D I + G+ +          +   KLT GD++ 
Sbjct: 278 GTCHGDAVEFTRDHSINVNLPNGLQDGDVIRIPGQGNYPQMALDPELKNSVKLTRGDVLV 337

Query: 253 DISEDSTTSNLERRGSDL-HTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPG 311
            I  D       +   D+  TK I   + AL G       T+DG  LRLK+  G   +  
Sbjct: 338 RIRVDKDNRFSIKDKYDIWFTKDIPITTAALGGI--VTIPTVDGTTLRLKVQAG--TQHD 393

Query: 312 NYICLKNEGWPLDDEGKKF-GNMYVQINIEFPPDHWYSERGEIEALRNI 359
             I + N G P     K+  GNM VQ  I        +E+   EAL ++
Sbjct: 394 QVISIPNLGVPRSSINKENRGNMKVQYRIVIRKPQSQAEKCLWEALADV 442

>Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}
           YFL016C (REAL)
          Length = 510

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 107/401 (26%), Positives = 177/401 (44%), Gaps = 58/401 (14%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           DPYDTLG+   AT  EIKKAY +LA ++HPD ++ E    ++E KF ++  AYE+LS+E 
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPD-INKEV---DAEKKFHDLQNAYEILSDEN 116

Query: 62  KRRNYD-------------------------TYGDTNGYSDS----YGGFQDGD-FASFF 91
           KR+ YD                          + D +G++++    +GG    D F + F
Sbjct: 117 KRQQYDQFGPAAFGGGGAAGGPGSGGSPFGSQFHDFSGFTNAGGSPFGGINFEDLFGAAF 176

Query: 92  GNFASGRYEDEEDFRAHARPRTDDAHVSLRLTMQD-LYNGKTVRFQSTRNVVCNRCEGAG 150
           G                 + R D   +  +++ +D ++    V+ + +    C+ C G G
Sbjct: 177 GGAGRSSGGGPRSSSMFRQYRGDPIEIVHKVSFKDAVFGSNNVQLKFSALDPCSTCSGTG 236

Query: 151 IRKRARHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGK 210
           ++    H   C+ C G G    +R    GF    T  C  C G G   R +D C KCHG+
Sbjct: 237 MKPNT-HKVNCSTCHGTGTTVHIR---GGFQMMST--CPTCNGEGTMKRPQDSCTKCHGE 290

Query: 211 RV-TPETKNLNVYIPRGSRHNDRIVLEG---------EAD-EEPGKLT-GDLVFDISEDS 258
            V     K + V +P G +  D + + G         EAD ++  KL+ GD++  I  D 
Sbjct: 291 GVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDTVKLSRGDILVRIRVDK 350

Query: 259 TTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKN 318
             +   +   D+     I ++ A  G    +  T++G+ +R+K+  G   +    I + N
Sbjct: 351 DPNFSIKNKYDIWYDKEIPITTAALGGTVTI-PTVEGQKIRIKVAPG--TQYNQVISIPN 407

Query: 319 EGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEALRNI 359
            G P     +  G+M +Q  I        +E+   EAL ++
Sbjct: 408 MGVPKTTTIR--GDMKIQYKIVVKKPQSLAEKCLWEALADV 446

>YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}
           MDJ1Co-chaperone that stimulates the ATPase activity of
           the HSP70 protein Ssc1p; involved in protein
           folding/refolding in the mitochodrial matrix; required
           for proteolysis of misfolded proteins; member of the
           HSP40 (DnaJ) family of chaperones
          Length = 511

 Score = 89.7 bits (221), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 107/402 (26%), Positives = 175/402 (43%), Gaps = 59/402 (14%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           DPYDTLG+   AT  EIKKAY +LA ++HPD ++ E    ++E KF ++  AYE+LS+E 
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPD-INKEP---DAEKKFHDLQNAYEILSDET 116

Query: 62  KRRNYDT--------------------------YGDTNGYSDS----YGGFQDGDFASFF 91
           KR+ YD                           + D +G++ +    +GG    D     
Sbjct: 117 KRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQFHDFSGFTSAGGSPFGGINFEDLFGAA 176

Query: 92  GNFASGRYEDEEDFRAHARP-RTDDAHVSLRLTMQD-LYNGKTVRFQSTRNVVCNRCEGA 149
                          +  R  R D   +  +++ +D ++  K V+ + +    C+ C G 
Sbjct: 177 FGGGGRGSGGASRSSSMFRQYRGDPIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGT 236

Query: 150 GIRKRARHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHG 209
           G++    H  +C+ C G G    +R    GF    T  C  C G G   R +D C KCHG
Sbjct: 237 GMKPNT-HKVSCSTCHGTGTTVHIRG---GFQMMST--CPTCNGEGTMKRPQDNCTKCHG 290

Query: 210 KRV-TPETKNLNVYIPRGSRHNDRIVLEG---------EAD-EEPGKLT-GDLVFDISED 257
           + V     K + V +P G +  D + + G         EAD ++  KL+ GD++  I  D
Sbjct: 291 EGVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD 350

Query: 258 STTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLK 317
              +   +   D+     I ++ A  G    +  T++G+ +R+K+  G   +    I + 
Sbjct: 351 KDPNFSIKNKYDIWYDKEIPITTAALGGTVTI-PTVEGQKIRIKVAPG--TQYNQVISIP 407

Query: 318 NEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEALRNI 359
           N G P     +  G+M VQ  I        +E+   EAL ++
Sbjct: 408 NMGVPKTSTIR--GDMKVQYKIVVKKPQSLAEKCLWEALADV 447

>Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON}
           YFL016C (REAL)
          Length = 507

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 112/406 (27%), Positives = 180/406 (44%), Gaps = 63/406 (15%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           DPYDTLG+   AT  EIKKAY +LA ++HPD ++ E    ++E KF ++  AYE+LS++ 
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPD-INKE---PDAEKKFHDLQNAYEILSDDT 116

Query: 62  KRRNYD------------------------TYGDTNGYSDSYGG--FQDGDFASFFGNFA 95
           KR+ +D                         + D +G++++ GG  F   +F   FG   
Sbjct: 117 KRQQFDQFGPAAFGGGGGGGAGGAGSPFGSQFHDFSGFTNASGGSPFGGINFEDLFGAAF 176

Query: 96  SGRYEDEEDFR---------AHARPRTDDAHVSLRLTMQD-LYNGKTVRFQSTRNVVCNR 145
            G        R          + + R D   +  +++ +D ++  K V+ + +    C  
Sbjct: 177 GGGGAGAGAGRGGSGGRSSPMYRQYRGDPIEIVHKVSFKDAVFGAKNVQLKFSALDPCGT 236

Query: 146 CEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCK 205
           C G G++    H  +CT C G G    +R    GF    T  C  C G G   R +D C 
Sbjct: 237 CSGTGMKPNT-HKVSCTTCHGSGSTVHVRG---GFQMMST--CPTCNGEGTMKRPQDNCT 290

Query: 206 KCHGKRVTPE-TKNLNVYIPRGSRHNDRIVLEG---------EAD-EEPGKLT-GDLVFD 253
            CHG+ V     K++ V +P G +  D + + G         EAD ++  KL+ GD++  
Sbjct: 291 SCHGEGVQANRGKSITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLQDSIKLSRGDILVR 350

Query: 254 ISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNY 313
           I  D   S   R   D+     I ++ A  G    +  T+DG+ +R+K+  G   +    
Sbjct: 351 IRVDKDPSFSIRNKYDIWYDKEIPITTAALGGTITI-PTVDGQKIRIKVAPG--TQYNQV 407

Query: 314 ICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEALRNI 359
           I + N G P     +  G+M VQ  I        +E+   EAL ++
Sbjct: 408 ISIPNMGVPRTATLR--GDMKVQYKIVVKKPQSLAEKCLWEALADV 451

>Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON}
           (23785..25272) [1488 nt, 496 aa]
          Length = 495

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 115/399 (28%), Positives = 173/399 (43%), Gaps = 56/399 (14%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           DPY TLGVA  A+Q EIKKAY +LA ++HPD ++ E    ++E  F  +  AYE+LS+E+
Sbjct: 56  DPYKTLGVARSASQSEIKKAYYKLAKKYHPD-INKE---PDAEKTFHNLQNAYEILSDED 111

Query: 62  KRRNYDTYGDT-----NGYSDSYGGFQDGDFA-SFFGNFASGRYEDEEDFRAHARPRT-- 113
           KR  +D +G +      G S   GGF    FA    G F      + ED    A      
Sbjct: 112 KRAQFDQFGASAFSQNAGPSGGSGGFN--PFANGNGGGFGDFGGLNFEDLFGAAFGGGAS 169

Query: 114 --DDAHVSLRLTMQDLYNGKTVRF---QSTRNVV---------------CNRCEGAGIRK 153
              +     R+ M   Y G T+      S ++ V               C+ C G+G++K
Sbjct: 170 GRSNGGFGSRVNMVREYKGDTIEIIHNLSFKDAVFGVNNVSLTFNALDPCDTCHGSGLKK 229

Query: 154 RARHA-SACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRV 212
              H   +C++C G G +  +R    GF    T  C  C G G  +  ED+C KCHG  V
Sbjct: 230 GENHKRRSCSYCNGTGTQIHVR---SGFQMAST--CNHCHGEGTIIAFEDMCTKCHGDGV 284

Query: 213 TPET-KNLNVYIPRGSRHNDRIVLEGEA----------DEEPGKLT-GDLVFDISEDSTT 260
             +  K +NV +P      D I + GE           D++  KL+ GDL+  I      
Sbjct: 285 KLDAQKKINVNLPSSLSDGDVIRIPGEGSFPNIAVPEEDKDRVKLSRGDLLVRIRVKPDP 344

Query: 261 SNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEG 320
               +   D+ +   I ++ A  G    +  T+D + +RLK+  G   +      + N G
Sbjct: 345 DYTIKNKYDIWSVKEIPITTAALGGTITI-KTIDDKQIRLKVMAGT--QHDQVTSIPNMG 401

Query: 321 WPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEALRNI 359
            P  + G   G+M +Q  +         E    EAL ++
Sbjct: 402 VPRRN-GLGRGDMKIQYKVVIRKPSTEVETCLWEALADV 439

>CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016c MDJ1
           heat shock protein - chaperone
          Length = 522

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 112/420 (26%), Positives = 179/420 (42%), Gaps = 81/420 (19%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           DPY+TLGV   ++Q +IKKAY +LA ++HPD ++ E+  E+   KF ++  AYE+LS+E 
Sbjct: 47  DPYETLGVKKSSSQSDIKKAYYKLAKKYHPD-INKEAGAEK---KFHDLQNAYEILSDES 102

Query: 62  KRRNYDT--------------------------YGDTNGYSDSYGGFQDG------DFAS 89
           KR+ YD                           +G+  G+  S G           +F  
Sbjct: 103 KRKQYDQFGAAAFSGGAGAGPGGPGAGPGGFNPFGNGFGFDFSGGQAGGAGGFGGINFED 162

Query: 90  FFGN-FASGRYEDEED--------FRAHARPRTDDAHVSLRLTMQDLYNGK---TVRFQS 137
            FG  F  G +    +        FR +   + D   V   L  +D   GK   +++F++
Sbjct: 163 LFGTAFGGGPFGSSSNSGRRSSSMFREY---KGDTIEVIQNLDFKDAVFGKKNVSIKFRA 219

Query: 138 TRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKN 197
                C  C G+G++  A   + C  C G G    +R    GF    T  C  C G G  
Sbjct: 220 LDP--CGTCNGSGLKSGASK-TTCPSCHGSGTTVHVR---AGFQMMST--CQTCGGEGTT 271

Query: 198 LRSEDLCKKCHGKRVTPET-KNLNVYIPRGSRHNDRIVLEGE-------ADEEPGKLT-- 247
           + + D CK CHG+ V   T K + V +P G +  D + + G+        D+E  K    
Sbjct: 272 VNASDFCKSCHGEGVNVNTQKTITVDLPHGLQDGDVVRIPGQGSYPDIAVDKEMAKSVKL 331

Query: 248 --GDLVFDISEDSTTSNLERRGSDL-HTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPT 304
             GD++  I  +       +   D+ +TK I   + AL G       T++G  +R+K+P 
Sbjct: 332 SRGDILVRIRVNKDPHFSIKNKYDIWYTKEIPITTAALGGTVS--IPTIEGTKIRIKVPA 389

Query: 305 GQVIRPGNYICLKNEGWPL-----DDEGKKFGNMYVQINIEFPPDHWYSERGEIEALRNI 359
           G    P   I + N G P      +   +  G+M +Q  +        +E+   EAL ++
Sbjct: 390 GTA--PEQVISIPNMGVPKSSPYRNSAVQARGDMKIQYKVVIRKPQSKAEQCLWEALADV 447

>Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}
           YFL016C (REAL)
          Length = 517

 Score = 85.1 bits (209), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 107/413 (25%), Positives = 171/413 (41%), Gaps = 76/413 (18%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           DPYDTLG+   AT  EIKKAY +LA ++HPD ++ E    ++E KF ++  AYE+LS+E 
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPD-INKEP---DAEKKFHDLQNAYEILSDES 116

Query: 62  KRRNYDTYGDTNGYSDS------------------YGGFQDGDFASFFGNFASGRYED-- 101
           KR+ YD +G                          + GF +   +S FG      +ED  
Sbjct: 117 KRQQYDQFGPAAFGGGDAAGGPSGGGSPFGSQFHDFSGFSNAGGSSPFGGI---NFEDLF 173

Query: 102 ----------------------EEDFRAHARPRTDDAHVSLRLTMQD-LYNGKTVRFQST 138
                                    FR +   R D   +   ++ +D ++    V+ + +
Sbjct: 174 GAAFGGAGRGSSSSGGGGSTRSSSMFRQY---RGDPIEIVHNVSFKDAVFGSNNVQLKFS 230

Query: 139 RNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNL 198
               C  C G G++    H   C  C G G    +R    GF    T  C  C G G   
Sbjct: 231 ALDPCGTCSGTGMKPNT-HKVNCGTCHGTGTTVHIRG---GFQMMST--CPTCNGEGTMK 284

Query: 199 RSEDLCKKCHGKRV-TPETKNLNVYIPRGSRHNDRIVLEGEAD----------EEPGKLT 247
           R +D C KCHG+ V     K + V +P G +  D + + G+            ++  KL+
Sbjct: 285 RPQDSCSKCHGEGVQVNRGKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEEDLKDSVKLS 344

Query: 248 -GDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQ 306
            GD++  I  D   +   +   D+     I ++ A  G    +  T++G+ +R+K+  G 
Sbjct: 345 RGDILVRIRVDKDPNFSIKNKYDIWYNKEIPITTAALGGTVTI-PTVEGQKIRIKVAPG- 402

Query: 307 VIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEIEALRNI 359
             +    I + N G P     +  G+M VQ  I        +E+   EAL ++
Sbjct: 403 -TQYNQVISIPNMGVPKTPTIR--GDMKVQYKIVVKKPQSLAEKCLWEALADV 452

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 57/91 (62%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV+P AT  EIKKAYR+ A+Q HPDK  D+    E+E KF+ V  AY++LS+ E R
Sbjct: 8  YDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDDP---EAETKFQAVGEAYQVLSDTELR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDGD--FASFFG 92
            YD +G  +       GF+D +  F++ FG
Sbjct: 65 SRYDQFGKDDAVPQQ--GFEDAEEYFSAIFG 93

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.218
           YNL077W
          Length = 554

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 101/219 (46%), Gaps = 13/219 (5%)

Query: 112 RTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQ 171
           R  D   +L+ T+ +LY+GK  + +  R   C +C+G G    + +  +C+ C G G   
Sbjct: 229 RGPDIKHTLKCTLSNLYSGKRSKLRLERTRCCLKCKGFG----SLNIKSCSKCNGRGSLT 284

Query: 172 RLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHND 231
           + ++ GP   T  T  C  C G G    ++D+C +C G+    E K   V I  G     
Sbjct: 285 QTKKFGPMTQTF-TQTCDGCGGNGTFADAQDICNECQGEGFLNEKKIFEVEITPGMTDGQ 343

Query: 232 RIVLEGEADE----EPGK---LTGDLVFDISEDSTTSNLERRGSD-LHTKIIISLSDALT 283
            I+L GEADE      GK   + GD++  I+     +    +G+D L+    I+L  +L 
Sbjct: 344 LIILTGEADEVISTNLGKERVIPGDIILTINLLPDPTFKVVQGADLLYANYKINLLTSLC 403

Query: 284 GFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWP 322
           G    +        +++ I  G++I+ G    ++N G P
Sbjct: 404 GGSIYIKNHPSEHLIKINIIPGELIKNGAIKTVENLGMP 442

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 48/67 (71%), Gaps = 3/67 (4%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD L V  D+ +  IKKAYR LAL++HPDK    +L EES+  F++++ AY +LSN++KR
Sbjct: 8  YDILQVRYDSDESVIKKAYRTLALKYHPDK---NNLSEESKQMFQKISEAYVVLSNKDKR 64

Query: 64 RNYDTYG 70
          + YD YG
Sbjct: 65 QMYDKYG 71

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {ON}
           Anc_7.217 YER048C
          Length = 366

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 62/101 (61%), Gaps = 7/101 (6%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNE 60
           ++ YD LGV+P A+  EIKKAYR+ A++ HPDK  D+    +++ KF+ V  AY++LS+E
Sbjct: 5   LEYYDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDDP---DAQAKFQRVGEAYQVLSDE 61

Query: 61  EKRRNYDTYGDTNGYSDSYGGFQDGD--FASFFGNFASGRY 99
           E R+ YD +G    Y+    GF D    F + FG  + G +
Sbjct: 62  ELRKRYDEFG--KDYAIPQQGFTDAQEYFTAIFGGESFGDW 100

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.157
           YIR004W
          Length = 425

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 58/98 (59%), Gaps = 7/98 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV P AT  EIKKAYR+ ++Q HPDK  D+ +  E   +F+ ++ AY++LS+E+ R
Sbjct: 8   YEILGVTPTATAVEIKKAYRKKSVQEHPDKNRDDPMATE---RFQAISEAYQVLSDEDLR 64

Query: 64  RNYDTYGDTNGYSDSYGGFQDG--DFASFFGNFASGRY 99
             YD +G T       GGF+D    F+  FG  A   Y
Sbjct: 65  GKYDRFGKTEAVPK--GGFEDAAEQFSVIFGGDAFASY 100

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
           {ON} highly similar to uniprot|P40564 Saccharomyces
           cerevisiae YIR004w DJP1
          Length = 425

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 57/98 (58%), Gaps = 7/98 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LG+ P AT  EIKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++LS+EE R
Sbjct: 8   YDLLGIGPTATAVEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLSSEELR 64

Query: 64  RNYDTYGDTNGYSDSYGGFQDG--DFASFFGNFASGRY 99
             YD +G         GGF+D    F++ FG  A   Y
Sbjct: 65  AKYDKFGKQEAIPK--GGFEDAAEQFSAIFGGEAFASY 100

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 58/94 (61%), Gaps = 7/94 (7%)

Query: 1  MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNE 60
          M+ YD LG+ PDAT  EIKKAYRR A+Q HPDK  D+    +++ KF+ V  AY++LS+ 
Sbjct: 5  MEYYDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDDP---DAQSKFQAVGEAYQVLSDP 61

Query: 61 EKRRNYDTYGDTNGYSDSYGGFQDGD--FASFFG 92
          + +  YD +G  +    +  GF+D +  F   FG
Sbjct: 62 QLKSRYDQFGKDDAVPQA--GFEDAEEYFTVIFG 93

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 55/91 (60%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LG++P AT  EIKKAYRR A++ HPDK  D+    E+E KF+ V  AY++LS+E  R
Sbjct: 8  YDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDP---EAENKFQAVGEAYQVLSDESLR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDGD--FASFFG 92
            YD YG  +       GF+D +  F   FG
Sbjct: 65 ARYDEYGKDDAVPQQ--GFEDANEYFTVIFG 93

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 57/91 (62%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LG++P+AT  EIKKAYR++A+  HPDK  D+    E++ KF+ V  AY++L++   R
Sbjct: 8  YDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDP---EAQAKFQAVGEAYQVLNDPALR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDGD--FASFFG 92
          + YD +G  N       GF+D +  F + FG
Sbjct: 65 KQYDEFGKDNAVPQQ--GFEDAEEYFTAIFG 93

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV P AT  EIKKAYRR A+Q HPDK  D+    E++ KF+EV  AY++LS+   R
Sbjct: 8  YDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDDP---EAQAKFQEVGEAYQVLSDPGLR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDGD--FASFFG 92
            YD +G          GF+D +  F + FG
Sbjct: 65 SRYDEFGKDEAVPQQ--GFEDANEYFTAIFG 93

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 4/68 (5%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           DPY+TLGVA DA+  +IKKAY +LA Q HPD   DE     +E KF ++  AYE+LS+E 
Sbjct: 41  DPYETLGVAKDASASQIKKAYYKLAKQFHPDINKDEG----AEKKFHDLQNAYEILSDEN 96

Query: 62  KRRNYDTY 69
           KRR YD +
Sbjct: 97  KRRQYDQF 104

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {ON}
           similar to uniprot|P39101 YER048C Saccharomyces
           cerevisiae CAJ1 Nuclear type II J heat shock protein of
           the E. coli dnaJ family
          Length = 395

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/110 (41%), Positives = 63/110 (57%), Gaps = 20/110 (18%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LG+ PDA+  EIKKAYR+ A+  HPDK  D+    E++ KF+ +  AY++LS+ E R
Sbjct: 8   YDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDP---EAQAKFQAIGQAYQVLSDPELR 64

Query: 64  RNYDTYGDTN-----GYSDS-------YGG--FQD--GDFASFFGNFASG 97
             YD +G  +     G+ D+       +GG  FQD  GDFA F  N   G
Sbjct: 65  SRYDEFGKEDAVPQQGFEDAAEFFSTIFGGDAFQDWIGDFA-FLKNLTKG 113

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {ON}
           Anc_7.157 YIR004W
          Length = 470

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 59/98 (60%), Gaps = 7/98 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LG+ P ATQ EIKKAYR+ +++ HPDK  ++    E   +F++++ AY++LS+E  R
Sbjct: 8   YDILGITPTATQAEIKKAYRKKSIKEHPDKNPNDPTATE---RFQQISEAYQVLSDEHLR 64

Query: 64  RNYDTYGDTNGYSDSYGGFQD-GD-FASFFGNFASGRY 99
            NYD +G          GF+D GD F+  FG  A   Y
Sbjct: 65  NNYDQFGKEQAIPKE--GFEDAGDLFSVIFGGDAFESY 100

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 58/98 (59%), Gaps = 7/98 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+PDA   EIKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++LS++E R
Sbjct: 8   YDLLGVSPDAKAIEIKKAYRKKSVQEHPDKNPNDPKATE---RFQAISEAYQVLSSDELR 64

Query: 64  RNYDTYGDTNGYSDSYGGFQDG--DFASFFGNFASGRY 99
             YD +G       +  GF+D    FA+ FG  A   Y
Sbjct: 65  AKYDKFGKEEAVPQN--GFEDAGEQFAAIFGGEAFASY 100

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa]
          {ON} similar to gnl|GLV|CAGL0H03707g Candida glabrata
          CAGL0H03707g and some similarites with YNL007C
          uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (71%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LG++P A + EIKK YR+ AL++HPDK + ++       KFKE++ A+E+LS+ +KR
Sbjct: 8  YDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDAQKR 61

Query: 64 RNYDTYG 70
            YDTYG
Sbjct: 62 EVYDTYG 68

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 60/131 (45%), Gaps = 9/131 (6%)

Query: 215 ETKNLNVYIPRGSRHNDRIVLEGEADEEP---GKLTGDLVFDISEDSTTSNLERRGSDLH 271
           E   +++ +  G +   +I  +GE D  P   G+ T   V    ++       R+ +DL 
Sbjct: 215 EKNQIDIQLKPGWKAGTKITFKGEGDYNPRTGGRQTLQFVL---QEKPHEFFTRQDNDLI 271

Query: 272 TKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFG 331
             + +S  ++L GF K+V  T+DG+   + I   Q I+P        +G  L     + G
Sbjct: 272 YTLPLSFKESLLGFSKQV-QTIDGKT--IPITRTQPIQPTQTSTYPGQGMTLSKNPSQRG 328

Query: 332 NMYVQINIEFP 342
           ++ ++  I++P
Sbjct: 329 DLIIKFKIDYP 339

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {ON}
           similar to uniprot|P40564 YIR004W Saccharomyces
           cerevisiae DJP1 Cytosolic J-domain-containing protein,
           required for peroxisomal protein import
          Length = 429

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 59/99 (59%), Gaps = 9/99 (9%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDK-VSDESLREESEIKFKEVAAAYELLSNEEK 62
           YD LGV+P+A   EIKKAYR+ ++Q HPDK  +D S  E    +F+ ++ AY++LSNEE 
Sbjct: 8   YDLLGVSPNARPIEIKKAYRKKSVQEHPDKNPNDPSATE----RFQSISQAYQVLSNEEL 63

Query: 63  RRNYDTYGDTNGYSDSYGGFQDG--DFASFFGNFASGRY 99
           R  YD +G       +  GF+D    F++ FG  A   Y
Sbjct: 64  RTKYDKFGKEEAVPQN--GFEDAAEQFSAIFGGDAFASY 100

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 57/98 (58%), Gaps = 7/98 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LG+ P+AT  EIKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++LSN+E R
Sbjct: 8   YDLLGITPNATSIEIKKAYRKKSVQEHPDKNPNDPGATE---RFQAISEAYQVLSNDELR 64

Query: 64  RNYDTYGDTNGYSDSYGGFQDG--DFASFFGNFASGRY 99
             YD  G         GGF+D    F++ FG  A   Y
Sbjct: 65  AKYDRLGKQEAVPK--GGFEDAAEQFSAIFGGDAFASY 100

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
           {ON} similar to uniprot|P40564 YIR004W Saccharomyces
           cerevisiae DJP1 Cytosolic J-domain-containing protein,
           required for peroxisomal protein import
          Length = 433

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 58/98 (59%), Gaps = 7/98 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGVA DA Q +IKKAYR+ +++ HPDK  D+    E   +F+ ++ AY++LS+EE R
Sbjct: 8   YDLLGVATDAKQIDIKKAYRKKSVKEHPDKNPDDPTATE---RFQAISEAYQVLSSEELR 64

Query: 64  RNYDTYGDTNGYSDSYGGFQDG--DFASFFGNFASGRY 99
             YD +G       +  GF+D    FA+ FG  A   Y
Sbjct: 65  MKYDKFGKEEAMPKN--GFEDAGEQFAAIFGGEAFTSY 100

>Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016C
           (MDJ1) - DnaJ homolog involved in mitochondrial
           biogenesis and protein folding [contig 202] FULL
          Length = 478

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 115/255 (45%), Gaps = 23/255 (9%)

Query: 118 VSLRLTMQD-LYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRL 176
           +S R++ +D ++  K V  + +    CN C+G+G++  A   S C  C G G +  +R  
Sbjct: 184 ISHRISFKDSVFGTKNVNLKYSAYDPCNTCDGSGLKPGASR-STCPGCSGTGTRVHVR-- 240

Query: 177 GPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKN-LNVYIPRGSRHNDRIVL 235
             GF    T  C +C G G  LR  D C+ CHG+    +  + L V +P G +  D I +
Sbjct: 241 -AGFQMAST--CNQCGGEGSVLRDADTCQTCHGEGAKLDKNHELKVDLPHGLQDGDVIRI 297

Query: 236 EGE----------ADEEPGKLT-GDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTG 284
            G+          A ++  +L+ GDL+  I  D       +   D+     I ++ A  G
Sbjct: 298 SGKGSYPNIAVDPAMKDTVRLSRGDLLLRIRVDKDPRFQIKNKYDIWFTQDIPITTAALG 357

Query: 285 FEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPD 344
               +  T+DG  +RLK+  G   +  + + +  +G P    G + G+M VQ  +     
Sbjct: 358 GVVTI-PTVDGEQVRLKVSPG--TQHHDVVSIPQKGVPRGSFGTR-GDMKVQYRVVIKKP 413

Query: 345 HWYSERGEIEALRNI 359
              +E+   EAL +I
Sbjct: 414 QSQAEKCLWEALADI 428

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
          YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
          82] FULL
          Length = 353

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (71%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV+P A + E+KK YR+ AL++HPDK S ++       KFKE++ A+E+L++ +KR
Sbjct: 8  YDLLGVSPSAQETELKKGYRKAALKYHPDKPSGDAE------KFKEISEAFEILNDPQKR 61

Query: 64 RNYDTYG 70
            YDTYG
Sbjct: 62 EVYDTYG 68

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 61/128 (47%), Gaps = 3/128 (2%)

Query: 215 ETKNLNVYIPRGSRHNDRIVLEGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKI 274
           E + +++ +  G +   +I  + E D  P       +  I ++   SN  R G+DL   +
Sbjct: 214 EKQQVDIQLKPGWKAGTKITYKNEGDYNPRTGRRQTLQFILQEKPHSNYTRDGNDLIYSL 273

Query: 275 IISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMY 334
            ++  ++L GF K +  T+DGR   L I   Q ++P +      +G P+     + GN+ 
Sbjct: 274 PLTFKESLLGFSKTI-QTIDGRT--LPISRVQPVQPSDSSTYPGQGMPIAKTPSQRGNLI 330

Query: 335 VQINIEFP 342
           V+  I++P
Sbjct: 331 VKYKIDYP 338

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 57/91 (62%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV P+AT  +IKKAYR+ A+Q HPDK  D+    E++ KF+ V  AY++LS+   R
Sbjct: 8  YDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDDP---EAQSKFQAVGEAYQVLSDPGLR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDGD--FASFFG 92
            YD +G  +   ++  GF+D    F++ FG
Sbjct: 65 SKYDQFGKDDAVPNA--GFEDAQEFFSTIFG 93

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LG+ P AT  EIKKAYRR A++ HPDK  D+    E   +F++V  AY++LS+ + R
Sbjct: 8  YDVLGIPPTATATEIKKAYRRKAMETHPDKHPDDPTASE---RFQQVGEAYQVLSDPDLR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDGD--FASFFG 92
          + YD +G  N       GF+D    F+  FG
Sbjct: 65 KQYDEFGKDNAVPQQ--GFEDAGEYFSMIFG 93

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV PDAT  EIKKAYRR A+Q HPDK  D+    +++ KF+ V  AY++LS+   R
Sbjct: 8  YDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDGD--FASFFG 92
            YD +G  +       GF+D    F + FG
Sbjct: 65 SRYDEFGKDDAVPKQ--GFEDAGEYFTAIFG 93

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 44/67 (65%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV+P A   EIKK YR+ ALQ+HPDK +  +       KFK+++ AYE+LS+  KR
Sbjct: 8  YDLLGVSPSANDQEIKKGYRKAALQYHPDKPTGNTE------KFKQISEAYEILSDSNKR 61

Query: 64 RNYDTYG 70
            YD YG
Sbjct: 62 EVYDQYG 68

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 56/91 (61%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LG+ P AT  EIKKAYR+ A++ HPDK  D+    +++ KF+ V  AY++LS+++ R
Sbjct: 8  YDILGIQPSATSTEIKKAYRKKAMETHPDKHPDDP---DAQSKFQSVGEAYQVLSDDDLR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDGD--FASFFG 92
          + YD +G  N       GF+D    F + FG
Sbjct: 65 KRYDEFGKDNAVPQH--GFEDAGEYFTAIFG 93

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {ON}
           Anc_7.157
          Length = 482

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 57/98 (58%), Gaps = 7/98 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LG+ P ATQ EIKKAYR+ +++ HPDK  ++    E   +F+ ++ AY++LS+E  R
Sbjct: 8   YDLLGIEPSATQGEIKKAYRKKSIKEHPDKNPNDPQATE---RFQAISEAYQVLSDESLR 64

Query: 64  RNYDTYGDTNGYSDSYGGFQDG--DFASFFGNFASGRY 99
             YD YG       +  GF+D    F++ FG  A   Y
Sbjct: 65  LKYDKYGKKEAIPQN--GFEDAAEQFSAIFGGDAFASY 100

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 58/98 (59%), Gaps = 7/98 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+PDA Q +IKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++L ++E R
Sbjct: 8   YDLLGVSPDAKQIDIKKAYRKKSVQEHPDKNPNDPKATE---RFQAISEAYQVLGSDELR 64

Query: 64  RNYDTYGDTNGYSDSYGGFQDG--DFASFFGNFASGRY 99
             YD +G       +  GF+D    FA+ FG  A   Y
Sbjct: 65  AKYDKFGKDEAVPQN--GFEDAGEQFAAIFGGEAFASY 100

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (71%), Gaps = 3/67 (4%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV PDAT ++IKKAYR+ A+Q HPDK  ++    E++ KF+EV+ AY++LS+ E R
Sbjct: 8  YDVLGVQPDATAEQIKKAYRKKAIQTHPDKNPNDP---EAQAKFQEVSKAYKVLSDGELR 64

Query: 64 RNYDTYG 70
            YD  G
Sbjct: 65 SRYDEVG 71

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LG+ PDAT  EIKKAYRR A++ HPDK  D+    +++ KF+ V  AY++LS+   R
Sbjct: 8  YDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDGD--FASFFG 92
            YD +G  +       GF+D    F + FG
Sbjct: 65 SKYDEFGKEDAVPQQ--GFEDASEYFTAIFG 93

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
          Anc_1.398
          Length = 363

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV P A + EIKK YR+ AL++HPDK + ++       KFK+++ AYE+LS+  KR
Sbjct: 8  YDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKQISEAYEILSDSNKR 61

Query: 64 RNYDTYG 70
            YD YG
Sbjct: 62 EIYDQYG 68

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 66/148 (44%), Gaps = 9/148 (6%)

Query: 215 ETKNLNVYIPRGSRHNDRIVLEGEADEEP---GKLTGDLVFDISEDSTTSNLERRGSDLH 271
           E   +++ +  G +   ++  + + D  P   G+ T   + D     T    +R   +L 
Sbjct: 222 EKTQIDIQLKPGWKAGTKLTYKNKGDYNPRTHGRKTLQFIIDEKPHPT---FQREDDNLV 278

Query: 272 TKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFG 331
             + ++  ++L GF K V  T+DGR+L   I   Q I+P        +G P+  +  + G
Sbjct: 279 CTVPLTFKESLLGFSKTV-QTIDGRNL--PISRSQPIQPTEITRYPGQGMPISKKPGQRG 335

Query: 332 NMYVQINIEFPPDHWYSERGEIEALRNI 359
           ++ V+  I +P     ++R  I+   N+
Sbjct: 336 DLIVKYKIAYPITLTQAQRDAIKTNFNV 363

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa]
          {ON} highly similar to uniprot|P25294 Saccharomyces
          cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 47/67 (70%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LG++P A + EIKK YR+ AL++HPDK + ++       KFKE++ A+E+LS+ +KR
Sbjct: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPQKR 61

Query: 64 RNYDTYG 70
            YD YG
Sbjct: 62 EVYDQYG 68

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 57/134 (42%), Gaps = 3/134 (2%)

Query: 209 GKRVTPETKNLNVYIPRGSRHNDRIVLEGEADEEPGKLTGDLVFDISEDSTTSNLERRGS 268
           G    PE   +++ +  G +   +I  +   D  P       +  I ++       R G+
Sbjct: 204 GPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGN 263

Query: 269 DLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGK 328
           DL   + ++  ++L GF K +  T+DGR   L +   Q I+P        +G P+     
Sbjct: 264 DLIYTLPLTFKESLLGFNKTI-QTIDGR--TLPVSRIQPIQPSEKSTYPGQGMPIPKTPG 320

Query: 329 KFGNMYVQINIEFP 342
           + G+M V   +++P
Sbjct: 321 QRGDMIVNYKVDYP 334

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 55/91 (60%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LG+ P+AT  EIKKAYRR A++ HPDK  D+    +++ KF+ V  AY++LS++  R
Sbjct: 8  YDILGIKPEATATEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDQGLR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDGD--FASFFG 92
            YD +G  +       GF+D    F + FG
Sbjct: 65 SKYDEFGKEDAVPQQ--GFEDASEYFTAIFG 93

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV+P A+  E+KK YR+ AL++HPDK + ++       KFKE++ A+E+LS+  KR
Sbjct: 8  YDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPNKR 61

Query: 64 RNYDTYG 70
            YDTYG
Sbjct: 62 EVYDTYG 68

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 64/134 (47%), Gaps = 3/134 (2%)

Query: 209 GKRVTPETKNLNVYIPRGSRHNDRIVLEGEADEEPGKLTGDLVFDISEDSTTSNLERRGS 268
           G+   PE K +++ +  G +   +I  + E D  P       +  I ++      +R G+
Sbjct: 204 GQTGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTIQFIIQEKPHEFFKRDGN 263

Query: 269 DLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGK 328
           DL   + ++  ++L GF+K V  T+DGR  ++ I   Q ++P   +    +G PL     
Sbjct: 264 DLIYTLPLTFKESLLGFDKTV-RTIDGR--QISIHKTQPVQPSEEMRYPGQGMPLSKNPS 320

Query: 329 KFGNMYVQINIEFP 342
           + G++ V+   ++P
Sbjct: 321 ERGDLIVKYKTDYP 334

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
           Anc_7.157
          Length = 414

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 57/98 (58%), Gaps = 7/98 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           Y+ LG++P AT  EIKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++LS++  R
Sbjct: 8   YELLGISPSATAIEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLSDDTLR 64

Query: 64  RNYDTYGDTNGYSDSYGGFQDG--DFASFFGNFASGRY 99
             YD YG         GGF+D    F++ FG  A   Y
Sbjct: 65  LKYDKYGKKEAVPT--GGFEDAAEQFSAIFGGDAFSSY 100

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 357

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 46/67 (68%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV+P A + E+KK Y++ AL++HPDK + ++       KFKE++ AYE+LS+  KR
Sbjct: 8  YDMLGVSPSANEQELKKGYKKAALKYHPDKPAGDTE------KFKEISEAYEILSDSSKR 61

Query: 64 RNYDTYG 70
            YD YG
Sbjct: 62 EIYDQYG 68

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 60/131 (45%), Gaps = 9/131 (6%)

Query: 215 ETKNLNVYIPRGSRHNDRIVLEGEADEEP---GKLTGDLVFDISEDSTTSNLERRGSDLH 271
           E   +++ +  G +   +I  + E D  P   G+ T   V    ++ +    +R G +L 
Sbjct: 218 EKTQIDIQLKPGWKAGTKITYKNEGDYNPQTGGRKTLQFVL---QEKSHPLYKRDGDNLI 274

Query: 272 TKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFG 331
             + +S  ++L GF K +  T+DGR L   I   Q ++P        +G P+     + G
Sbjct: 275 YSLPLSFKESLLGFSKTI-QTIDGRTL--PISKIQPVQPTEVSSYPGQGMPVSKRPGQRG 331

Query: 332 NMYVQINIEFP 342
           ++ V+  I++P
Sbjct: 332 DLVVKYKIDYP 342

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON}
          Anc_1.398 YNL007C
          Length = 359

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (68%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV+P A   EIKK YR+ AL++HPDK + ++       KFKE++ A+E+LS++ KR
Sbjct: 8  YDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDKNKR 61

Query: 64 RNYDTYG 70
            YD YG
Sbjct: 62 EVYDQYG 68

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 77/173 (44%), Gaps = 29/173 (16%)

Query: 184 ETVQCTKCRGLGKNLRSEDLCKKCHGKRVT-----------PETKNLNVYIPRGSRHNDR 232
           ETVQ +    L      EDL    HGK+ +           PE   +++ +  G +   +
Sbjct: 187 ETVQVSLPVSL------EDLF---HGKKKSFKIGRKGQGGIPEKTQIDIQLKPGWKAGTK 237

Query: 233 IVLEGEADEEP---GKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEV 289
           I  + + D  P   G+ T  L F + E +     +R G DL   + ++  ++L GF K++
Sbjct: 238 ITYKSQGDYNPQTGGRKT--LQFMLQEKNHPV-FKREGDDLTCTLPLTFKESLLGFNKQI 294

Query: 290 CTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342
             T+DGR L   I   Q I+P        +G P+     + GN+ V+  I++P
Sbjct: 295 -QTIDGRTL--PISRTQPIQPSETSVYPGQGMPIPKTPSQRGNLIVRYKIDYP 344

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
          (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (68%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD L V+P A + EIKK YR+ AL++HPDK + ++       KFKE++ A+E+LS+ EKR
Sbjct: 8  YDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDAEKR 61

Query: 64 RNYDTYG 70
            YD YG
Sbjct: 62 EVYDQYG 68

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/128 (20%), Positives = 57/128 (44%), Gaps = 3/128 (2%)

Query: 215 ETKNLNVYIPRGSRHNDRIVLEGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKI 274
           E   + + +  G +   +I  + + D  P       +  I ++   +N +R   +L   +
Sbjct: 218 EKAQIEIALKAGWKAGTKITYKNQGDYNPSTGGRKTLQFILKEKPNTNFKRDEDNLIYTL 277

Query: 275 IISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMY 334
            ++  ++L GF+K +  T+DG+ L   I   Q ++P        +G P+     + G+M 
Sbjct: 278 PLTFKESLLGFQKTI-KTIDGKTL--PISRVQPVQPSECTTYPGQGMPISKSVGQRGDMI 334

Query: 335 VQINIEFP 342
           V+  + +P
Sbjct: 335 VKFKVGYP 342

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 40/91 (43%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV P+AT  EIKKAYRR A++ HPDK  D+    E++ KF+ V  AY++LS+   R
Sbjct: 8  YDILGVKPEATPAEIKKAYRRRAMETHPDKHPDDP---EAQSKFQAVGEAYQVLSDPGLR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDGD--FASFFG 92
            YD +G  +       GF+D    F + FG
Sbjct: 65 SRYDEFGKDDAVPQH--GFEDATEFFTTIFG 93

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LG+ P+AT  EIKKAYRR A++ HPDK  D+    +++ KF+ V  AY++LS+   R
Sbjct: 8  YDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDGD--FASFFG 92
            YD +G  +       GF+D    F + FG
Sbjct: 65 SKYDEFGKEDAVPQQ--GFEDASEYFTAIFG 93

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {ON}
           YER048C (CAJ1) - homologous to E. coli DnaJ [contig 197]
           FULL
          Length = 393

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 69/125 (55%), Gaps = 23/125 (18%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LG+ PDA+  +IKKAYR+ A+  HPDK  D+    E++ KF+ +  AY++LS+ + R
Sbjct: 8   YDLLGLQPDASATDIKKAYRKKAMLTHPDKHPDDP---EAQAKFQAIGEAYQVLSDPDLR 64

Query: 64  RNYDTYGDTN-----GYSDS-------YGG--FQD--GDFASFFGNFASGRY---EDEED 104
             YD +G  N     G+ D+       +GG  FQ   GDFA F  N   G     ED+E+
Sbjct: 65  SRYDEFGKENAVPQQGFEDAAEFFTTIFGGDAFQGWIGDFA-FLKNLTKGAEIMGEDKEE 123

Query: 105 FRAHA 109
             A A
Sbjct: 124 TTAEA 128

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV P+AT  EIKKAYRR A++ HPDK  ++     ++ KF+ V  AY++LS++E R
Sbjct: 8  YDILGVKPEATSAEIKKAYRRRAMETHPDKHPNDP---NAQAKFQAVGEAYQVLSDDELR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDGD--FASFFG 92
          + YD  G  +       GF D    F + FG
Sbjct: 65 KRYDQLGKESAVPQQ--GFVDPSEYFTAIFG 93

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (64%), Gaps = 3/77 (3%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREES---EIKFKEVAAAYELL 57
            DPYD LGV+  A+  EIK AYR+L+L+ HPDKV+ +   EE    E  + +++ AYE L
Sbjct: 119 FDPYDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYEAL 178

Query: 58  SNEEKRRNYDTYGDTNG 74
           ++E  ++NY  YG  +G
Sbjct: 179 TDELVKQNYLMYGHPDG 195

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON}
          Anc_1.398 YNL007C
          Length = 355

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (65%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV+P A   EIKK YR+ AL++HPDK +  +       KFKE++ A+E+LS+  KR
Sbjct: 8  YDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGNTE------KFKEISEAFEILSDSNKR 61

Query: 64 RNYDTYG 70
            YD YG
Sbjct: 62 EVYDQYG 68

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 68/151 (45%), Gaps = 9/151 (5%)

Query: 209 GKRVTPETKNLNVYIPRGSRHNDRIVLEGEADEEP---GKLTGDLVFDISEDSTTSNLER 265
           G+    E   +++ +  G +   +I  +   D  P   G+ T  L F I E     N +R
Sbjct: 210 GQNGVQEKVQVDIQLKAGWKAGTKITFKNYGDYNPSTGGRKT--LQFVIKE-KVHPNFKR 266

Query: 266 RGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDD 325
               L   + ++  ++L GF+K +  T+DGR   L I   Q ++P +      +G P+  
Sbjct: 267 EDDTLVYYLPLTFKESLLGFQKTI-QTIDGR--TLPISRVQPVQPNDSSTYPGQGMPMTK 323

Query: 326 EGKKFGNMYVQINIEFPPDHWYSERGEIEAL 356
           +  + G+M V+  IE+P      +R  I+ L
Sbjct: 324 KPGQRGDMIVKYKIEYPTTLTDDQRRAIDEL 354

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LG+ P+AT  EIKKAYRR A++ HPDK  D+    +++ KF+ V  AY++LS+   R
Sbjct: 8  YDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDGD--FASFFG 92
            YD +G  +       GF+D    F + FG
Sbjct: 65 SKYDQFGKEDAVPQQ--GFEDASEYFTAIFG 93

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
          to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 48/67 (71%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++ +KR
Sbjct: 8  YDLLGVSPSADEGELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQKR 61

Query: 64 RNYDTYG 70
            YD+YG
Sbjct: 62 EIYDSYG 68

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 69/147 (46%), Gaps = 11/147 (7%)

Query: 199 RSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIVLEGEAD---EEPGKLTGDLVFDIS 255
           +S  + +K  G    PE K +++ +  G +   +I  + E D   +  G+ T   V    
Sbjct: 195 KSFKITRKGPGS--VPEKKQIDIQMKPGWKAGTKITFKNEGDYNQQTGGRQTMQFVI--- 249

Query: 256 EDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYIC 315
           ++    + +R G++L   + +S  ++L GF K +  T+DGR L   I   Q I+P     
Sbjct: 250 QEKLHPHFKRDGNNLIYTLPLSFKESLLGFSKTI-QTIDGRTL--PISRVQPIQPSETST 306

Query: 316 LKNEGWPLDDEGKKFGNMYVQINIEFP 342
              +G PL     + G++ ++  +++P
Sbjct: 307 YPGQGMPLPKTPAQRGDLIIKYKVDYP 333

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
          {ON} Anc_1.398 YNL007C
          Length = 369

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++ +KR
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDSQKR 61

Query: 64 RNYDTYG 70
            YD YG
Sbjct: 62 EIYDQYG 68

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 69/153 (45%), Gaps = 17/153 (11%)

Query: 201 EDLC---KKCH-----GKRVTPETKNLNVYIPRGSRHNDRIVLEGEADEEP---GKLTGD 249
           EDLC   KK       G   T E   +++ + +G +   +I  + E D  P   G+ T  
Sbjct: 208 EDLCAGKKKSFKIGRKGPNGTSEKTQIDIQLKQGWKAGTKITYKNEGDYNPRTGGRKTLQ 267

Query: 250 LVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIR 309
            V    ++      +R G +L   + +S  ++L GF K +  T+DGR L   I   Q I+
Sbjct: 268 FVL---QEKAHPLFKRDGDNLIYTLPLSFKESLLGFSKTI-QTIDGRTL--PISRVQPIQ 321

Query: 310 PGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342
           P        +G P+  +  + G++ V+  I++P
Sbjct: 322 PSESSRYPGQGMPITKKPGQRGDLIVKYKIDYP 354

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
          SIS1Type II HSP40 co-chaperone that interacts with the
          HSP70 protein Ssa1p; not functionally redundant with
          Ydj1p due to due to substrate specificity; shares
          similarity with bacterial DnaJ proteins
          Length = 352

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++ +KR
Sbjct: 8  YDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQKR 61

Query: 64 RNYDTYG 70
            YD YG
Sbjct: 62 EIYDQYG 68

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 73/173 (42%), Gaps = 17/173 (9%)

Query: 178 PGFVTRETVQCTKCRGL-----GKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDR 232
           P +   ETVQ      L     GK    +   K  HG     E   +++ +  G +   +
Sbjct: 174 PTYPEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAS---EKTQIDIQLKPGWKAGTK 230

Query: 233 IVLEGEADEEPGKLTG---DLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEV 289
           I  + + D  P   TG    L F I E S   N +R G DL   + +S  ++L GF K +
Sbjct: 231 ITYKNQGDYNPQ--TGRRKTLQFVIQEKSH-PNFKRDGDDLIYTLPLSFKESLLGFSKTI 287

Query: 290 CTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342
             T+DGR L L     Q ++P        +G P      + GN+ V+  +++P
Sbjct: 288 -QTIDGRTLPLS--RVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 337

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa]
          {ON} YNL007C (REAL)
          Length = 366

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++ +KR
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDSQKR 61

Query: 64 RNYDTYG 70
            YD YG
Sbjct: 62 EIYDQYG 68

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 73/173 (42%), Gaps = 17/173 (9%)

Query: 178 PGFVTRETVQCTKCRGL-----GKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDR 232
           P +   ETVQ      L     GK    +   K  HG     E   +++ +  G +   +
Sbjct: 188 PTYPEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAS---EKTQIDIQLKPGWKAGTK 244

Query: 233 IVLEGEADEEPGKLTG---DLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEV 289
           I  + + D  P   TG    L F I E S   N +R G DL   + +S  ++L GF K +
Sbjct: 245 ITYKNQGDYNPQ--TGRRKTLQFVIQEKSH-PNFKRDGDDLIYTLPLSFKESLLGFSKTI 301

Query: 290 CTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342
             T+DGR L L     Q ++P        +G P      + GN+ V+  +++P
Sbjct: 302 -QTIDGRTLPLS--RVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 351

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 52/90 (57%), Gaps = 3/90 (3%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREE---SEIKFKEVAAAYELL 57
            DPYD LG++P A+  +IK AYRRL+L+ HPDK+S E   EE    E  + +++ A+E L
Sbjct: 124 FDPYDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEAL 183

Query: 58  SNEEKRRNYDTYGDTNGYSDSYGGFQDGDF 87
           ++   R NY  YG  +G   +  G     F
Sbjct: 184 TDPIVRENYLKYGHPDGPQSTTHGIAIPSF 213

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 350

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++ +KR
Sbjct: 8  YDLLGVSPSAQETELKKGYRKAALKYHPDKPTGDAE------KFKEISEAFEILNDPQKR 61

Query: 64 RNYDTYG 70
            YD YG
Sbjct: 62 EIYDNYG 68

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 61/129 (47%), Gaps = 3/129 (2%)

Query: 214 PETKNLNVYIPRGSRHNDRIVLEGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTK 273
           PE + +++ +  G +   +I  + E D  P       +  I ++    N  R G+DL   
Sbjct: 210 PEKQQVDIQLRPGWKAGTKITYKNEGDYNPRTGRRQTMQFIIQEKPHENYTRDGNDLIYT 269

Query: 274 IIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNM 333
           + ++  ++L GF K +  T+DGR L   I   Q ++P +      +G P+     + GN+
Sbjct: 270 LPLTFKESLLGFNKTI-QTIDGRTL--PISRVQPVQPSDVSTYPGQGMPVAKNPSQRGNL 326

Query: 334 YVQINIEFP 342
            V+  I++P
Sbjct: 327 IVKYKIDYP 335

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa]
          {ON} YNL007C (REAL)
          Length = 359

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++ +KR
Sbjct: 8  YDMLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQKR 61

Query: 64 RNYDTYG 70
            YD YG
Sbjct: 62 EIYDQYG 68

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 72/170 (42%), Gaps = 11/170 (6%)

Query: 178 PGFVTRETVQCTKCRGL-----GKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDR 232
           P +   ETVQ      L     GK    +   K  HG   T E   +++ +  G +   +
Sbjct: 181 PSYPEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHG---TSEKTQIDIQLKPGWKAGTK 237

Query: 233 IVLEGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVCTT 292
           I  + + D  P       +  + ++ +  N +R G DL   + +S  ++L GF K +  T
Sbjct: 238 ITYKNQGDFNPQTNRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTI-QT 296

Query: 293 LDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342
           +DGR L L     Q ++P        +G P      + GN+ V+  +++P
Sbjct: 297 IDGRTLPLS--RVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 344

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa]
          {ON} Anc_1.398 YNL007C
          Length = 363

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 48/67 (71%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++++KR
Sbjct: 8  YDLLGVSPTANEQELKKGYRKSALKYHPDKPTGDTE------KFKEISEAFEILNDKQKR 61

Query: 64 RNYDTYG 70
            YD YG
Sbjct: 62 EIYDQYG 68

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 64/144 (44%), Gaps = 9/144 (6%)

Query: 215 ETKNLNVYIPRGSRHNDRIVLEGEADEEP---GKLTGDLVFDISEDSTTSNLERRGSDLH 271
           E   +++ +  G +   ++  +   D  P   G+ T  L F I E  T    +R G DL 
Sbjct: 224 EKVQIDIQLKAGWKAGTKVTYKNHGDYNPRTGGRKT--LQFVIQE-KTHPLYKRNGDDLE 280

Query: 272 TKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFG 331
             + ++  ++L GF K +  T+DGR L L       ++P        +G P+     + G
Sbjct: 281 YTLPLTFKESLLGFSKTI-QTIDGRTLPLS--RSSPVQPTETSRYPGQGMPMPKMPSQRG 337

Query: 332 NMYVQINIEFPPDHWYSERGEIEA 355
           ++ V+  I++P     ++R  I A
Sbjct: 338 DLVVRFKIDYPISLNDAQRQAIAA 361

>SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON}
          conserved hypothetical protein
          Length = 292

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 57/88 (64%), Gaps = 6/88 (6%)

Query: 1  MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNE 60
          +DPY TL ++ DA   ++KK+YRRL L++HPDK+S++  +EE++ +F +V  +YE+L+  
Sbjct: 11 IDPYATLELSNDAEDSQVKKSYRRLMLRYHPDKLSNDLAKEEAQDRFHKVQLSYEVLT-- 68

Query: 61 EKRRNYDTYGDTNG----YSDSYGGFQD 84
          + R  YD  G         SDS G ++D
Sbjct: 69 KFREIYDKSGSIEACYATASDSLGDWKD 96

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
           HLJ1Co-chaperone for Hsp40p, anchored in the ER
           membrane; with its homolog Ydj1p promotes ER-associated
           protein degradation (ERAD) of integral membrane
           substrates; similar to E. coli DnaJ
          Length = 224

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 61/124 (49%), Gaps = 22/124 (17%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           Y+ L V   AT  EIKKAYR+LA++ HPDK S     E     FK +  A+E+LSNEEKR
Sbjct: 23  YEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGE----AFKVINRAFEVLSNEEKR 78

Query: 64  RNYDTYG------------------DTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDF 105
             YD  G                   + G S   GGF+D  F S FG   +G  ED  DF
Sbjct: 79  SIYDRIGRDPDDRQMPSRGAASGFRGSAGGSPMGGGFEDMFFNSRFGGQRAGPPEDIFDF 138

Query: 106 RAHA 109
             +A
Sbjct: 139 LFNA 142

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.157
           YIR004W
          Length = 434

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 58/98 (59%), Gaps = 7/98 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV P++T  EIKKAYR+ +++ HPDK  +     ++  KF+ ++ AY++LS++  R
Sbjct: 8   YDLLGVEPNSTDIEIKKAYRKKSIKLHPDKNPN---NPDATKKFQAISEAYQVLSDKNLR 64

Query: 64  RNYDTYGDTNGYSDSYGGFQDGD--FASFFGNFASGRY 99
            NYD +G         GGF+D +  F + FG  A   Y
Sbjct: 65  SNYDKFGKDKAIPK--GGFEDANEQFTAMFGGEAFKDY 100

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa]
          {ON} YNL007C (REAL)
          Length = 368

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++ +KR
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDAQKR 61

Query: 64 RNYDTYG 70
            YD YG
Sbjct: 62 EIYDQYG 68

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 73/172 (42%), Gaps = 15/172 (8%)

Query: 178 PGFVTRETVQCTKCRGL-----GKNLRSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDR 232
           P +   ETVQ      L     GK    +   K  HG     E   +++ +  G +   +
Sbjct: 190 PTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHG---AAEKTQIDIQLKPGWKAGTK 246

Query: 233 IVL--EGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEKEVC 290
           I    +G+ + + G+    L F I E     N +R G DL   + +S  ++L GF K + 
Sbjct: 247 ITYKNQGDFNSQTGR-RKTLQFVIQEKGH-PNFKRDGDDLIYTLPLSFKESLLGFSKTI- 303

Query: 291 TTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFP 342
            T+DGR L L     Q ++P        +G P      + GN+ V+  +++P
Sbjct: 304 QTIDGRTLPLS--RVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 353

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 55/91 (60%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LG++  AT  EIKKAYR+ +++ HPDK  ++    E   +F+ ++ AY++LS+++ R
Sbjct: 8  YDLLGISTTATDIEIKKAYRKKSIKEHPDKNPNDPSATE---RFQAISEAYQVLSDKQLR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDG--DFASFFG 92
           NYD YG         GGF+D    F+  FG
Sbjct: 65 SNYDKYGKEKAIPS--GGFEDAAEQFSVIFG 93

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 53/73 (72%), Gaps = 5/73 (6%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD L V+ DA+  EIKK+YR+LA++ HPDK  D+    +++ KF+E+A AY++L +++ R
Sbjct: 8  YDILQVSVDASPQEIKKSYRKLAIKTHPDKNPDDP---QAQTKFQELAKAYQVLIDDDLR 64

Query: 64 RNYDTYG--DTNG 74
          + YD +G  +TNG
Sbjct: 65 KKYDQFGLDETNG 77

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 49/78 (62%), Gaps = 5/78 (6%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIK----FKEVAAAYEL 56
            DPY+ LGV   +T+ EIKKAYR L+L+ HPDK+ D +L E+  +     F +++ AYE 
Sbjct: 120 FDPYEILGVTVSSTEKEIKKAYRNLSLKFHPDKL-DRNLSEKERLSMEEIFVQISKAYEA 178

Query: 57  LSNEEKRRNYDTYGDTNG 74
           L+N   + NY  YG  +G
Sbjct: 179 LTNPATKENYLLYGHPDG 196

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
           (REAL)
          Length = 224

 Score = 64.3 bits (155), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 62/124 (50%), Gaps = 22/124 (17%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           Y+ L V   AT  EIKKAYR+LA++ HPDK S     E     FK +  A+E+LSNEEKR
Sbjct: 23  YEILRVDKKATDGEIKKAYRKLAIKLHPDKNSHPRASE----AFKVINRAFEVLSNEEKR 78

Query: 64  RNYDTYG------------DTNGYSDSYG------GFQDGDFASFFGNFASGRYEDEEDF 105
             YD  G              +G+  S G      GF+D  F S FG   +G  ED  DF
Sbjct: 79  SIYDRIGRDPDDRQMPSSSAASGFRGSAGGSPMGSGFEDMFFNSRFGGQRAGPPEDIFDF 138

Query: 106 RAHA 109
             +A
Sbjct: 139 LFNA 142

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
           (REAL)
          Length = 224

 Score = 64.3 bits (155), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 61/124 (49%), Gaps = 22/124 (17%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           Y+ L V   AT  +IKKAYR+LA++ HPDK S     E     FK +  A+E+LSNEEKR
Sbjct: 23  YEILKVDRKATDSDIKKAYRKLAIKLHPDKNSHPKAGE----AFKVINRAFEVLSNEEKR 78

Query: 64  RNYDTYG------------------DTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDF 105
             YD  G                   + G S   GGF+D  F S FG   +G  ED  DF
Sbjct: 79  SIYDRIGRDPDDRQIPSRSAASGFQGSAGGSPMGGGFEDMFFGSRFGGQRAGPPEDIFDF 138

Query: 106 RAHA 109
             +A
Sbjct: 139 LFNA 142

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
           (REAL)
          Length = 432

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 55/98 (56%), Gaps = 7/98 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+  AT  EIKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++L ++E R
Sbjct: 8   YDLLGVSTTATAIEIKKAYRKKSIQEHPDKNPNDPKATE---RFQAISEAYQVLGDDELR 64

Query: 64  RNYDTYGDTNGYSDSYGGFQDG--DFASFFGNFASGRY 99
             YD YG         GGF+D    F+  FG  A   Y
Sbjct: 65  AKYDKYGRKEAIPQ--GGFEDAAEQFSVIFGGDAFASY 100

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {ON}
           similar to gnl|GLV|CAGL0J01936g Candida glabrata
           CAGL0J01936g and some similarites with uniprot|P40564
           YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
           J-domain- containing protein, required for peroxisomal
           protein import
          Length = 418

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 54/98 (55%), Gaps = 7/98 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV   AT  EIKKAYR+ ++  HPDK  D+    E   +F+ ++ AY++LSN++ R
Sbjct: 8   YDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDPAATE---RFQSISEAYQVLSNKDLR 64

Query: 64  RNYDTYGDTNGYSDSYGGFQDG--DFASFFGNFASGRY 99
            NYD  G         GGF+D    F+  FG  A   Y
Sbjct: 65  ANYDKSGKEKAIPK--GGFEDAAEQFSVIFGGEAFAAY 100

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 50/77 (64%), Gaps = 3/77 (3%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVS---DESLREESEIKFKEVAAAYELL 57
            DPY+ LG++  A+  +IK AYR+L+L+ HPDK+     E+ RE  E ++ ++  AYE L
Sbjct: 120 FDPYELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYESL 179

Query: 58  SNEEKRRNYDTYGDTNG 74
           ++E  R NY TYG  +G
Sbjct: 180 TDELIRFNYLTYGHPDG 196

>KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 473

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 111/252 (44%), Gaps = 23/252 (9%)

Query: 121 RLTMQD-LYNGKTVRFQSTRNVVCNRCEGAGIRKRARHASACTHCEGHGVKQRLRRLGPG 179
           R++ +D ++  K V  + +    C  C+G+G++  A   + C  C G G +  +R    G
Sbjct: 183 RISFKDSVFGTKNVNLKFSAYDPCGTCDGSGLKPGASRTT-CPGCSGTGTRVHIR---AG 238

Query: 180 FVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPETKN-LNVYIPRGSRHNDRIVLEGE 238
           F    T  C +C G G  +R  D C  CHG+  +    + + V +P G +  D I + G+
Sbjct: 239 FQMAST--CNQCGGEGSVVRDSDTCATCHGEGASLNKDHAIKVDLPHGLQDGDVIRISGQ 296

Query: 239 ----------ADEEPGKLT-GDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFEK 287
                     A ++  +L+ GD++  I  D       +   D+     I ++ A  G   
Sbjct: 297 GSYPNIAVDPAMKDTVRLSRGDVLLRIRVDKDPRFQIKNKYDIWLTQDIPITTAALGGIV 356

Query: 288 EVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWY 347
            V  T+DG  +RLK+  G   +  + + +  +G P    G + G+M VQ  I        
Sbjct: 357 TV-PTVDGEQVRLKVAPG--TQHNDVVSISQKGVPRGAFGSR-GDMKVQYKISIKKPQSQ 412

Query: 348 SERGEIEALRNI 359
           +ER   EAL ++
Sbjct: 413 AERCLWEALADV 424

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 50/77 (64%), Gaps = 3/77 (3%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREE---SEIKFKEVAAAYELL 57
            DPYD LG++  A++ EIK AYR+L+++ HPDK++ E   +E    E  + ++  AYE L
Sbjct: 118 FDPYDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEAL 177

Query: 58  SNEEKRRNYDTYGDTNG 74
           ++E  R+N+  YG  +G
Sbjct: 178 TDELTRQNFLKYGHPDG 194

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} similar
           to uniprot|P40564 YIR004W Saccharomyces cerevisiae DJP1
           Cytosolic J-domain-containing protein, required for
           peroxisomal protein import
          Length = 419

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 55/98 (56%), Gaps = 7/98 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+PDA   +IKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++LS ++ R
Sbjct: 8   YDLLGVSPDAKSIDIKKAYRKKSVQEHPDKNPNDPTATE---RFQAISQAYQVLSKDDLR 64

Query: 64  RNYDTYGDTNGYSDSYGGFQDG--DFASFFGNFASGRY 99
             YD +G          GF+D    F+  FG  A   Y
Sbjct: 65  AKYDKFGKEEAVPKE--GFEDAAEQFSMIFGGDAFASY 100

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa]
          {ON} Anc_1.398 YNL007C
          Length = 353

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 45/67 (67%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV+  A+  EIKK YR+ AL++HPDK + ++       KFKE++ A+E+LS+  KR
Sbjct: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDSNKR 61

Query: 64 RNYDTYG 70
            YD YG
Sbjct: 62 SVYDQYG 68

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 64/148 (43%), Gaps = 9/148 (6%)

Query: 209 GKRVTPETKNLNVYIPRGSRHNDRIVLEGEADEEP---GKLTGDLVFDISEDSTTSNLER 265
           G R  PE   +++ +  G +   ++  +   D  P   G+ T  L F I E       +R
Sbjct: 208 GMRGEPEKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKT--LQFIIKEKKHPL-YKR 264

Query: 266 RGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDD 325
            G ++   + ++  ++L GF K    TLDGR L L     Q ++P        +G P+  
Sbjct: 265 DGDNIIYTLPLTFKESLLGFSK-TLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISK 321

Query: 326 EGKKFGNMYVQINIEFPPDHWYSERGEI 353
              + GN+ ++  I +P     S+R  I
Sbjct: 322 NPGQRGNLIIKYKINYPISLTDSQRRAI 349

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (64%), Gaps = 3/77 (3%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREES---EIKFKEVAAAYELL 57
            DPY  LGV+P AT  +IK AYR+L+++ HPDK+S +   EE    E  + +++ AYE L
Sbjct: 122 FDPYALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYEAL 181

Query: 58  SNEEKRRNYDTYGDTNG 74
           ++E  + NY TYG  +G
Sbjct: 182 TDEITKANYLTYGHPDG 198

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
           (DJP1) - involved in peroxisome biogenesis [contig 135]
           FULL
          Length = 421

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 53/98 (54%), Gaps = 7/98 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV P A   +IKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++LS E+ R
Sbjct: 9   YDLLGVDPSAKAIDIKKAYRKKSVQEHPDKNPNDPTATE---RFQAISQAYQVLSKEDLR 65

Query: 64  RNYDTYGDTNGYSDSYGGFQDG--DFASFFGNFASGRY 99
             YD YG          GF+D    F+  FG  A   Y
Sbjct: 66  AKYDKYGKEEAIPKE--GFEDAAEQFSMIFGGDAFASY 101

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa]
          {ON} highly similar to uniprot|P39101 YER048C
          Saccharomyces cerevisiae CAJ1 Nuclear type II J heat
          shock protein of the E. coli dnaJ family
          Length = 393

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LG++PDAT  EIKKAYR+ A+  HPDK  ++    +++ KF+ V  AY++LS+   R
Sbjct: 8  YDALGISPDATPTEIKKAYRKKAMLTHPDKHPNDP---DAQAKFQAVGQAYQVLSDPGLR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDGD--FASFFG 92
            YD +G  +       GF+D    F + FG
Sbjct: 65 SRYDEFGKDDAVPQQ--GFEDAGEFFTTIFG 93

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 45/67 (67%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV+P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++   R
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPNTR 61

Query: 64 RNYDTYG 70
            YD YG
Sbjct: 62 EVYDQYG 68

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 63/131 (48%), Gaps = 9/131 (6%)

Query: 215 ETKNLNVYIPRGSRHNDRIVLEGEADEEP---GKLTGDLVFDISEDSTTSNLERRGSDLH 271
           E   +++ +  G +   ++  + + D  P   G+ T  L F I E +   + +R G DL 
Sbjct: 188 EKTQIDIQLRPGWKAGTKVTYKNQGDYNPRSGGRKT--LQFVIQEKAH-PDFKRDGDDLI 244

Query: 272 TKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFG 331
             + +S  ++L GF K +  T+DGR  +L +   Q I+P        +G P+     + G
Sbjct: 245 YILRLSFKESLLGFSKTI-NTIDGR--KLPLSRSQPIQPTEISTYPGQGMPVSKNPSQRG 301

Query: 332 NMYVQINIEFP 342
           N+ ++  I++P
Sbjct: 302 NLIIKYKIDYP 312

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON}
          Anc_1.398
          Length = 367

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 45/67 (67%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD L V P A + E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++ +KR
Sbjct: 8  YDLLNVQPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQKR 61

Query: 64 RNYDTYG 70
            YD YG
Sbjct: 62 EIYDQYG 68

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 72/147 (48%), Gaps = 12/147 (8%)

Query: 215 ETKNLNVYIPRGSRHNDRIVLEGEADEEP---GKLTGDLVFDISEDSTTSNLERRGSDLH 271
           E   +++ +  G +   +I  + + D  P   G+ T  L F ISE     + +R   +L 
Sbjct: 228 EKTQIDIQLKPGWKAGTKITYKSKGDYNPKTGGRKT--LQFIISE-KPHPHFKREDDNLI 284

Query: 272 TKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFG 331
             + ++  ++L GF K +  T+DG++L L    GQ ++P        +G P+  +  + G
Sbjct: 285 YTLPLTFKESLLGFSKTI-QTIDGKNLPLS--RGQPVQPSETTTYPGQGMPITKKPGQRG 341

Query: 332 NMYVQINIEFPPDHWYSERGEIEALRN 358
           ++ ++  +++P +   ++R   EA+ N
Sbjct: 342 DLLIKYKVDYPINLTPAQR---EAISN 365

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytosolic
           J-domain-containing protein, required for peroxisomal
           protein import and involved in peroxisome assembly,
           homologous to E. coli DnaJ
          Length = 432

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 55/98 (56%), Gaps = 7/98 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+  A+  EIKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++L +++ R
Sbjct: 8   YDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLGDDDLR 64

Query: 64  RNYDTYGDTNGYSDSYGGFQDG--DFASFFGNFASGRY 99
             YD YG         GGF+D    F+  FG  A   Y
Sbjct: 65  AKYDKYGRKEAIPQ--GGFEDAAEQFSVIFGGDAFASY 100

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
          similar to Ashbya gossypii AAL008W
          Length = 347

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 45/67 (67%), Gaps = 6/67 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD LGV+P+    E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++  KR
Sbjct: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPNKR 61

Query: 64 RNYDTYG 70
            YD YG
Sbjct: 62 EVYDKYG 68

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 63/134 (47%), Gaps = 3/134 (2%)

Query: 209 GKRVTPETKNLNVYIPRGSRHNDRIVLEGEADEEPGKLTGDLVFDISEDSTTSNLERRGS 268
           G    PE K +++ +  G +   +I  + E D  P       +  I ++     L+R G+
Sbjct: 202 GPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGN 261

Query: 269 DLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGK 328
           DL   + +S  ++L GF K V  T+DGR  ++ I   Q ++P        +G PL     
Sbjct: 262 DLTYTLPLSFKESLLGFSKTVH-TIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPS 318

Query: 329 KFGNMYVQINIEFP 342
           + G++ V+  I++P
Sbjct: 319 ERGDLIVKYKIDYP 332

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
           (REAL)
          Length = 431

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 54/98 (55%), Gaps = 7/98 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+  A+  EIKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++L + E R
Sbjct: 8   YDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDPKATE---RFQAISEAYQVLGDNELR 64

Query: 64  RNYDTYGDTNGYSDSYGGFQDG--DFASFFGNFASGRY 99
             YD YG         GGF+D    F+  FG  A   Y
Sbjct: 65  VKYDKYGRKEAIPQ--GGFEDAAEQFSVIFGGDAFASY 100

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
           (REAL)
          Length = 421

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 55/98 (56%), Gaps = 7/98 (7%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD LGV+  A+  EIKKAYR+ ++Q HPDK  ++    E   +F+ ++ AY++L ++E R
Sbjct: 8   YDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDLKATE---RFQAISEAYQVLGDDELR 64

Query: 64  RNYDTYGDTNGYSDSYGGFQDG--DFASFFGNFASGRY 99
             YD +G         GGF+D    F+  FG  A   Y
Sbjct: 65  AKYDKFGRKEAIPQ--GGFEDAAEQFSVIFGGDAFASY 100

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 56/84 (66%), Gaps = 2/84 (2%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V P A  +E+KKAYRR ALQ+HPDK + E++ E +EI F  + AAYE+LS+ ++R
Sbjct: 6  YELLDVQPFADDNELKKAYRRKALQYHPDK-NPENVEEATEI-FASIRAAYEVLSDPQER 63

Query: 64 RNYDTYGDTNGYSDSYGGFQDGDF 87
            YD++ +     +  G  +DG+F
Sbjct: 64 AWYDSHKEQILNDEPIGLNEDGEF 87

>YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protein
          of unknown function, contains a CSL Zn finger and a
          DnaJ-domain; involved in diphthamide biosynthesis;
          ortholog human Dph4
          Length = 172

 Score = 59.7 bits (143), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 39/64 (60%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ L +  DATQDEIKKAYR   L  HPDK+S       S +   ++  AY++LSN + R
Sbjct: 10 YEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILSNIKTR 69

Query: 64 RNYD 67
          R YD
Sbjct: 70 REYD 73

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
           (REAL)
          Length = 225

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 58/121 (47%), Gaps = 23/121 (19%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           Y  L V   AT  EIKKAYR+LA++ HPDK       E     FK +  A+E+LSNEEKR
Sbjct: 23  YQILKVDKKATDGEIKKAYRKLAIKLHPDKNPHPKASEA----FKIINRAFEVLSNEEKR 78

Query: 64  RNYDTYG---------DTNGYSDSY----------GGFQDGDFASFFGNFASGRYEDEED 104
             YD  G          + G +  +          GGF+D  F S FG   +G  ED  D
Sbjct: 79  GLYDRIGRDPDDRQMPSSRGAASGFQGNAGGSPMGGGFEDMFFNSRFGGQRAGPPEDIFD 138

Query: 105 F 105
           F
Sbjct: 139 F 139

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 56/87 (64%), Gaps = 10/87 (11%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKV-----SDE-SLREESEIKFKEVAAAY 54
            DPY+ LG++  A+  +IK AYR+L+++ HPDKV     SDE S+ EE+   + ++  AY
Sbjct: 124 FDPYEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEET---YVQITKAY 180

Query: 55  ELLSNEEKRRNYDTYGDTNG-YSDSYG 80
           E L++E  R+NY  YG  +G  S S+G
Sbjct: 181 ESLTDELVRQNYLKYGHPDGPQSTSHG 207

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 50/77 (64%), Gaps = 3/77 (3%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREE---SEIKFKEVAAAYELL 57
            DPY+ LG++  A+  +IK AYR+L+++ HPDK+S +  +EE    E K+ ++  AYE L
Sbjct: 120 FDPYELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEAL 179

Query: 58  SNEEKRRNYDTYGDTNG 74
           ++E  + N+  YG  +G
Sbjct: 180 TDEVIKENFLKYGHPDG 196

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 48/77 (62%), Gaps = 3/77 (3%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVS---DESLREESEIKFKEVAAAYELL 57
            DPY+ LG++  A++ +IK AYR+L+++ HPDK+S    E  R   E  + ++  AYE L
Sbjct: 128 FDPYELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEAL 187

Query: 58  SNEEKRRNYDTYGDTNG 74
           ++E  R N+  YG  +G
Sbjct: 188 TDEAMRENFLKYGHPDG 204

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 47/77 (61%), Gaps = 3/77 (3%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVS---DESLREESEIKFKEVAAAYELL 57
            DPY+ LGV   +T  EIK AYR+L+++ HPDK+S   +E  R   E +F  +  AY+ L
Sbjct: 110 FDPYELLGVTLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKAL 169

Query: 58  SNEEKRRNYDTYGDTNG 74
           ++E  + NY  YG  +G
Sbjct: 170 TDEITKENYRKYGHPDG 186

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 53/91 (58%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ LG+   AT  EIKKAYR+ +++ HPDK  ++    E   +F+ ++ AY++LS+ + R
Sbjct: 8  YELLGIETTATAVEIKKAYRKKSIEEHPDKNPNDPGATE---RFQAISEAYQVLSDSDLR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDG--DFASFFG 92
           NYD +G         GGF+D    F+  FG
Sbjct: 65 ANYDKFGKEKAIPK--GGFEDAAEQFSVIFG 93

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 56/87 (64%), Gaps = 10/87 (11%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVS------DESLREESEIKFKEVAAAY 54
            DPY+ LG++  A+  +IK AYR+L+++ HPDK++      ++S+ EE+ +   ++  AY
Sbjct: 124 FDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYV---QITKAY 180

Query: 55  ELLSNEEKRRNYDTYGDTNG-YSDSYG 80
           E L++E  R+NY  YG  +G  S S+G
Sbjct: 181 ESLTDELVRQNYLKYGHPDGPQSTSHG 207

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 53/84 (63%), Gaps = 4/84 (4%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEI---KFKEVAAAYELL 57
            DPY+ LG++  A+  +IK AYR+L+++ HPDK++     +E ++    + ++  AYE L
Sbjct: 124 FDPYEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYESL 183

Query: 58  SNEEKRRNYDTYGDTNG-YSDSYG 80
           ++E  R+NY  YG  +G  S S+G
Sbjct: 184 TDELVRQNYLKYGHPDGPQSTSHG 207

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 53/91 (58%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD L +   AT  EIKKAYR+ +++ HPDK  ++    E   +F+ ++ AY++LS++  R
Sbjct: 8  YDLLDIDITATAIEIKKAYRKKSIKEHPDKNPNDPTATE---RFQAISEAYQVLSDKNLR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDG--DFASFFG 92
           NYD +G         GGF+D    F++ FG
Sbjct: 65 ANYDKFGKEKAIPK--GGFEDAAEQFSAIFG 93

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (62%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ L +  DATQ+EIKKAYR   L  HPDK++  +    + +   ++  AY++LSN +KR
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTINKIQDAYKILSNNQKR 69

Query: 64 RNYD 67
            YD
Sbjct: 70 GEYD 73

>NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa]
           {ON} Anc_1.297
          Length = 635

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 53/94 (56%), Gaps = 6/94 (6%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEI--KFKEVAAAYELLSN 59
           D Y  L V+ DA   +I+K+Y  L  + HPDK    S +E+ +I  K  E+  AYE+LS+
Sbjct: 527 DYYKILDVSKDAGAKDIRKSYLNLTKKFHPDKQGQLSEKEQKKIQEKMSEINEAYEVLSD 586

Query: 60  EEKRRNYDT--YGDTNGYSDSYGGFQDGDFASFF 91
           E KR  YD    G+ NG ++  GG Q+ DF   F
Sbjct: 587 ETKRNEYDLNRSGNHNGMAN--GGAQNFDFGRMF 618

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 53/85 (62%), Gaps = 6/85 (7%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKE----VAAAYEL 56
            DPY+ LG+   AT+ E++ +YR+L+++ HPDK+S + L +E  ++ +E    +  AY+ 
Sbjct: 114 FDPYELLGIGTSATEREVRSSYRKLSVKFHPDKLSKD-LSQEERLQLEEQYVLITKAYKA 172

Query: 57  LSNEEKRRNYDTYGDTNG-YSDSYG 80
           L+ E  R NY  YG  +G  S S+G
Sbjct: 173 LTEEVTRENYLKYGHPDGPQSTSHG 197

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD L V  DA+  ++KKAYRR ALQ+HPDK  D    EE+   F E+ AAYE+LS+ ++R
Sbjct: 6  YDLLEVRSDASDLDLKKAYRRKALQYHPDKNPDNV--EEATTIFAEIRAAYEVLSDPQER 63

Query: 64 RNYDTY 69
            YD++
Sbjct: 64 AWYDSH 69

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 52/84 (61%), Gaps = 4/84 (4%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEI---KFKEVAAAYELL 57
            DPY+ LGV+  A+  +IK AYR+L+++ HPDK++     +E  +    + ++  AYE L
Sbjct: 124 FDPYEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAYESL 183

Query: 58  SNEEKRRNYDTYGDTNG-YSDSYG 80
           ++E  R+NY  YG  +G  S S+G
Sbjct: 184 TDELVRQNYLKYGHPDGPQSTSHG 207

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (59%), Gaps = 4/84 (4%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDE---SLREESEIKFKEVAAAYELL 57
            DPY+ LGV+  A   EIK AYR+L+++ HPDK+  +     R + E  + ++  AYE L
Sbjct: 121 FDPYEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYESL 180

Query: 58  SNEEKRRNYDTYGDTNG-YSDSYG 80
           ++E  + NY  YG  +G  S S+G
Sbjct: 181 TDENVKENYLRYGHPDGPQSTSHG 204

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 51/84 (60%), Gaps = 4/84 (4%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSD---ESLREESEIKFKEVAAAYELL 57
            DPY  LGVA  AT  E++ AYR+L+++ HPDK++    +  R E E ++  +  AY+ L
Sbjct: 115 FDPYTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKAL 174

Query: 58  SNEEKRRNYDTYGDTNG-YSDSYG 80
           ++E  + NY  +G  +G  S S+G
Sbjct: 175 TDEITKENYLKFGHPDGPQSTSHG 198

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
           Anc_2.350 YMR161W
          Length = 225

 Score = 57.8 bits (138), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 59/113 (52%), Gaps = 15/113 (13%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           Y+ L +   A+ +EIKK+YR+LA++ HPDK       E     FK +  A+E+LS+EEKR
Sbjct: 26  YEVLQIERSASDNEIKKSYRKLAIKLHPDKNPHPRASE----AFKVINRAFEVLSDEEKR 81

Query: 64  RNYDTYG-----------DTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDF 105
           R YD  G            ++G+  +  GF  G   SF+   A+ R   E+ F
Sbjct: 82  RLYDRLGRDPDDRNMPSASSSGFRTASAGFPAGFENSFYSRRAATRDPGEDIF 134

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 50/83 (60%), Gaps = 11/83 (13%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV   A+  E+KKAYR+ ALQ+HPDK  D    EE+  KF  + AAYE+LS+ ++R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNV--EEATQKFAIIRAAYEVLSDSQER 63

Query: 64 RNYDTYG---------DTNGYSD 77
            YD++          D +GY D
Sbjct: 64 AWYDSHKEQILNDTPPDADGYYD 86

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 50/83 (60%), Gaps = 11/83 (13%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV   A+  E+KKAYR+ ALQ+HPDK  D    EE+  KF  + AAYE+LS+ ++R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNV--EEATEKFAIIRAAYEVLSDSQER 63

Query: 64 RNYDTYG---------DTNGYSD 77
            YD++          D +GY D
Sbjct: 64 AWYDSHKEQILNDTPPDADGYYD 86

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 56/93 (60%), Gaps = 13/93 (13%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV+  A   E+KKA+RR ALQ+HPDK  D    EE+   F ++ AAYE+L++ ++R
Sbjct: 6  YELLGVSSTADDLELKKAFRRKALQYHPDKNRDNV--EEATETFAQIRAAYEVLNDPQER 63

Query: 64 RNYDTYG------DTNGYSDSYGGFQDGDFASF 90
            YD++       D NG     G ++D ++ S+
Sbjct: 64 AWYDSHKSQILNDDING-----GTYEDDEYGSY 91

>KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON}
          Anc_7.217 YER048C
          Length = 373

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 48/91 (52%), Gaps = 7/91 (7%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV PDAT  EIKKAYR+ AL   P+K        E   KF+ +A AY++L ++E R
Sbjct: 8  YELLGVEPDATSSEIKKAYRKKALSMLPEKHPSNIGANE---KFQAIAEAYQVLHSKELR 64

Query: 64 RNYDTYGDTNGYSDSYGGFQDGD--FASFFG 92
            YD  G          GF+D    F + FG
Sbjct: 65 EKYDKLGKEAAIPKK--GFEDASEYFPTIFG 93

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {ON}
           Anc_2.15 YNL227C
          Length = 626

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 57/119 (47%), Gaps = 24/119 (20%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           Y+ LGV  +AT  E+KKAYRR ALQ HPDK  D    EE+   F  V AAYE+L++ ++R
Sbjct: 6   YELLGVETNATDVELKKAYRRKALQFHPDKNPDNV--EETTAIFASVRAAYEVLADPQER 63

Query: 64  RNYDTYGD----------------------TNGYSDSYGGFQDGDFASFFGNFASGRYE 100
             YD + +                      T   SD    F +    + FGN  SG Y+
Sbjct: 64  AWYDDHKEQILNDSVNLDDADDESHLDSSITGVTSDELLMFFNSSLYTNFGNSPSGVYQ 122

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {ON}
           some similarities with uniprot|P48353 Saccharomyces
           cerevisiae YMR161W
          Length = 233

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 60/117 (51%), Gaps = 17/117 (14%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           Y+ L +  +A+ +EIKKAYR+LA++ HPDK       E     FK +  A+E+LS+E+KR
Sbjct: 24  YEVLQIEREASDNEIKKAYRKLAIKLHPDKNKHPRASE----AFKRINRAFEVLSDEQKR 79

Query: 64  RNYDTYGD-----------TNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHA 109
           R +D  G             +G S +  GF   +   FF     G+ +D  DF  +A
Sbjct: 80  RIFDQVGHDPDERPVRDPFASGRSTATAGFPPENM--FFRRAPGGQPQDIFDFLFNA 134

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 7/85 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV   A+  E+KKAYR+ ALQ+HPDK  D    EE+  KF  + AAYE+LS+ ++R
Sbjct: 6  YELLGVETHASDLELKKAYRKKALQYHPDKNPDNV--EEATQKFAVIRAAYEVLSDPQER 63

Query: 64 RNYDTY-----GDTNGYSDSYGGFQ 83
            YD++      DT   +D Y  ++
Sbjct: 64 AWYDSHKEQILNDTPPSTDDYYDYE 88

>CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097w
          Length = 175

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 48/87 (55%), Gaps = 6/87 (6%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVS----DESLREESEIKFKEVAAAYELLSN 59
          Y+ LGV  DA+ DEIK  YR++ L  HPDK      D +++  S +   ++  AY +LSN
Sbjct: 12 YEVLGVPVDASTDEIKLTYRKMLLTLHPDKSKTVPIDSTIKIRSGVSINQIQEAYRVLSN 71

Query: 60 EEKRRNYD-TYGDTNGYSDSYGGFQDG 85
          ++ R  Y+    D+N  +  +  F DG
Sbjct: 72 DQLRAAYNRALNDSNKLA-GFNNFGDG 97

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 47/68 (69%), Gaps = 2/68 (2%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD L V  DAT  ++K+AYR+ AL +HPDK +  ++ E +E+ F ++ AAYE+LS+ ++R
Sbjct: 6  YDLLDVKSDATDTDLKRAYRKKALLYHPDK-NRNNIEEATEV-FAQIRAAYEVLSDAQER 63

Query: 64 RNYDTYGD 71
            YD + D
Sbjct: 64 AWYDAHKD 71

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (63%), Gaps = 11/83 (13%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV   A+  E+KKAYR+ ALQ+HPDK  D +++E +E KF  + AAYE+LS+ ++R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPD-NVQEATE-KFAIIRAAYEVLSDPQER 63

Query: 64 RNYDTYG---------DTNGYSD 77
            YD++          D +GY D
Sbjct: 64 AWYDSHKEQILNDTAPDADGYYD 86

>NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON}
          Anc_1.185 YJL162C
          Length = 491

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 4/65 (6%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y  LG+ P AT +EI+K+Y +LA Q HPDK   +S  E     FK V  A+ +L++EE +
Sbjct: 9  YSILGLTPKATDNEIRKSYMKLARQLHPDKSKSDSCAE----LFKLVVHAHSILTDEETK 64

Query: 64 RNYDT 68
          R YDT
Sbjct: 65 RKYDT 69

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
           Anc_2.350 YMR161W
          Length = 219

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 50/92 (54%), Gaps = 8/92 (8%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           Y+ L V   A+ +EIKKAYRRLA++ HPDK         S   FK +  A+E+L +E+KR
Sbjct: 25  YEVLQVERTASDNEIKKAYRRLAIKLHPDKNG----HPRSAEAFKVINRAFEVLGDEDKR 80

Query: 64  RNYDTYG----DTNGYSDSYGGFQDGDFASFF 91
           R +D  G    D +  S    GF  G  + FF
Sbjct: 81  RLFDQLGRDPDDRSAPSRGPSGFDGGVRSPFF 112

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 47/77 (61%), Gaps = 3/77 (3%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVS-DESLREES--EIKFKEVAAAYELL 57
            DPY  L V+  +T  EI+ AYR+L+++ HPDK+S D S  E S  E ++  +  AY+ L
Sbjct: 116 FDPYALLDVSASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKAL 175

Query: 58  SNEEKRRNYDTYGDTNG 74
           ++E  R NY  YG  +G
Sbjct: 176 TDEVTRENYLKYGHPDG 192

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V   +T++EIKKAYR+LA++ HPDK       E     FK +  A+E+LS+ EKR
Sbjct: 23 YEILKVERTSTENEIKKAYRKLAIRLHPDKNPHPKASE----AFKIINRAFEVLSDNEKR 78

Query: 64 RNYDTYG 70
          R +D  G
Sbjct: 79 RIFDQLG 85

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 44/68 (64%), Gaps = 2/68 (2%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEI--KFKEVAAAYELLSN 59
           D Y  LG++  A+  EI+KAY  L  ++HPDK    S +E+ +I  K  +V  AYE+LS+
Sbjct: 522 DYYKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKIHEKMSQVNEAYEILSD 581

Query: 60  EEKRRNYD 67
           E K+R+YD
Sbjct: 582 EGKKRDYD 589

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 52/83 (62%), Gaps = 4/83 (4%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV   A+  ++KKAYRR ALQ+HPDK  D    EE+   F  + +AYE+L++ ++R
Sbjct: 6  YELLGVETTASDSDLKKAYRRKALQYHPDKNPDNV--EEATTVFATIRSAYEVLADPQER 63

Query: 64 RNYDTYGDTNGYSDSYGGFQDGD 86
            YD++      SD +G  ++GD
Sbjct: 64 AWYDSHK-QQILSDDFGA-ENGD 84

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 2/68 (2%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEI--KFKEVAAAYELLSN 59
           D Y  LGVAP AT  EI+KAY  L  ++HPDK+      +E  I     ++  AYE LS+
Sbjct: 535 DYYKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHNDKEETIHETMSQINEAYETLSD 594

Query: 60  EEKRRNYD 67
           ++KR+ YD
Sbjct: 595 DDKRKEYD 602

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 53/102 (51%), Gaps = 14/102 (13%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKV------SDESLREESEIKFKEVAAAYE 55
           D Y TLGV P AT  EI+KAY  L  ++HPDK+        ES+ E       ++  AYE
Sbjct: 538 DYYKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHET----MSQINEAYE 593

Query: 56  LLSNEEKRRNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASG 97
            LS++ KR+ YD    +N + ++   F  G   S F N  +G
Sbjct: 594 ALSDDNKRKEYDL-SRSNPHRNT---FAQGPRQSMFKNQGNG 631

>NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON}
          Anc_1.113
          Length = 190

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 39/70 (55%), Gaps = 6/70 (8%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESL------REESEIKFKEVAAAYELL 57
          Y+ L +  DAT  EIKKAY++  L  HPDK S + L       + + +   ++  AY++L
Sbjct: 11 YEVLNINSDATLQEIKKAYKQKLLNIHPDKSSTQILPISITTNDLTSVSINQIQQAYKIL 70

Query: 58 SNEEKRRNYD 67
          SNE  R  YD
Sbjct: 71 SNESTREQYD 80

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV   AT  E+KKAYR+ ALQ HPDK  D ++ E +EI F  + +AYE+LS+ ++R
Sbjct: 6  YELLGVDITATDIELKKAYRKKALQFHPDKNPD-NVEEATEI-FATIRSAYEVLSDPQER 63

Query: 64 RNYDTY 69
            YD +
Sbjct: 64 AWYDAH 69

>Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 40/64 (62%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ L +  DATQ+EIKKAYR   L  HPDK++ ++  + + +    +  AY++LSN + R
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLAKKTSNKVNSVTIDTIQDAYKVLSNIKTR 69

Query: 64 RNYD 67
            YD
Sbjct: 70 GEYD 73

>Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AFR507W
          Length = 492

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 48/69 (69%), Gaps = 4/69 (5%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           DPY+TLGV+ DA+  +IKKAY +LA ++HPD   DE     +E KF ++  AYE+LS+E 
Sbjct: 51  DPYETLGVSRDASTSQIKKAYYKLAKKYHPDINKDEG----AEKKFHDLQNAYEILSDES 106

Query: 62  KRRNYDTYG 70
           KR  YD +G
Sbjct: 107 KRSQYDQFG 115

>KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON}
           Anc_2.350 YMR161W
          Length = 175

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 46/86 (53%), Gaps = 5/86 (5%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD +GV    +Q ++K +Y+ L  + HPDK S    +E     F  V  AY+ LSN++KR
Sbjct: 25  YDVIGVDIGVSQRQLKMSYKELITKLHPDKNSSPGAKEA----FALVHKAYKTLSNKQKR 80

Query: 64  RNYDTYGDTNGYSDSYGGFQDGDFAS 89
             YD YG+ + +S    G  D  F S
Sbjct: 81  AMYDKYGN-DAFSRKTDGSADKPFNS 105

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/61 (45%), Positives = 38/61 (62%), Gaps = 4/61 (6%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V   A+  EIKKAYR+LA++ HPDK       E     FK +  A+E+LS+E+KR
Sbjct: 24 YEVLRVEKQASDLEIKKAYRKLAIKLHPDKNKHPRASE----AFKRINRAFEVLSDEQKR 79

Query: 64 R 64
          R
Sbjct: 80 R 80

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (59%), Gaps = 3/77 (3%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEI---KFKEVAAAYELL 57
            DPY  L ++  +T  EI+ AYR+L+++ HPDK+S +   +E  +   ++  +  AY+ L
Sbjct: 114 FDPYALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYKAL 173

Query: 58  SNEEKRRNYDTYGDTNG 74
           ++E  R NY  YG  +G
Sbjct: 174 TDEITRENYLRYGHPDG 190

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V   A++ +IKKAYR+LA++ HPDK       E     FK++  A+E+LS++ KR
Sbjct: 24 YEMLKVGKSASESDIKKAYRKLAIKLHPDKNRHPRASE----AFKKINRAFEVLSDDSKR 79

Query: 64 RNYDTYG 70
          R +D  G
Sbjct: 80 RIFDQLG 86

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
           [687 nt, 229 aa]
          Length = 228

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 46/84 (54%), Gaps = 7/84 (8%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           D Y+ L V   + + EIKK+YR+LA++ HPDK       E     FK +  A+E+LS+ E
Sbjct: 22  DFYNVLKVERSSDETEIKKSYRKLAIKLHPDKNPHPKASE----AFKVINRAFEVLSDNE 77

Query: 62  KRRNYDTYG---DTNGYSDSYGGF 82
           KR  +D  G   D  G S S  GF
Sbjct: 78  KREIFDRIGRDPDDRGVSSSASGF 101

>NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8.698
           YOR254C
          Length = 680

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (63%), Gaps = 3/77 (3%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREE---SEIKFKEVAAAYELL 57
            DPYD LG++  ++  +IK AYR+L+++ HPDK+S +   +E    E K+ ++  AYE L
Sbjct: 121 FDPYDILGISSSSSDKDIKSAYRKLSIKFHPDKLSKDLSADERIVMEEKYVQITKAYEAL 180

Query: 58  SNEEKRRNYDTYGDTNG 74
           ++E  R NY  YG  +G
Sbjct: 181 TDETVRENYLKYGHPDG 197

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV   AT  E+KKAYR+ ALQ HPDK  D ++ E +EI F  + +AYE+LS+ ++R
Sbjct: 6  YELLGVDVTATDLELKKAYRKKALQFHPDKNPD-NVDEATEI-FATIRSAYEVLSDPQER 63

Query: 64 RNYDTY 69
            YD +
Sbjct: 64 AWYDAH 69

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 42/72 (58%), Gaps = 10/72 (13%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKV------SDESLREESEIKFKEVAAAYE 55
           D Y  LGV+P+A   EI+KAY  L  ++HPDK+        ES+ E       ++  AYE
Sbjct: 542 DYYKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHET----MSQINEAYE 597

Query: 56  LLSNEEKRRNYD 67
            LS+E+KR+ YD
Sbjct: 598 TLSDEDKRKEYD 609

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV   A+  ++KKAYRR ALQ+HPDK +  ++++ +EI F  + AAYE+LS+ ++R
Sbjct: 6  YELLGVDSGASDTDLKKAYRRKALQYHPDK-NIGNVQQATEI-FASIRAAYEVLSDAQER 63

Query: 64 RNYDTY 69
            YD +
Sbjct: 64 AWYDAH 69

>TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {ON}
           Anc_1.113 YJR097W
          Length = 159

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 58/130 (44%), Gaps = 22/130 (16%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           Y+TLG+  D + +EIKKAY+   L  HPDK+ DES    S ++  ++  AY++L +   R
Sbjct: 6   YETLGLNSDCSLEEIKKAYKEKLLSSHPDKIGDES----SSVEVNKIQEAYKVLCDVNLR 61

Query: 64  RNYD----TYGDTNGYSDSYGGFQDGDFASFFGNFA--------------SGRYEDEEDF 105
             YD          G+  S  G  D     F+ N A               G +  EE  
Sbjct: 62  EKYDESLKKQYKHQGFLGSGDGLDDYSLDEFYFNPAIMEYCMDCPRCHGKDGFHFSEETL 121

Query: 106 RAHARPRTDD 115
             HA+ ++ D
Sbjct: 122 EEHAQEKSKD 131

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V   A+ +EIKKAYR+LA++ HPDK +     E     FK +  A+E+LS+  KR
Sbjct: 26 YELLQVEKGASDNEIKKAYRKLAIRLHPDKNTHPRASE----AFKRINRAFEVLSDVGKR 81

Query: 64 RNYDTYG 70
          R +D  G
Sbjct: 82 RMFDQLG 88

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {ON}
           Anc_2.350 YMR161W
          Length = 227

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 56/113 (49%), Gaps = 15/113 (13%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
           YD L V   A  +EIKK+YR+LA++ HPDK       E     FK +  A+E+L +E+KR
Sbjct: 26  YDILKVDKTAQDNEIKKSYRKLAIKLHPDKNPHPKASEA----FKRINRAFEVLGDEKKR 81

Query: 64  RNYDTYG---------DTNGYSDSYGGFQDGDFASFFGN--FASGRYEDEEDF 105
             +D  G         +++  +  + G   G+  S F N  F  GR   E+ F
Sbjct: 82  VLFDRIGRDPDDRSVPESSATASGFRGHNHGNMPSSFENMFFQRGRNPQEDLF 134

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V   A+  +IKKAYR++A++ HPDK       E     FK+V  A+E+LS+E+KR
Sbjct: 26 YELLQVDEKASDGDIKKAYRKMAIKLHPDKNRHPRAAE----AFKKVNRAFEVLSDEKKR 81

Query: 64 RNYDTYG 70
          R YD  G
Sbjct: 82 RVYDQLG 88

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V+  A+  E+KKAYR+ ALQ+HPDK  +    EE+   F E+ AAYE+LS+ ++R
Sbjct: 6  YELLEVSEYASDLELKKAYRKKALQYHPDKNRENP--EEATAIFSEIRAAYEVLSDPQER 63

Query: 64 RNYDTY 69
            YD++
Sbjct: 64 AWYDSH 69

>KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa]
          {ON} conserved hypothetical protein
          Length = 283

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 48/91 (52%), Gaps = 7/91 (7%)

Query: 1  MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNE 60
          +DPY+ LGV    T+ E+KK YR+L L+ HPDK  D +   E++ KF ++  A+E+L   
Sbjct: 13 IDPYEVLGVNKSVTEKELKKCYRKLMLRCHPDKTKDWT--PEAKEKFHKIQFAFEVLD-- 68

Query: 61 EKRRNYDTYGDTNGYSDSYGGFQDGDFASFF 91
             +  +TY  T      + G    D+   F
Sbjct: 69 ---KFKETYDKTGSVEACFKGSDFADWKDLF 96

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 2/82 (2%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV   A+  E+KKAYR+ ALQ HPDK  D    +E+   F  + AAYE+LS+ ++R
Sbjct: 6  YELLGVEVTASDAELKKAYRKKALQFHPDKNPDNV--DEATENFATIRAAYEVLSDPQER 63

Query: 64 RNYDTYGDTNGYSDSYGGFQDG 85
            YD + +        G  +DG
Sbjct: 64 AWYDAHKEQILNDSPIGTAEDG 85

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V   A  +EIKKAYR+LA++ HPDK       E     FK +  A+E+LS+ EKR
Sbjct: 24 YEILKVEKTANDNEIKKAYRKLAVKLHPDKNPHPKASE----AFKIINRAFEVLSDVEKR 79

Query: 64 RNYDTYG 70
          + YD  G
Sbjct: 80 QLYDRIG 86

>ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR061C
          Length = 305

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 53/109 (48%), Gaps = 6/109 (5%)

Query: 3   PYDTLGVAPDAT-QDEIKKAYRRLALQHHPDKV--SDESLREESEIK-FKEVAAAYELLS 58
           PY+ LG+        ++KK Y  LA  +HPD    + + L E   ++ FK V  AY LLS
Sbjct: 92  PYEVLGLVKTGVDARQLKKRYHELAKLYHPDTAGAAQQGLGEHERLRRFKLVNEAYALLS 151

Query: 59  NEEKRRNYDTY--GDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDF 105
           +  +RR YD Y  G  +G +        G +   +  + +G +ED +D 
Sbjct: 152 DASRRRMYDMYATGWAHGPAPMAPAMAHGAYHERYAYYNAGTWEDMQDL 200

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 4/67 (5%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD L V   A   EIKK+YR+LA++ HPDK       E     FK +  A+E+LS++EKR
Sbjct: 26 YDILNVQKSADSVEIKKSYRKLAIKLHPDKNPHPKAGE----AFKVINRAFEVLSDDEKR 81

Query: 64 RNYDTYG 70
            +D  G
Sbjct: 82 SVFDRIG 88

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 41/68 (60%), Gaps = 2/68 (2%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEI--KFKEVAAAYELLSN 59
           D Y  LGV+P A+  EI+KAY  L  ++HPDK+      ++  I     ++  AYE LS+
Sbjct: 538 DYYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLSD 597

Query: 60  EEKRRNYD 67
           ++KR+ YD
Sbjct: 598 DDKRKEYD 605

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ L +  +A+  ++KKAYR+LA++ HPDK       E     FK++  A+E+LS+E KR
Sbjct: 26 YELLQIDKEASDSDVKKAYRKLAIKLHPDKNRHPRAAE----AFKKINRAFEVLSDENKR 81

Query: 64 RNYDTYG 70
          + YD  G
Sbjct: 82 KVYDQIG 88

>Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to
          Ashbya gossypii AFR639W
          Length = 156

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (59%), Gaps = 8/67 (11%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDK--VSDESLREESEIKFKEVAAAYELLSNEE 61
          Y  LG+  DA  D IKKAYRR  L+ HPDK  +S+ESL  +      ++  AY +L ++E
Sbjct: 6  YSVLGIDSDADSDTIKKAYRRRLLETHPDKKQISNESLSVD------QLQKAYRVLIDKE 59

Query: 62 KRRNYDT 68
           R  YD+
Sbjct: 60 LRAKYDS 66

>KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 471

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 109/266 (40%), Gaps = 33/266 (12%)

Query: 112 RTDDAHVSLRLTMQD-LYNGKTVRFQSTRNVVCNRCEGAGIRKRARHA-SACTHCEGHGV 169
           + ++  V  +++ +D ++  K V+        C+ C+G+G++  A H+ S C  C G G 
Sbjct: 168 KGENVTVPFQVSFKDAVFGVKNVKLNYQCYDPCSSCDGSGLK--AGHSRSVCPTCHGTGT 225

Query: 170 KQRLRRLGPGFVTRETVQCTKCRGLGKNLRSEDLCKKCHGKRVTPET-KNLNVYIPRGSR 228
           +  +R    GF    T  C  C G G  ++  D C  CH       + K + V +P G +
Sbjct: 226 QVHVR---AGFQMAST--CQTCDGEGSTIKDSDKCGTCHSHGFKLNSNKTITVDLPHGLQ 280

Query: 229 HNDRI-----------VLEGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIIS 277
             D I            ++     E     GDL+  +     T        D+     I 
Sbjct: 281 DGDTIRVPNQGSYPGMAIDPSMKSELHLTRGDLLIRVRVRKDTRFQVSNNYDIIYTQEIP 340

Query: 278 LSDALTGFEKEVCTTLDGRDLRLKIPTG----QVIRPGNYICLKNEGWPLDDEGKKFGNM 333
           ++ A  G   EV  T++   +RLK+ +G    QVIR      + N+G P    G + G+M
Sbjct: 341 ITTAALGGVIEV-PTVEEEKIRLKVSSGTQHDQVIR------IPNKGVPRGARGDR-GDM 392

Query: 334 YVQINIEFPPDHWYSERGEIEALRNI 359
            V+  I        +ER   E L ++
Sbjct: 393 LVKFKIVIKKPKDETERYLWETLAHL 418

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV   A+  E+KKAYR+ ALQ+HPDK +   + E +EI F  +  AYE+LS+ ++R
Sbjct: 6  YELLGVDSHASDLELKKAYRKKALQYHPDK-NPTKVEEATEI-FATIRTAYEVLSDPQER 63

Query: 64 RNYDTY 69
            YD++
Sbjct: 64 AWYDSH 69

>Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W
          (REAL)
          Length = 172

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 38/67 (56%)

Query: 1  MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNE 60
          +  Y+ L +  DATQ+EIK+AYR   L  HPDK++  +    S +   ++  AY +LS+ 
Sbjct: 7  LTHYEILRIPSDATQEEIKRAYRDQLLHTHPDKLTKNTHGTISSVTINKIQDAYRILSDI 66

Query: 61 EKRRNYD 67
            R  YD
Sbjct: 67 RSRCEYD 73

>TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.297
           YJL073W
          Length = 604

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 52/101 (51%), Gaps = 9/101 (8%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEI--KFKEVAAAYELLSN 59
           D Y  LG+   AT  +I++AY     ++HPDK    S +EES+I  K  ++  AYE LS+
Sbjct: 494 DYYKILGLPKTATSKDIRRAYLDFTKKYHPDKQGQLSEKEESKIHEKMSQINEAYETLSD 553

Query: 60  EEKRRNYDTY-------GDTNGYSDSYGGFQDGDFASFFGN 93
           + +R+ YD         G  N     +   ++G  +S FGN
Sbjct: 554 DTRRKEYDQARSSGSRSGPMNPNMFRHANAREGQGSSHFGN 594

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 49/83 (59%), Gaps = 3/83 (3%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV   A+  ++KKAYR+ AL +HPDK  D    EE+   F  + AAYE+L++ ++R
Sbjct: 6  YELLGVETTASDADLKKAYRKKALVYHPDKNRDNV--EEATAIFATIRAAYEVLADPQER 63

Query: 64 RNYDTYGDTNGYSDSYGGFQDGD 86
            YD++      SD  G   DG+
Sbjct: 64 AWYDSHK-QQILSDDIGMTNDGE 85

>TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.297
           YJL073W
          Length = 666

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAA--AYELLSN 59
           D Y  L +   AT  EI+KAY  L  ++HPDK    S +++++   K +A   AYE+LS+
Sbjct: 560 DFYKVLSIPTSATDKEIRKAYLLLTKKYHPDKQGQLSPKQQAKNHAKMIAINEAYEILSD 619

Query: 60  EEKRRNYDT 68
           E KRR+YD 
Sbjct: 620 ENKRRDYDN 628

>AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR254C (SEC63)
          Length = 669

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (59%), Gaps = 3/77 (3%)

Query: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVS---DESLREESEIKFKEVAAAYELL 57
            DPY+ L V   AT  EI+ AYR+L+++ HPDK++    ++ R   E ++  +  AY+ L
Sbjct: 114 FDPYELLQVGSGATDREIRSAYRKLSVKFHPDKLAKDLQDTERSVLEEQYVLITKAYKAL 173

Query: 58  SNEEKRRNYDTYGDTNG 74
           +++  R N+  YG  +G
Sbjct: 174 TDDATRDNFLRYGHPDG 190

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 44/69 (63%), Gaps = 2/69 (2%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVS--DESLREESEIKFKEVAAAYELLSN 59
           D Y  LG++ +AT  +I+KAY +L  ++HPDK     ES ++++  K  E+  AYE LS+
Sbjct: 559 DYYKILGISKEATSKDIRKAYLQLTKRYHPDKQGHLSESEQKKNHEKMSEINEAYETLSD 618

Query: 60  EEKRRNYDT 68
           E K+  YD+
Sbjct: 619 EAKKSEYDS 627

>CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} similar
           to uniprot|P40358 Saccharomyces cerevisiae YJL073w JEM
          Length = 656

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDE---SLREESEIKFKEVAAAYELLSNE 60
           Y  LG+ P+A+  EI+KAY  L  ++HPDK   +      ++++ K  E+  AYE+L++E
Sbjct: 543 YQILGIKPEASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEINEAYEVLNDE 602

Query: 61  EKRRNYDT 68
           EKR+ YD+
Sbjct: 603 EKRKEYDS 610

>KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa]
          {ON} weakly similar to uniprot|P46997 Saccharomyces
          cerevisiae YJL162C JJJ2 Protein that may function as a
          cochaperone as suggested by the presence of a DnaJ-like
          domain
          Length = 590

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 39/64 (60%), Gaps = 4/64 (6%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y  LG+  DA++ +IKKAYRR+A+  HPDK    S  E     FK V+ A  +L ++E R
Sbjct: 14 YSVLGLKSDASESQIKKAYRRIAMAIHPDKNKSASAAE----MFKLVSHAQSVLIDKELR 69

Query: 64 RNYD 67
          R Y+
Sbjct: 70 RTYN 73

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 9/100 (9%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVS--DESLREESEIKFKEVAAAYELLSNEE 61
           Y  LGV   AT  +I+K+Y  +  ++HPDK     E+ + +++ K  E+  AYE+LS+E 
Sbjct: 507 YKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILSDEG 566

Query: 62  KRRNYD-------TYGDTNGYSDSYGGFQDGDFASFFGNF 94
           KR+ YD         G  + +      F  G+F   FG F
Sbjct: 567 KRKEYDDQRSGRAPQGQGSPFGQGGFPFGSGNFKMNFGGF 606

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON}
          Anc_2.15 YNL227C
          Length = 598

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 46/66 (69%), Gaps = 2/66 (3%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ L V   A+  ++KKAYRR ALQ+HPDK +  +++E ++I F  +  AYE+LS+ ++R
Sbjct: 6  YELLDVEMTASDADLKKAYRRKALQYHPDK-NINNIKEATDI-FANIRTAYEILSDPQER 63

Query: 64 RNYDTY 69
            YD++
Sbjct: 64 VWYDSH 69

>KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa]
          {ON} Anc_1.185 YJL162C
          Length = 544

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 4/64 (6%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y  LGV  DAT +EI K+YR+LA++ HPDK    S  ++ E  FK V  A+ +L+N E+R
Sbjct: 11 YSLLGVHFDATNEEISKSYRKLAMKLHPDK----SKSDKCEELFKLVVHAHSVLTNGEER 66

Query: 64 RNYD 67
            Y+
Sbjct: 67 AKYN 70

>KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa]
          {ON} Anc_1.185 YJL162C
          Length = 555

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 39/64 (60%), Gaps = 4/64 (6%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y  LG+ P+AT  EI+K+Y  LA + HPDK   E+  E     FK V  A+ +L++ EK+
Sbjct: 15 YSILGLTPNATDIEIRKSYMNLARKLHPDKSKSEATGE----LFKLVVHAHSILTDVEKK 70

Query: 64 RNYD 67
          R YD
Sbjct: 71 RAYD 74

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 53/93 (56%), Gaps = 5/93 (5%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDK---VSDESLREESEIKFKEVAAAYELLS 58
           D Y  LGV   AT  +++++Y +L  + HPDK   ++DE  R+++E K  E+  AYE+LS
Sbjct: 528 DYYKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDEQ-RQKNEEKMAEINEAYEILS 586

Query: 59  NEEKRRNYDTYGDTNGYSDSYGGFQ-DGDFASF 90
           +++KR  YD     +  S    GF+  G F  F
Sbjct: 587 DDDKRTKYDNARANSRNSRGAHGFEGHGGFKPF 619

>KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 607

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 41/66 (62%), Gaps = 2/66 (3%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVS--DESLREESEIKFKEVAAAYELLSNEE 61
           Y  L V P AT  +I+K+Y  +  ++HPDK     ES + +++ +  E+  AYE+LS+E 
Sbjct: 505 YKVLEVTPQATSKDIRKSYLSMTRKYHPDKQGQLSESQKLQNQERMSEINEAYEILSDEG 564

Query: 62  KRRNYD 67
           KR+ YD
Sbjct: 565 KRKEYD 570

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 40/67 (59%), Gaps = 2/67 (2%)

Query: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEI--KFKEVAAAYELLSNEE 61
           Y  LG+  DA   +I++AY  L  ++HPDK  + S  E +++  K   +  AYE+LS+E 
Sbjct: 511 YKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYEVLSDES 570

Query: 62  KRRNYDT 68
           KR+ YD 
Sbjct: 571 KRKEYDM 577

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          YD L V   ++  +IKKAYR+LA++ HPDK       E     FK +  A+E+LS+ +KR
Sbjct: 23 YDILNVERSSSDVDIKKAYRKLAIKLHPDKNPYPKAHE----AFKLINRAFEVLSDSQKR 78

Query: 64 RNYDTYG 70
          + YD  G
Sbjct: 79 QIYDQIG 85

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 2/66 (3%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y+ LGV   A+  E+KKAYR+ AL++HPDK  +    EE+   F  +  AYE+LS+ ++R
Sbjct: 6  YELLGVESIASDLELKKAYRKKALKYHPDKNPNNV--EEATQAFATIRLAYEVLSDPQER 63

Query: 64 RNYDTY 69
            YD++
Sbjct: 64 AWYDSH 69

>TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {ON}
           Anc_8.61 YFL016C
          Length = 470

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (69%), Gaps = 4/69 (5%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61
           DPY+TLGV  +A+  EIKKAY +LA + HPD ++ E     +E KF ++  AYE+LS++ 
Sbjct: 36  DPYETLGVGKNASSSEIKKAYYKLAKKFHPD-INKE---PNAEAKFHDLQNAYEILSDDT 91

Query: 62  KRRNYDTYG 70
           K++ YD +G
Sbjct: 92  KKQQYDQFG 100

>Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa]
          {ON} YJL162C - Hypothetical ORF [contig 108] FULL
          Length = 578

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 4/71 (5%)

Query: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63
          Y  LG+  DAT+ +IKKAYR++A+  HPDK    S  E     FK V+ A  +L ++E+R
Sbjct: 14 YSMLGLTSDATEAQIKKAYRKIAMAIHPDKNKSVSAAE----LFKLVSHAQSVLIDKEQR 69

Query: 64 RNYDTYGDTNG 74
          ++Y+    T G
Sbjct: 70 QSYNRKLITKG 80

>KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON}
           Anc_1.297 YJL073W
          Length = 668

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 40/68 (58%), Gaps = 2/68 (2%)

Query: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEI--KFKEVAAAYELLSN 59
           D Y  LGVA ++    I+KAY  L  ++HPDK    S +E+ +   K  E+  AYE+L +
Sbjct: 554 DYYKILGVAKNSDSKNIRKAYLNLTKKYHPDKQGQLSQKEQEQNHEKMSEINEAYEILGD 613

Query: 60  EEKRRNYD 67
           E K++ YD
Sbjct: 614 ESKKKEYD 621

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.136    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,014,292
Number of extensions: 2156668
Number of successful extensions: 7282
Number of sequences better than 10.0: 392
Number of HSP's gapped: 6655
Number of HSP's successfully gapped: 421
Length of query: 414
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 302
Effective length of database: 40,638,807
Effective search space: 12272919714
Effective search space used: 12272919714
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)