Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.237818.265ON29329312461e-174
KLTH0G13618g8.265ON3023026943e-90
SAKL0H16962g8.265ON3363402612e-25
ZYRO0C01584g8.265ON2821231342e-08
Ecym_43058.265ON3113261201e-06
YDR113C (PDS1)8.265ON3732991174e-06
TDEL0F039208.265ON3223361164e-06
Smik_4.3588.265ON3712121121e-05
Suva_2.2738.265ON3762061093e-05
CAGL0L12298g8.265ON2863011075e-05
KLLA0F19206g8.265ON26394995e-04
AGR083W8.265ON295153986e-04
NDAI0J013508.265ON422150970.001
Skud_4.3748.265ON373208870.017
KAFR0B055108.265ON275123860.020
Kpol_543.418.265ON30663860.022
NCAS0B038308.265ON325333810.10
KNAG0H032308.265ON281118790.18
NDAI0A060803.67ON43556740.88
YNL292W (PUS4)3.67ON40356674.9
KAFR0A083103.67ON40756675.0
Skud_14.453.67ON40356668.0
NOTE: 2 genes in the same pillar as Kwal_56.23781 were not hit in these BLAST results
LIST: TBLA0E04460 TPHA0A01780

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23781
         (293 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...   484   e-174
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...   271   3e-90
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...   105   2e-25
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...    56   2e-08
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    51   1e-06
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...    50   4e-06
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...    49   4e-06
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...    48   1e-05
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...    47   3e-05
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    46   5e-05
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    43   5e-04
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...    42   6e-04
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    42   0.001
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...    38   0.017
KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8....    38   0.020
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...    38   0.022
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...    36   0.10 
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    35   0.18 
NDAI0A06080 Chr1 complement(1378812..1380119) [1308 bp, 435 aa] ...    33   0.88 
YNL292W Chr14 (82806..84017) [1212 bp, 403 aa] {ON}  PUS4Pseudou...    30   4.9  
KAFR0A08310 Chr1 complement(1665068..1666291) [1224 bp, 407 aa] ...    30   5.0  
Skud_14.45 Chr14 (76370..77581) [1212 bp, 403 aa] {ON} YNL292W (...    30   8.0  

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score =  484 bits (1246), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 248/293 (84%), Positives = 248/293 (84%)

Query: 1   MGARENKENAIWSERSVPVTPTHLLSRSQSFMKNISPKRAEQRKPLASKDNNKSTGFLGA 60
           MGARENKENAIWSERSVPVTPTHLLSRSQSFMKNISPKRAEQRKPLASKDNNKSTGFLGA
Sbjct: 1   MGARENKENAIWSERSVPVTPTHLLSRSQSFMKNISPKRAEQRKPLASKDNNKSTGFLGA 60

Query: 61  KEPLRKRTRPTVNHAGSFIGNTRPGVVPILNTNGAPRIKSLVLKDDIEEEQSQSDGGEAE 120
           KEPLRKRTRPTVNHAGSFIGNTRPGVVPILNTNGAPRIKSLVLKDDIEEEQSQSDGGEAE
Sbjct: 61  KEPLRKRTRPTVNHAGSFIGNTRPGVVPILNTNGAPRIKSLVLKDDIEEEQSQSDGGEAE 120

Query: 121 DDESNSLAAKLRGKLNARDRDDSTEXXXXXXXXXXXXXXXNTKLHSETLDSDSDXXXXXX 180
           DDESNSLAAKLRGKLNARDRDDSTE               NTKLHSETLDSDSD      
Sbjct: 121 DDESNSLAAKLRGKLNARDRDDSTEQGGLLGATGGLQGLANTKLHSETLDSDSDLEVEVI 180

Query: 181 XXXXXXXXXXXXGYTPFTDEDIGKLQDTEASPFQLNFXXXXXXXXXXXXTQLFTLKLDND 240
                       GYTPFTDEDIGKLQDTEASPFQLNF            TQLFTLKLDND
Sbjct: 181 PPRPEPLPHIPHGYTPFTDEDIGKLQDTEASPFQLNFADDDDDASSQDSTQLFTLKLDND 240

Query: 241 DNLGDQEHDRKRLHTPEKKPTRASIAQQAADFELDPIYAGHGLSTKELESLLE 293
           DNLGDQEHDRKRLHTPEKKPTRASIAQQAADFELDPIYAGHGLSTKELESLLE
Sbjct: 241 DNLGDQEHDRKRLHTPEKKPTRASIAQQAADFELDPIYAGHGLSTKELESLLE 293

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score =  271 bits (694), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 162/302 (53%), Positives = 189/302 (62%), Gaps = 9/302 (2%)

Query: 1   MGARENKENAIWSERSVPVTPTHLLSRSQSFMKNISPKRAEQRKPLASKDNNKSTGFLGA 60
           MG  E+KEN+IWSE +VPVTP HLLSRSQSFMKN SPKRAE R+PLASKDNN+S  +LG 
Sbjct: 1   MGRHEDKENSIWSESNVPVTPRHLLSRSQSFMKNKSPKRAEARRPLASKDNNRSVSYLGT 60

Query: 61  KEPLRKRTRPTVNHAGSFIGNTRPGVVPILNTNGAPRIKSLVLKDDIEEEQSQSDGGEA- 119
           KEPLRKRTRP VNHAGSF+GN R G  P LN +GAP+IKSLVLKD IEEE SQS+G E  
Sbjct: 61  KEPLRKRTRPGVNHAGSFVGNARLGPAPTLNASGAPKIKSLVLKDGIEEEGSQSEGAEVD 120

Query: 120 --EDDESNSLAAKLRGKLNARDRDDSTEXXXXXXXXXXXXXXXNTKLHSETLDSDSDXXX 177
             +DD+SN LAAKLR KL +RDRD   E                 KL     +SDSD   
Sbjct: 121 EDDDDDSNRLAAKLRTKLLSRDRDAEGEQTGLLGATGGLQSLLGPKLSQRAEESDSDQEV 180

Query: 178 XXXXXXXXXXXXXXXGYTPFTDEDIGKLQDTEASPFQLNFXXXXXXX--XXXXXTQLFTL 235
                          GYTPF +++I KLQ  + SPFQLNF              TQLFTL
Sbjct: 181 EVIPPRPEPLPHVPEGYTPFGEQEIAKLQGVDVSPFQLNFSGVDEDEDINSQDSTQLFTL 240

Query: 236 KL--DNDDNLGDQEHDRKRLHTPEKKPTRASIAQQAAD--FELDPIYAGHGLSTKELESL 291
               D++D+    +  RKR HTPE+     S  Q+     FEL+P YAG+GL+ KELESL
Sbjct: 241 NFDRDDNDDTDADQSGRKRHHTPERTTIPISTGQRRKSDVFELEPTYAGNGLTAKELESL 300

Query: 292 LE 293
           LE
Sbjct: 301 LE 302

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score =  105 bits (261), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 112/340 (32%), Positives = 152/340 (44%), Gaps = 51/340 (15%)

Query: 1   MGARENKENAIWSERSVPVTPTHLLSRSQSFMK----NISPKRAEQRKPLASKDNNKSTG 56
           M   ENKEN I+S  ++P TP+HLL RSQSFMK    N   K++ +R PLASKDNNKS  
Sbjct: 1   MRTHENKENVIFSSENLPTTPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNKSNT 60

Query: 57  FL--GAKEPL--------------RKRTRPTVNHAGSFIG-NTRPGVVP----------- 88
            +  G K  L               KR RP V++ GSFI  NT     P           
Sbjct: 61  LINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLKKYG 120

Query: 89  -ILNTNGAPRIKSLVLKDDIEEEQSQSDGGEAEDDES-------NSLAAKLRGKLNARDR 140
            +L  NG PR+KSLVLKD  E +  +S+ GE E+++        N LAAKL   LN  + 
Sbjct: 121 SVLGYNGLPRVKSLVLKDVDERKVGKSEEGEEEEEDDDEEEEEDNPLAAKLLKALNNHNE 180

Query: 141 DDSTEXXXXXXXXXXXXXXXNTKLHSETLDSDSDXXXXXXXXXXXXXXXXXXGYTPFTDE 200
           DD  E                   + E    +SD                  GY+PF + 
Sbjct: 181 DDKEEGSIGLLGSNTGLQQLLKHRNVEE-GENSDFEIEIVPPHSEELPHVPNGYSPFKES 239

Query: 201 DIGKLQDTEASPFQLNFXXXXXXXXXXXXTQLFTLKL--DNDDNLGDQEHDRKRLHTPEK 258
           D+ KL +T  SPF ++               L T+ +    D+   D  +DRKR  +   
Sbjct: 240 DVIKL-NTFTSPFSMH-KEDSDCEECDDYDGLLTISMVKSEDEEQDDDTNDRKRRKSWID 297

Query: 259 KPTRASIAQQAADFE-----LDPIYAGHGLSTKELESLLE 293
           +   A+      DF      ++P Y G GL+ ++LESLL+
Sbjct: 298 E-GLATARHGLFDFNKPELYIEPHYNGEGLNKEDLESLLD 336

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 64/123 (52%), Gaps = 27/123 (21%)

Query: 3   ARENKENAIW------SERSVPVTPTHLLSRSQSFM------------KNISPKRAEQRK 44
            ++NKEN +          ++P TP HLL RSQ  +            +++SP R ++R 
Sbjct: 5   VQDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKPEENTPVKKSRSVSPVRGQRRL 64

Query: 45  PLASKDNNKSTGFLGAKEPLRKRTRPTVNHAGSFIGNTRP--GVVPILNTNGAPRIKSLV 102
           PLASKD+NKS+    A  P++KR +PT+   G  + N R       +L     PR KSLV
Sbjct: 65  PLASKDHNKSS----AAGPVKKR-QPTL--QGELLSNPRKLQKYGSVLGYTDLPRTKSLV 117

Query: 103 LKD 105
           LKD
Sbjct: 118 LKD 120

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 98/326 (30%), Positives = 130/326 (39%), Gaps = 48/326 (14%)

Query: 1   MGARENKENA-IWSERS---VPVTPTHLLSRSQS--FMKNISPKRAEQRKPLASKDNNKS 54
           M   E+KEN    SE S   VP TP H L RS S   +KN S      R PLASKD N+S
Sbjct: 1   MKKHEDKENIPTGSEPSGSIVPRTPMHQLKRSTSNVHLKNNS------RLPLASKDRNRS 54

Query: 55  TGFLGAKEPL-------------RKRTRPTVNHAGSFIGNT------RPGVVPILNTNGA 95
                 K+ L              K  RP  N   SF+ N       + G V  +N    
Sbjct: 55  QSGFNLKQQLVQGHVGGGVMVGQNKSKRPASN---SFVKNMPDSKLKKYGSVLGVNYPHL 111

Query: 96  PRIKSLVLKDDIEEEQSQSDGGEAEDDES---NSLAAKLRGKLNARDRDDSTEXXXXXXX 152
            + KSLVLKD    + SQ +G E++D +    N LAAKLR +L +   +D  E       
Sbjct: 112 TKTKSLVLKD--ASDGSQDNGEESDDYDDEEGNPLAAKLRSRLTS-GVEDENEDDGSSGL 168

Query: 153 XXXXXXXXNTKLH-SETLDSDSDXXXXXXXXXXXXXXXXXXGYTPFTDEDIGKLQDTEAS 211
                     KLH S+  D++                    GY  F DE+I KL  T  S
Sbjct: 169 LLGGGLKKLIKLHESDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLA-TYTS 227

Query: 212 PFQLNFXXXXXXXXXXXXTQLFTLKLD----NDDNLGDQEHDRKRLHTPEKKPTRASIAQ 267
           PF L F             +   + LD    ++     QE    + +    K     +  
Sbjct: 228 PF-LRFADREEDDSDSTEGERLLIPLDFGGIDESPSKKQELMATQENIIANKTIVDELGT 286

Query: 268 QAADFELDPIYAGHGLSTKELESLLE 293
           QA + +      G GLS+ EL+SLL+
Sbjct: 287 QADEIQFS-FDIGKGLSSNELQSLLD 311

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 77/299 (25%), Positives = 108/299 (36%), Gaps = 84/299 (28%)

Query: 1   MGARENKENAIW------SERSVPVTPTHLLSRSQSFM---------------------- 32
           M A E+KEN I       S  + P TP HLL RS S +                      
Sbjct: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61

Query: 33  ------KNISPKR-----AEQ--RKPLASKDNNKSTGFLGAK------------------ 61
                 K +SP +     A+Q  R PLA+KDNN+S  F+  +                  
Sbjct: 62  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTLS 121

Query: 62  ----EPLRK-----RTRPTVNHAGSFIGNTRP--GVVPILNTNGAPRIKSLVLKD--DIE 108
               + LRK     R+R   NH    + N+R       +L  N  P++KSLVLKD  D  
Sbjct: 122 IRKNDQLRKLSQISRSRSRANH-NDLLSNSRKLQKYGSVLGYNALPKMKSLVLKDLADSG 180

Query: 109 EEQSQSDGGEAEDDESNSLAAKLRGKLNARDRDDST----------EXXXXXXXXXXXXX 158
           + +  SD  E  +D  + L  KL+  L  +D  D                          
Sbjct: 181 KNEESSDDDEGNEDSESKLGKKLQSALLKQDSSDGENELNGGLGLFNEQGGLQQLIKNST 240

Query: 159 XXNTKLHSETLDSDSDXXXXXXXXXXXXXXXXXXGYTPFTDEDIGKLQDTEASPFQLNF 217
               K  ++  D   D                  GY+PF  +DI KL+ T  SP++L+ 
Sbjct: 241 KNEQKTKNDKSDKTDDYDIEIAPQRQEPLPYVPEGYSPFQQDDIEKLK-TFNSPYKLDL 298

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 94/336 (27%), Positives = 128/336 (38%), Gaps = 58/336 (17%)

Query: 1   MGARENKENAIW------SERSVPVTPTHLLSRSQSFM---------------------K 33
           M   ENKEN +          S P TP HLL RSQS M                     K
Sbjct: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVK 60

Query: 34  NISPKRAEQ--RKPLASKDNNKSTGFLGA----------KEPLRKRTRPTVNHA-GSFIG 80
             SP R  Q  R PLASKDNN+STGFL            K  L +  +   N   G  + 
Sbjct: 61  RASPSRRVQQGRPPLASKDNNRSTGFLPQLQKLQQQPSLKRNLSQSKKRNANVVDGQLLT 120

Query: 81  NTR--PGVVPILNTNGAPRIKSLVLKDDIEEEQSQSDGGEAEDDESNSLAAKLRGKLNAR 138
           N R       +L  N  P++KSLVLKD +++   Q +    ++DE + L  KL    NA 
Sbjct: 121 NPRRLKKYGSVLGYNALPKMKSLVLKD-VDQVGEQGEDENDDEDEDHILRLKLH---NAI 176

Query: 139 DRDDSTEXXXXXXXXXXXXXXXNTKLHSETLDSDSDXXXXXXXXXXXXXXXXXXGYTPFT 198
           DR D  E                 +   +  D   D                  G+    
Sbjct: 177 DRSDE-EGEEVGGLFDKSGLLHLVRDSKKDEDDWEDREIEYGPQRHEPLPYIPEGHLSLA 235

Query: 199 DEDIGKLQDTEASPFQLNFXXXXXXXXXXXXTQLFTLKLDNDDNLGDQEH-DRKRLHTPE 257
            ED  KL+ T  SP+ +               Q   L+L+   + GD E+ +R+ L   +
Sbjct: 236 QEDYDKLK-TFRSPYLI----EDDYSDSDDDKQDGFLQLEEIGSAGDDENIERENLTVKQ 290

Query: 258 KKPTRASIAQQAADFELDPIYAGHGLSTKELESLLE 293
           ++     +  Q   FE+ P Y G GL   +L  LL+
Sbjct: 291 RE-----MLPQYDTFEIQPSYCGEGLDASDLNDLLK 321

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 82/212 (38%), Gaps = 81/212 (38%)

Query: 1   MGARENKENAIW------SERSVPVTPTHLLSRSQSFM---------------------- 32
           M A E+KEN I       S  + P TP HLL RS S +                      
Sbjct: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60

Query: 33  ------KNISPKR-----AEQ--RKPLASKDNNKSTGFLGAKE----------------- 62
                 K +SP +     A+Q  R PLA+KDNN++  F+   E                 
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120

Query: 63  -------PLRK-----RTRPTVNHAGSFIGNTRP--GVVPILNTNGAPRIKSLVLKDDI- 107
                   LRK     R R  VNH+   + NTR       +L  N  P++KSLVLKD + 
Sbjct: 121 LSIRKNDQLRKLSQISRNRNRVNHS-DLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVD 179

Query: 108 ----EEEQSQSDGGEAEDDESNSLAAKLRGKL 135
               EE     DG E  +   N L+ KL+  L
Sbjct: 180 PGKNEESSDDDDGSEGSE---NKLSKKLQNAL 208

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 79/206 (38%), Gaps = 75/206 (36%)

Query: 1   MGARENKENAIW------SERSVPVTPTHLLSRSQSFM---------------------- 32
           M A E+KEN I       S  S P TP HLL RS S +                      
Sbjct: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60

Query: 33  ------KNISPKR-------AEQRKPLASKDNNKSTGFLGAKEP---------------- 63
                 K +SP +        + R PLA+KDNN+S  F+ A E                 
Sbjct: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120

Query: 64  --------LRK-----RTRPTVNHAGSFIGNTRP--GVVPILNTNGAPRIKSLVLKD--D 106
                   LRK     R R   N+ G  + N+R       +L  N  P++KSLVLKD  D
Sbjct: 121 LSTRKNDQLRKLSQVSRNRNRGNYNG-MLNNSRKLQKYGSVLGYNALPKMKSLVLKDLAD 179

Query: 107 IEEEQSQSDGGEAEDDESNSLAAKLR 132
             + Q  SD  +  +   N L+ KL+
Sbjct: 180 PAKNQESSDDDDGSEGTDNKLSQKLQ 205

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 50/107 (46%), Gaps = 11/107 (10%)

Query: 193 GYTPFTDEDIGKLQDTEASPFQLNFXXXXXXXXXXXXTQLFTLKLDNDDNLGDQEHDRKR 252
           GY PF  EDI KL+ T  SP+ L+               L +L   N++   D++ +   
Sbjct: 273 GYPPFQQEDILKLK-TFNSPYGLDLEGNSNNTNSADKVGLLSLVEVNEE---DEKDNTTH 328

Query: 253 LHTPEKKPTRASIAQQ-------AADFELDPIYAGHGLSTKELESLL 292
               +++P   S+A Q       AA   ++ +Y G GL ++ELE LL
Sbjct: 329 TIGDQQEPAELSLALQNSEDDDNAAMPLIESLYNGEGLDSEELEDLL 375

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 83/301 (27%), Positives = 115/301 (38%), Gaps = 45/301 (14%)

Query: 1   MGARE-NKENAIWS--ERSVPVTPTHLLSRSQSFMKNISPKRAEQRKPLASKDNN--KST 55
           MGA E +KEN +        P TPT LL R++S +    PK+  QR+PLASKD N  +S+
Sbjct: 1   MGAVETDKENNVVGTLREKGPATPTQLLKRTRSTL---LPKKNGQRQPLASKDKNYNRSS 57

Query: 56  GFLGAKE-PLRKRTRPTVNHAGSFIGNTRPGVVPILNTNGAPRIKSLVLKDDI--EEEQS 112
            +L  K    +K+ +P V  AGS   N               R+ SL+LKD    +E++S
Sbjct: 58  SYLSLKRNSNQKKLKPAVTRAGSTANNANR------------RVTSLILKDIASGDEKES 105

Query: 113 QSDGGEAEDDESNSLAAKLRGKLNARDRDDSTEXXXXXXXXXXXXXXXNTKLHSETLDSD 172
            S+    +D+ESN LA K++  L                          + L     D D
Sbjct: 106 ASESDSEDDEESNPLALKIKQALT---------HSIASAEGKTGLLNGKSGLRKIFNDRD 156

Query: 173 SDXXXXXXXXXXXXXXXXXXGYTPFTDEDIGKLQDTEA--SPFQLNFXXXXXXXXXXXXT 230
            D                  GY P  D D+ KL+   A   P  +               
Sbjct: 157 LDREIEVASVREPEKPYEPEGYEPLDDSDLEKLKLKNAINRPTFIMDSPRAISIVGDDSP 216

Query: 231 QLFTLKLD---------NDDNLGDQEHDRKRLHTPEKKPTRASIAQQAADFELDPIYAGH 281
           QL  L L+         ND N  D+   R   +T  K           +  E+D IY G 
Sbjct: 217 QLLPLDLEESKLEEGVLNDKNTTDEVITRA--NTQAKNANITESIDDCSSVEIDSIYDGR 274

Query: 282 G 282
           G
Sbjct: 275 G 275

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 46/94 (48%), Gaps = 16/94 (17%)

Query: 20  TPTHLLSRSQSFMKNISPKRAEQRKPLASKDNNKSTGFLGAKE--PLRKRTRPTVNHAGS 77
           TP + + R+ S ++         R+PLASKDNN++   L  K    L K   P    A S
Sbjct: 23  TPLNQMKRTDSLVRG-------NRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASS 75

Query: 78  FIGNT------RPGVVPILNTNGAPRIKSLVLKD 105
           F+ N       + G V  +NT   PR KSLVLKD
Sbjct: 76  FMKNMPENKLKKYGSVLGMNT-FMPRTKSLVLKD 108

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 42/101 (41%), Gaps = 10/101 (9%)

Query: 193 GYTPFTDEDIGKLQDTEASPFQLNFXXXXXXXXXXXXTQLFTLKLDNDDNLGDQEHDRKR 252
           GY PF  E I KLQ    SPFQ+               +L +L   ++D +    ++  +
Sbjct: 173 GYDPFDKESIEKLQH-HRSPFQV---ESITFDTEERDPELISLAATDEDLVSPTRYNNHK 228

Query: 253 LHTPEKKPTRASIAQQAADFELDPIYAGHGLSTKELESLLE 293
            H  E      SI       EL   Y G GL T EL SLL+
Sbjct: 229 -HNLELDSDNESIT-----IELGEEYNGQGLDTLELNSLLD 263

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 67/153 (43%), Gaps = 29/153 (18%)

Query: 1   MGARENKENAIWSE---RSVPVTPTHLLSRSQSFMKNISPKRAEQRKPLASKDNNKSTGF 57
           M   E+KEN + S      +P TP H L RS S +      R   R PLASKD N+S G 
Sbjct: 1   MKKHEDKENLVTSAGRGAMMPRTPIHQLKRSSSNLAG----RNSTRMPLASKDRNQSQGV 56

Query: 58  LGAKEPLRKRT--------RPTVNHAGSFIGNTRP-------GVVPILNTNGAPRIKSLV 102
            G K               RP    A S I    P       G V  +      + KSLV
Sbjct: 57  FGLKTSGAGGAGGAQAQSKRP----ASSSIAKNMPDSKLKKYGSVLGVGYGSLAKAKSLV 112

Query: 103 LKDDIEEEQSQSDGGEAEDDESNSLAAKLRGKL 135
           LKD  + E +     E+E++E N LAAKL+ +L
Sbjct: 113 LKDTSDCESANE---ESEEEEGNPLAAKLKSRL 142

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 63/150 (42%), Gaps = 44/150 (29%)

Query: 17  VPVTPTHLLSRSQSFMK--------------------------NISPKRA----EQRKPL 46
            P TP HLL RS S +                           NISP+R     + R PL
Sbjct: 37  FPQTPAHLLKRSSSILSKQKPDIKPGNLELQLQSDAGAGAVPPNISPRRQLLQLQNRFPL 96

Query: 47  ASKDNNKSTGFLGAKEPLRKRTRPTVNHAGSFIGNTRPGVVPILNTNGAPRIKSLVLKDD 106
           + KDNN S  F+  K+  ++     +   GS +G    G     N N   RIKSLVLK D
Sbjct: 97  SKKDNNNS--FI-LKQQQQQFDHKRLKKYGSVLGLGTDGN----NHNNLTRIKSLVLK-D 148

Query: 107 IEEEQSQSDGGEAEDDESNSLAAKLRGKLN 136
           I+++    + G   D   NS    +RG LN
Sbjct: 149 IDDD---DNAGSHTD---NSTNGNIRGSLN 172

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%)

Query: 193 GYTPFTDEDIGKLQDTEASPFQL 215
           GYTPFT+EDI KL+    SPF +
Sbjct: 292 GYTPFTNEDINKLK-VYHSPFAI 313

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 75/208 (36%), Gaps = 79/208 (37%)

Query: 1   MGARENKENAIW------SERSVPVTPTHLLSRSQSFM---------------------- 32
           M A E+KEN I       S  + P TP HLL RS S +                      
Sbjct: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60

Query: 33  ------KNISPKR-----AEQ--RKPLASKDNNKSTGFLGAKEPL--------------- 64
                 K +SP +     A+Q  R PLA+KDNN+S  F+   E                 
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120

Query: 65  ----------------RKRTRPTVNHAGSFIGNTRP--GVVPILNTNGAPRIKSLVLKD- 105
                           R RTR   N     + N+R       +L  N  P++KSLVLKD 
Sbjct: 121 LSIRKNDQLRQLSQISRNRTRANYNE---LLNNSRKLQKYGSVLGYNALPKMKSLVLKDL 177

Query: 106 -DIEEEQSQSDGGEAEDDESNSLAAKLR 132
               + Q  SD  +  +   + L  KL+
Sbjct: 178 AGPAKNQESSDDDDGSEGPESKLGVKLQ 205

>KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8.265
           YDR113C
          Length = 275

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 56/123 (45%), Gaps = 20/123 (16%)

Query: 1   MGARENKENAIWSERSVPV----TPTHLLSRSQSFMKNISP-KRAEQ--RKPLASKDNNK 53
           M  + +KEN +    ++PV    TP     +  +    ISP KR +Q  + PL SK+ NK
Sbjct: 1   MSNQSDKENNL---STIPVLALQTPNTNFVKKNTTSTRISPLKRLQQQGKLPLQSKNGNK 57

Query: 54  STGFLGAKEPLRKRTRPTVNHAGSFIGNTRPGVVPILNTNGAPRIKSLVLKDDIEEEQSQ 113
           S   L +     K     +   GS +G   PG   +      P+ KSL+LKD+   E  +
Sbjct: 58  SNSILIS----HKGNNTRIKKYGSILGLENPGNFKL------PKTKSLILKDNESSESEE 107

Query: 114 SDG 116
            DG
Sbjct: 108 EDG 110

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
          complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (55%), Gaps = 13/63 (20%)

Query: 5  ENKENAIWSE---RSVPVTPTHLLSRSQSFMK----------NISPKRAEQRKPLASKDN 51
          +NKEN I+     + +P TP +LL R+ S +K          N+     ++R PLASKDN
Sbjct: 3  QNKENNIFRHAMLKDMPQTPNNLLKRTHSKLKTGIAKDIQGGNVINTSPQKRLPLASKDN 62

Query: 52 NKS 54
          N+S
Sbjct: 63 NRS 65

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 85/333 (25%), Positives = 120/333 (36%), Gaps = 83/333 (24%)

Query: 5   ENKENAIWSERSV---------PVTPTHLL-SRSQSF------------MKNISPKR--- 39
           E+KEN    E  V         P TP HLL  RS S             + NISP+R   
Sbjct: 7   EDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKPNSVNATDELGNISPRRRQL 66

Query: 40  --AEQRKPLASKDNNKSTGFLGAKEPLRKRTRPTVNHAGSFIGNTRPGVVPILNTNGAPR 97
              + R PLA KDNN S+ F   K  L    +  +   GS +G            +  PR
Sbjct: 67  LQLQNRLPLAKKDNNNSS-FSSRKNGLNNIKK--LKKYGSVLG-----------MDALPR 112

Query: 98  IKSLVLKDDIEEEQSQSDGGEAEDDESNSLAAKLRGKL---------------------- 135
            KSL+LK     +       + ED++ N+   KLR  +                      
Sbjct: 113 TKSLILK-----DVDDKPDDDEEDEDDNAFGLKLRNAMKQHENNSNEEENEGMSGLGIGL 167

Query: 136 ------NARDRDDSTEXXXXXXXXXXXXXXXNTKLHSETLDSDSDXXXXXXXXXXXXXXX 189
                 N++ +    +                + L +   D+DSD               
Sbjct: 168 FHDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREIEYAPIREEPLPF 227

Query: 190 XXXGYTPFTDEDIGKLQDTEASPFQLNFXXXXXXXXXXXXTQLFTLKLDNDDNLGDQEHD 249
              GYTPFT EDI KL+ T  S ++L+               L T++   DD   + EH+
Sbjct: 228 VPFGYTPFTPEDINKLK-TFHSSYKLD-SPVSTVEDADKLLALETIETSVDDE-AEWEHE 284

Query: 250 RKRLHTPEKKPTRASIAQQAADFELDPIYAGHG 282
             R H   ++PTR S        +L P+Y G G
Sbjct: 285 -VRHH--RRRPTRDS---NDDSIDLVPLYNGEG 311

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 54/118 (45%), Gaps = 20/118 (16%)

Query: 1   MGARENKENAIWSERSVPVTP-THLLSRS------------QSFMKNISPKRAEQRKPLA 47
           M   E+KENA+    +VP TP +++L  S            QSF    SP R   R PLA
Sbjct: 1   MQDNEDKENAV----AVPQTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTRG-GRLPLA 55

Query: 48  SKDNNKSTGFLGAKEPLRKRTRPTVNHAGSFIGNTRPGVVPILNTNGAPRIKSLVLKD 105
           SKDNN S   +  K  L ++    V  A S     R G +   +     R KSL+LKD
Sbjct: 56  SKDNNASGLVVSGK--LGRQPADQVREANSSRKLKRYGSLLGYDNRQLTRSKSLILKD 111

>NDAI0A06080 Chr1 complement(1378812..1380119) [1308 bp, 435 aa]
          {ON} Anc_3.67 YNL292W
          Length = 435

 Score = 33.1 bits (74), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 23 HLLSRSQSFMKNISPKRAEQRKPLASKDNNKSTGFLGAKEPLRKRTRPTVNHAGSF 78
          H+L+ SQ F K I+   AE++K        K TG + +K  LRK ++  + H G+ 
Sbjct: 37 HVLTDSQIFSKEIARLTAERKK-----QYEKETGKVASKRKLRKVSKVKMGHGGTL 87

>YNL292W Chr14 (82806..84017) [1212 bp, 403 aa] {ON}
          PUS4Pseudouridine synthase, catalyzes only the
          formation of pseudouridine-55 (Psi55), a highly
          conserved tRNA modification, in mitochondrial and
          cytoplasmic tRNAs; PUS4 overexpression leads to
          translational derepression of GCN4 (Gcd- phenotype)
          Length = 403

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 23 HLLSRSQSFMKNISPKRAEQRKPLASKDNNKSTGFLGAKEPLRKRTRPTVNHAGSF 78
          H L++SQ F K I    AE++     +   K TG   +K  LRK ++  + H G+ 
Sbjct: 24 HALTKSQVFSKEIQRATAERK-----QQYEKQTGKKASKRKLRKVSKVKMGHGGTL 74

>KAFR0A08310 Chr1 complement(1665068..1666291) [1224 bp, 407 aa]
          {ON} Anc_3.67 YNL292W
          Length = 407

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 23 HLLSRSQSFMKNISPKRAEQRKPLASKDNNKSTGFLGAKEPLRKRTRPTVNHAGSF 78
          HLL+ S+ F K I+   AE+ K     +  + TG + +K  LRK ++  + H G+ 
Sbjct: 24 HLLNNSRVFSKEIARATAERMK-----EYERQTGKVPSKRKLRKVSKVKMGHGGTL 74

>Skud_14.45 Chr14 (76370..77581) [1212 bp, 403 aa] {ON} YNL292W
          (REAL)
          Length = 403

 Score = 30.0 bits (66), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 23 HLLSRSQSFMKNISPKRAEQRKPLASKDNNKSTGFLGAKEPLRKRTRPTVNHAGSF 78
          H L++SQ F K I    AE++     +   + TG   +K  LRK ++  + H G+ 
Sbjct: 24 HALTKSQVFSKQIQSATAERK-----QQYEQQTGKKASKRKLRKVSKVKMGHGGTL 74

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.128    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,863,190
Number of extensions: 1192688
Number of successful extensions: 5670
Number of sequences better than 10.0: 69
Number of HSP's gapped: 5775
Number of HSP's successfully gapped: 77
Length of query: 293
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 184
Effective length of database: 40,982,805
Effective search space: 7540836120
Effective search space used: 7540836120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 65 (29.6 bits)