Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kwal_56.237778.266ON26726713230.0
KLTH0G13596g8.266ON2672658291e-111
SAKL0H16940g8.266ON3033015932e-75
TDEL0F039308.266ON2802544922e-60
ZYRO0C01562g8.266ON2772434452e-53
NDAI0B020108.266ON2812803826e-44
AGR082C8.266ON2662653591e-40
Kpol_392.48.266ON2812563573e-40
Ecym_43048.266ON2892813443e-38
KLLA0F19228g8.266ON3052283313e-36
NCAS0B050408.266ON2732623278e-36
KAFR0B027408.266ON2562502743e-28
YLR091W (GEP5)8.266ON2932482282e-21
Suva_10.1758.266ON2992502213e-20
Skud_12.1598.266ON2942512108e-19
KNAG0G020608.266ON2862522063e-18
Smik_12.1508.266ON2922262063e-18
TPHA0J007608.266ON2492261233e-07
Suva_8.164.6ON159973750.58
CAGL0L12320g8.266ON27843740.59
YBL055C7.373ON41854731.0
TPHA0M004103.149ON46080675.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_56.23777
         (267 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...   514   0.0  
KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...   323   e-111
SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa] ...   233   2e-75
TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...   194   2e-60
ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {O...   176   2e-53
NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.26...   151   6e-44
AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...   142   1e-40
Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...   142   3e-40
Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON} ...   137   3e-38
KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON} conse...   132   3e-36
NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.26...   130   8e-36
KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...   110   3e-28
YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...    92   2e-21
Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...    90   3e-20
Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W...    86   8e-19
KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.26...    84   3e-18
Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...    84   3e-18
TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.2...    52   3e-07
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...    33   0.58 
CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weak...    33   0.59 
YBL055C Chr2 complement(115573..116829) [1257 bp, 418 aa] {ON} 3...    33   1.0  
TPHA0M00410 Chr13 complement(79537..80919) [1383 bp, 460 aa] {ON...    30   5.1  

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/267 (94%), Positives = 251/267 (94%)

Query: 1   MNRGIQVLEKLPLDVRTLKLIEKRLERAESLRFLELARQYEAKKDYKTLENIIHHTYFSW 60
           MNRGIQVLEKLPLDVRTLKLIEKRLERAESLRFLELARQYEAKKDYKTLENIIHHTYFSW
Sbjct: 1   MNRGIQVLEKLPLDVRTLKLIEKRLERAESLRFLELARQYEAKKDYKTLENIIHHTYFSW 60

Query: 61  ENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGNPRVLAAMRYGS 120
           ENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGNPRVLAAMRYGS
Sbjct: 61  ENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGNPRVLAAMRYGS 120

Query: 121 YGWNXXXXXXXXXXXXXXXXFHEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMKPLGQNI 180
           YGWN                FHEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMKPLGQNI
Sbjct: 121 YGWNREGGGERLTELERTLRFHEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMKPLGQNI 180

Query: 181 ADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQTSSRMLKRLYQR 240
           ADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQTSSRMLKRLYQR
Sbjct: 181 ADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQTSSRMLKRLYQR 240

Query: 241 ACRGAYVIKPHPTLGLEIEESKILKIQ 267
           ACRGAYVIKPHPTLGLEIEESKILKIQ
Sbjct: 241 ACRGAYVIKPHPTLGLEIEESKILKIQ 267

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score =  323 bits (829), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 198/265 (74%)

Query: 1   MNRGIQVLEKLPLDVRTLKLIEKRLERAESLRFLELARQYEAKKDYKTLENIIHHTYFSW 60
           MN  ++ LEKLPLD+RTL+L+E++L +     F ELA+QY A    K+LE+I+H TYF W
Sbjct: 1   MNMAVRALEKLPLDIRTLELLERKLLKKSLPGFQELAQQYTADGSSKSLESIVHLTYFHW 60

Query: 61  ENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGNPRVLAAMRYGS 120
            NE   HIK FREHY ELRD WPYE HR+IL M +PK+QSIRFLWS+ +P+VL+ M Y  
Sbjct: 61  CNEDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQSIRFLWSSNSPKVLSKMSYEK 120

Query: 121 YGWNXXXXXXXXXXXXXXXXFHEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMKPLGQNI 180
           Y  +                FHE+FQHFLFL+ RP LCK RK L+VPIVEIPMKPLGQNI
Sbjct: 121 YAHDTEERPSRLTELQRTVQFHEVFQHFLFLKSRPHLCKTRKGLAVPIVEIPMKPLGQNI 180

Query: 181 ADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQTSSRMLKRLYQR 240
            +VR++NLFKRK+AYVW++LA+D+PALS +NE  L  II+SPQLP+  +S R LKRLYQR
Sbjct: 181 PEVRVRNLFKRKIAYVWKVLALDSPALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQR 240

Query: 241 ACRGAYVIKPHPTLGLEIEESKILK 265
           ACRGAY I+ HP LGLEI+ESK+LK
Sbjct: 241 ACRGAYTIEQHPVLGLEIKESKLLK 265

>SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 303

 Score =  233 bits (593), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 128/301 (42%), Positives = 178/301 (59%), Gaps = 37/301 (12%)

Query: 1   MNRG---IQVLEKLPLDVRTLKLIEKRLERAESLRFLELARQ---YEAKKDYKTLENIIH 54
           MNR    +  LE LPLD RTL L+E  ++   S     L ++   Y+A ++ K+LE I++
Sbjct: 1   MNRVKTLLNFLECLPLDTRTLDLLEGTVKLCSSALLDTLEQKLFDYQANENSKSLEWIVY 60

Query: 55  HTYFSWENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGNPRVLA 114
           +TYF W N  P HI+ FR++Y++LR+ WPYE HR +L M +P+  SIR +W+  N +VL+
Sbjct: 61  NTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWNDNNKKVLS 120

Query: 115 AMRYGSYGW------------------------------NXXXXXXXXXXXXXXXXFHEI 144
           +MR+    W                              +                FHEI
Sbjct: 121 SMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTLLFHEI 180

Query: 145 FQHFLFLQRRPQLCKNRKHLSVPIVEIPMKPLGQNIADVRIKNLFKRKVAYVWRILAVDN 204
           FQH++FL+R P+LCK  K L +PIVEIPMKPLGQ+I  VRI+NLFKRK A  W++LA +N
Sbjct: 181 FQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKLLAEEN 240

Query: 205 PALSAENESLLMDIIESPQLPQGQTSSRMLKRLYQRACRGAYVIKPHPTLGLEIEESKIL 264
           P LS ENE+LL+DII SP       S+R +KRLYQRAC+ +YVI    ++GL+ + SK+ 
Sbjct: 241 PVLSLENEALLLDIIASPH-HSTSVSNRKIKRLYQRACKHSYVICEDRSIGLDFQISKLS 299

Query: 265 K 265
           K
Sbjct: 300 K 300

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score =  194 bits (492), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 151/254 (59%), Gaps = 16/254 (6%)

Query: 5   IQVLEKLPLDVRTLKLIEKRLERAE----SLRFLELARQYEAKKD----YKTLENIIHHT 56
           ++ LEKLPL  +TL L+  +L+  E     +   +L    E+ +      K LE+II+HT
Sbjct: 10  LKALEKLPLHSKTLDLLACKLKGDELKTVIIPLAKLVSNLESSRAETQRIKALESIIYHT 69

Query: 57  YFSWENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGNPRVLAAM 116
           +F W + +P H+K F+ HY ++   WPYE HR+IL M+ P+S S+R+ W   +  VL+  
Sbjct: 70  HFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWEDSSKTVLSMA 129

Query: 117 RYGSYGW-NXXXXXXXXXXXXXXXXFHEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMKP 175
            Y    W                  FH +F H+LFL+  P+LC N ++L +PIVEIPM+P
Sbjct: 130 EYSKNPWIEDNILSKKLTIIQRDLLFHSVFSHYLFLKANPRLCNNGRNLPIPIVEIPMRP 189

Query: 176 LGQNIADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQTSSRMLK 235
           LG +IA  RIKNLFK KVA+ +RILA++NP LS  +E++L +II          SSR  +
Sbjct: 190 LGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEII-------SDASSRKQR 242

Query: 236 RLYQRACRGAYVIK 249
           RLYQ +C+ AYV++
Sbjct: 243 RLYQASCKRAYVME 256

>ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {ON}
           weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 277

 Score =  176 bits (445), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 140/243 (57%), Gaps = 9/243 (3%)

Query: 8   LEKLPLDVRTLKLIE--KRLERAESLRFLELARQYEAKKDYKTLENIIHHTYFSWENEIP 65
           + +LPL + T K++E   R    +SL   +   ++E   D+K LE +I  T+F W+N +P
Sbjct: 17  IRQLPLHIETQKVLEFYCRNSSYKSLLVAQDISEFEKHNDHKYLEALIQKTHFLWDNPLP 76

Query: 66  QHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGNPRVLAAMRYGSYGWNX 125
             +K F+ ++ EL + WPYE  R++L M +P+ +S  +LW  G    L+ +R+  + W  
Sbjct: 77  PFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGKELALSNLRFEKHRWAD 136

Query: 126 XXXXXXXXXXXXXXXFHEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMKPLGQNIADVRI 185
                           H IF  + FL+   +LC N + + VPIVEIP++P+G ++AD RI
Sbjct: 137 ENIIERLSPEQGTQLLHSIFHQYFFLKSHARLCYNNRKIPVPIVEIPLRPMGNDVADCRI 196

Query: 186 KNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQTSSRMLKRLYQRACRGA 245
           +NLFKRK A VW +LA +N  LS  NE LL +II        ++ +R ++RLYQRA R A
Sbjct: 197 RNLFKRKTAVVWNLLAWENRPLSTRNEQLLGEII-------TKSETRSMRRLYQRASRRA 249

Query: 246 YVI 248
           YV+
Sbjct: 250 YVV 252

>NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.266
           YLR091W
          Length = 281

 Score =  151 bits (382), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 97/280 (34%), Positives = 140/280 (50%), Gaps = 36/280 (12%)

Query: 5   IQVLEKLPLDVRTLKLIEKR-----LERAESLR--FLELARQYE-------AKKDYKTLE 50
           +  L+ LPL   TL  +E++     ++  +S +   L L   YE       +K   KTLE
Sbjct: 13  LSSLQNLPLHSNTLAQLERKCLTRNIKATKSFKIPLLTLINSYEKAQASGQSKLSNKTLE 72

Query: 51  NIIHHTYFSWENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWS-AGN 109
           +II+HTYF W N++  H+K F+  Y+ L  FWP+  H  I      K  SI   W+ + N
Sbjct: 73  SIIYHTYFEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKI----DSKKNSIILTWNKSSN 128

Query: 110 PR-----VLAAMRYGSYGWNXXXXXXXXXXXXXXXXFHEIFQHFLFLQRRPQLCKNRKHL 164
            +     +L+ + Y                      F +I+QH++FL   P LC N K L
Sbjct: 129 SKNMLRELLSHLNYT--------QSLVPQKKDFQVIFKKIYQHYIFLSLNPSLCSNGKRL 180

Query: 165 SVPIVEIPMKPLGQNIADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQL 224
             PIVEIPM  +G +I   RI NL + K+A  W  LA+ NP L+ ENE+ L +II     
Sbjct: 181 PSPIVEIPMNAMGYDIPKKRINNLLRSKIARTWNYLAITNPILNLENEAQLDEIING--- 237

Query: 225 PQGQTSSRMLKRLYQRACRGAYVIKPHPTLGLEIEESKIL 264
                 SR L++LY+RAC  +YVIK      +E ++SK L
Sbjct: 238 -SSAIKSRQLRKLYRRACSNSYVIKNEDDNNIEFQKSKKL 276

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score =  142 bits (359), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 89/265 (33%), Positives = 135/265 (50%), Gaps = 20/265 (7%)

Query: 1   MNRGIQ-VLEKLPLDVRTLKLIEKRLER------AESLRFLELARQYEAKKDYKTLENII 53
           MN  IQ ++ +LPL   T ++I   L +       E +  +E    +  K  ++ L+ ++
Sbjct: 1   MNEHIQRIVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLRKGGHQGLQRLV 60

Query: 54  HHTYFSWENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGNPRVL 113
            H +F      P+H++  R H  EL+ FWPYE H ++L +   +SQS+R LW  G   VL
Sbjct: 61  FHVHFQLMLRAPEHLRLLRRHREELQRFWPYERHHSLLALSDVRSQSLRRLWEDGQEEVL 120

Query: 114 AAMRYGSYGW---NXXXXXXXXXXXXXXXXFHEIFQHFLFLQRRPQLCKNRKHLSVPIVE 170
             M+Y  + W                     H +F  ++FL++RP L   R+ L +P+VE
Sbjct: 121 QQMQYCRHHWLREGDVPERYALTQAQREEVLHRVFAQYMFLKQRPALWSVRR-LPIPVVE 179

Query: 171 IPMKPLGQNIADVRIKNLFKRKVAYVWRILAVDNPALS-AENESLLMDIIESPQLPQGQT 229
           I M PLG +I DVR+  LFK K   V R+L  ++PAL+ A  E +L  I E P       
Sbjct: 180 IGMTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRIIAECP------- 232

Query: 230 SSRMLKRLYQRACRGAYVIKPHPTL 254
            +R ++R+Y RACR AYV+     L
Sbjct: 233 -TRAMRRIYLRACRRAYVLDADAQL 256

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score =  142 bits (357), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 82/256 (32%), Positives = 141/256 (55%), Gaps = 21/256 (8%)

Query: 5   IQVLEKLPLDVRTLKLIEKRLERAESLRFLE----LARQYEAKK-------DYKTLENII 53
           ++ LE+LPL   TL ++E+R+  A+ L F+E    +  +YE  K       + + LE I+
Sbjct: 16  LESLERLPLHKPTLDILERRIHVAD-LPFMEEYVGILNEYEISKINSKVENESRALEKIV 74

Query: 54  HHTYFSWENE-IPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGNPRV 112
             T+  W N+  P H++ F+ HY EL   WPYE H  +L M  P + S+ +L    + R 
Sbjct: 75  KKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGSLIYLCLNNDDRF 134

Query: 113 LAAMRYG-SYGWNXXXXXXXXXXXXXXXXFHEIFQHFLFLQRRPQLCKNRKHLSVPIVEI 171
               +   +  W                 +++IF+   FL+R   + +  K++ VPIVE+
Sbjct: 135 FNFYKSQINNKWFNSVDQYKLTDEQRVSIYNDIFKQIFFLKRHTTISEVNKNM-VPIVEV 193

Query: 172 PMKPLGQNIADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQTSS 231
           P+KP+G +I   RIKNLF +KV Y+W++L++ +PA+S  +E ++M+I+E  +       +
Sbjct: 194 PLKPIGCDIPACRIKNLFNKKVDYIWKLLSLSSPAISLSHEKIIMNILEDTK------DN 247

Query: 232 RMLKRLYQRACRGAYV 247
           R + RLY+R+ + +YV
Sbjct: 248 RRINRLYRRSLKNSYV 263

>Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON}
           similar to Ashbya gossypii AGR082C
          Length = 289

 Score =  137 bits (344), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 130/281 (46%), Gaps = 40/281 (14%)

Query: 1   MNRGI-QVLEKLPLDVRTLKLIEKRLERAESLRF-----LELARQYEAKKDYKTLENIIH 54
           MNR + +++ +LPL   T K+I   +       F     +E   +Y    +   L  +I 
Sbjct: 4   MNRKVLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYLLSGEVSYLRRVIF 63

Query: 55  HTYFSWENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGNPRVLA 114
             YF   N   +H++ F  +  EL+ FWPYE H  +L  + P   S R+LWS  N +VL 
Sbjct: 64  DVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNAKVLD 123

Query: 115 AMRYGSYGWNXXXXXXXXXXXXXXXXF--------HE-----------------IFQHFL 149
            MRY  + W                 F        HE                 IF H+L
Sbjct: 124 IMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKLIFSHYL 183

Query: 150 FLQRRPQLCKNRKHLSVPIVEIPMKPLGQNIADVRIKNLFKRKVAYVWRILAVDNPALSA 209
           F++ RP LC   K+L +PIVE+ M PLG+++ DVRI NLF+++     + L  D P LS 
Sbjct: 184 FVKSRPTLC-GHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFPPLSR 242

Query: 210 ENESLLMDIIESPQLPQGQTSSRMLKRLYQRACRGAYVIKP 250
           E ESLL  II        +   R + RLY+ +C GAY + P
Sbjct: 243 EVESLLHSII--------KECDRSMGRLYKWSCNGAYTMDP 275

>KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON}
           conserved hypothetical protein
          Length = 305

 Score =  132 bits (331), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 75/228 (32%), Positives = 108/228 (47%), Gaps = 32/228 (14%)

Query: 47  KTLENIIHHTYFSWENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWS 106
           KTLE +++  +F   N+ P+H+   R++ NEL  FWPYE   +IL M  P   S   LWS
Sbjct: 51  KTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWS 110

Query: 107 AGNPRVLAAMRYGSYGW-------------------------NXXXXXXXXXXXXXXXXF 141
             N   L  + +  + W                                           
Sbjct: 111 RNNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKETL 170

Query: 142 HEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMKPLGQNIADVRIKNLFKRKVAYVWRILA 201
            +IF+H+ FL+  P+LC  +K L  PIVEI MKP G +IAD+RI NLFK+KV  +  +L 
Sbjct: 171 RQIFEHYYFLKTNPKLCATKK-LQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISDLLY 229

Query: 202 VDNPALSAENESLLMDIIESPQLPQGQTSSRMLKRLYQRACRGAYVIK 249
             NP L+++ ES+L  I+  P L      +R  KRLY+     +Y+ K
Sbjct: 230 SQNPVLTSDAESILTSIVNDPDL------NRRTKRLYKNVASRSYLFK 271

>NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.266
           YLR091W
          Length = 273

 Score =  130 bits (327), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 84/262 (32%), Positives = 134/262 (51%), Gaps = 36/262 (13%)

Query: 5   IQVLEKLPLDVRTLKLIEKRLERAES-----------LRFLELARQYEAKKDY----KTL 49
           ++ L  +PL  +TL L+E++++ A             L+ L    +Y  ++D     K L
Sbjct: 10  LRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQEDKRGIEKVL 69

Query: 50  ENIIHHTYFSWENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSA-- 107
           E+I ++TYF W N +P H++ F+++   LR +WP   HR   GM + K  SI   W+   
Sbjct: 70  ESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHR---GMDT-KRDSIIVQWAKSN 125

Query: 108 -GNPRVLAAMRYGSYGWNXXXXXXXXXXXXXXXXFHEIFQHFLFLQRRPQLCKNRKHLSV 166
            G+  +   M +   G                  F +IFQH++FL    ++  N K L  
Sbjct: 126 NGDALLKGTMNHIQPG----------ASAEELLMFKKIFQHYIFLTLNARITSNAKRLQP 175

Query: 167 PIVEIPMKPLGQNIADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQ 226
           P+V +PM  +G+ I  VR+KNLF++KV++    L   NP L+ EN   L +II +     
Sbjct: 176 PLVGVPMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVLNVENHGFLDEIINA----D 231

Query: 227 GQTSSRMLKRLYQRACRGAYVI 248
            + +SR L+RLYQRA + A+VI
Sbjct: 232 YENTSRSLRRLYQRASKNAHVI 253

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score =  110 bits (274), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 118/250 (47%), Gaps = 31/250 (12%)

Query: 6   QVLEKLPLDVRTLKLIEKRLERAESLR--FLELARQYEAKKDYKTLENIIHHTYFSWENE 63
             +E LPL  +TL  ++  L+R ++L    L     YE     K LE+II+  YF W NE
Sbjct: 22  NAIEGLPLHQKTLLQLQDTLKRNDALAIPLLRDVVSYETTGKSKFLESIIYRLYFQWLNE 81

Query: 64  IPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGNPRVLAAMRYGSYGW 123
           +P H+K     Y  L+  WP E H      + P++ S+R  W     +  A     S G 
Sbjct: 82  VPSHLKPLLNQYEHLKSNWPIERHIKFKNAE-PEAISLRNAWMRN--KATAVDLSTSDG- 137

Query: 124 NXXXXXXXXXXXXXXXXFHEIFQHFLFLQ-RRPQLCKNRKHLSVPIVEIPMKPLGQNIAD 182
                               I  HF +L+    +LCK  K + +PI+E+P+   G  I +
Sbjct: 138 ----------------VIKPILNHFRYLRVNEDRLCK--KKVGLPILEVPLNVFGTEIPE 179

Query: 183 VRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQTSSRMLKRLYQRAC 242
            R+ NL K+++A+V + L  DNP LS + E  L  II   +      ++R LKR+Y R+C
Sbjct: 180 CRVNNLLKKRIAHVKKSLLEDNPMLSPKLEDTLHSIINDSK------NTRALKRVYLRSC 233

Query: 243 RGAYVIKPHP 252
             AY  + +P
Sbjct: 234 SRAYTGESNP 243

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score = 92.4 bits (228), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 116/248 (46%), Gaps = 32/248 (12%)

Query: 19  KLIEKRLERAESLRFLELA-RQYEAKKDYKTLENIIHHTYFSWENEIPQHIKAFREHYNE 77
           K  E  +   +SL+  E A R+ + +   K LE+II+ T+F W N +P+H   F++HY+ 
Sbjct: 38  KFKEIAVPLTKSLQLYEKAQRRQDLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHF 97

Query: 78  LRDFWPYECHRTILG--------MQSPKSQSIRF------LWSAGNPRVL---AAMRYGS 120
           L   WP+E HR ++         + S  S+S+        L++  NP V    + MR   
Sbjct: 98  LLTHWPFENHRDLVDSIAVNNGKLNSTSSRSVWLKADWITLFNVKNPWVQTPPSLMRLSG 157

Query: 121 YGWNXXXXXXXXXXXXXXXXFHEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMK-PLGQN 179
              +                 + +  H+ FL     L  N K    P V+IP++  LG+ 
Sbjct: 158 TDLDTFTPERIFL-------INSLGNHYKFLIANSHLSYNHKKYPSPGVQIPVRNALGEV 210

Query: 180 IADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQTSSRMLKRLYQ 239
               +I  LF R+++++++ L ++NP LS ENE  L  +         +T  R L+RLY 
Sbjct: 211 SPAKQIAQLFARQLSHIYKSLFIENPPLSPENELALTAVF------YDETVERRLRRLYM 264

Query: 240 RACRGAYV 247
           RAC  AY 
Sbjct: 265 RACARAYT 272

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score = 89.7 bits (221), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 71/250 (28%), Positives = 106/250 (42%), Gaps = 25/250 (10%)

Query: 18  LKLIEKRLERAESLRFLELA-RQYEAKKDYKTLENIIHHTYFSWENEIPQHIKAFREHYN 76
            K  E  +   ESL+  E A R  + +   K LE+I++ T+F W N  P+H   F++HY+
Sbjct: 37  FKFKEIAVPLTESLQVYEKAQRAQDLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYH 96

Query: 77  ELRDFWPYECHRTILGMQSPKSQSIRFLWSAGN--------------PRV---LAAMRYG 119
            L   WP+E HR+++     ++  +  L S GN              P V          
Sbjct: 97  FLLSHWPFENHRSLVDSIPAQNGKLISLTSKGNWLKADWTTLFQVKNPWVRTPPPPPSPS 156

Query: 120 SYGWNXXXXXXXXXXXXXXXXFHEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMK-PLGQ 178
                                   +  H+ FL     L  N K    P+V+IP++  LG+
Sbjct: 157 LSLAQNSIAELDAFTAERTFLVKSLGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGE 216

Query: 179 NIADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQTSSRMLKRLY 238
                +I  LF R++A ++  L V+NP LS  NE  LM + +   L +  T      RLY
Sbjct: 217 ISPPKQISKLFARQLAQIYTSLFVENPPLSTANELALMTVFDDGTLERRHT------RLY 270

Query: 239 QRACRGAYVI 248
            RAC  AY I
Sbjct: 271 MRACARAYTI 280

>Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W
           (REAL)
          Length = 294

 Score = 85.5 bits (210), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 70/251 (27%), Positives = 107/251 (42%), Gaps = 35/251 (13%)

Query: 19  KLIEKRLERAESLRFLELA-RQYEAKKDYKTLENIIHHTYFSWENEIPQHIKAFREHYNE 77
           K  E  +   ESL+  E A R+ + +   K LE+II  T+F W N  P+H   F++H+  
Sbjct: 38  KFKEIAVPLTESLQVYEKAQRRQDLRTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYF 97

Query: 78  LRDFWPYECHRTILG--------MQSPKSQS------------IRFLWSAGNPRVLAAMR 117
           L   WP+E HR+++         + S  S+             ++  W    P   +   
Sbjct: 98  LLSHWPFENHRSLVDSICAHNGKLNSMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAY 157

Query: 118 YGSYGWNXXXXXXXXXXXXXXXXFHEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMK-PL 176
           +G    +                 + +  H+ FL     L  N K    P V+IP++  L
Sbjct: 158 HGGANLDAFTPERTFL-------VNSLGNHYKFLVANSHLSYNHKKYPPPAVQIPIRNAL 210

Query: 177 GQNIADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQTSSRMLKR 236
           G+     +I  LF R++  ++  L V+NP LSA+NE  LM +     L       R  KR
Sbjct: 211 GELSLSKQIAKLFSRQLTQIYTSLFVENPPLSADNELALMAVFHDDSL------DRRHKR 264

Query: 237 LYQRACRGAYV 247
           LY RAC  AY 
Sbjct: 265 LYMRACARAYT 275

>KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.266
           YLR091W
          Length = 286

 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/252 (28%), Positives = 106/252 (42%), Gaps = 19/252 (7%)

Query: 7   VLEKLPLDVRTLKLIEKRLERAESLRFLELARQYEAKKDYKTLENIIHHTYFSWENE--- 63
            L +L   V   K I +    AE+L+        +    YK L  ++   Y  W+N    
Sbjct: 21  TLARLSRHVAATKSIPRLKHVAETLQNFHDVPSTKKHTQYKILTTLLLQLYCQWDNSFSR 80

Query: 64  ---IPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQ-SIRFLWSAGNPRVLAAMRYG 119
              +P H+  F + +  L   WP E H ++   QS K   +++  W   N   L  M + 
Sbjct: 81  LSHLPPHLAPFEQDFPGLVRIWPRESHLSL--KQSTKGHATLKHAWVTNNKHALQ-MSFD 137

Query: 120 SYGWNXXXXXXXXXXXXXXXXFHEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMKPLGQN 179
           +   N                  +I  H+  L    ++    K L VP+ EIP+   G+ 
Sbjct: 138 AAAANPTSGNIELRGS-----LRQILSHYQLLYNNMRMFGKIK-LQVPVAEIPLNVFGEE 191

Query: 180 IADVRIKNLFKRKVAYVWRILAVDNPAL-SAENESLLMDII--ESPQLPQGQTSSRMLKR 236
           I   R  NL +RKV YV R+L  + PAL + E  + L  II  + P    G  S R L+R
Sbjct: 192 IPACRTANLLQRKVGYVKRVLIEELPALYNTECIAELTAIIAGDGPAARSGNYSPRQLRR 251

Query: 237 LYQRACRGAYVI 248
           LY+RA  G Y +
Sbjct: 252 LYRRAFAGCYTL 263

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 98/226 (43%), Gaps = 25/226 (11%)

Query: 38  RQYEAKKDYKTLENIIHHTYFSWENEIPQHIKAFREHYNELRDFWPYECHRTI------- 90
           R+ + +   K LE+II+ T+F W N  P+H   F++HY+ L   WP+E HR +       
Sbjct: 58  RRQDLRTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAH 117

Query: 91  ---LGMQSPKSQSIRFLWSA----GNPRVLAAMRYGSYGWNXXXXXXXXXXXXXXXXFHE 143
              L     K+  ++  W+      NP V    +      N                 + 
Sbjct: 118 KGKLNSIPSKTTWLKADWATLFQVKNPWV----QTPPTPKNLSETDLDAFTPERAFLVNS 173

Query: 144 IFQHFLFLQRRPQLCKNRKHLSVPIVEIPMK-PLGQNIADVRIKNLFKRKVAYVWRILAV 202
           +   + FL     L  N K    P V+IP++  LG+     +I  LF R++AY++  L  
Sbjct: 174 LGNQYKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFE 233

Query: 203 DNPALSAENESLLMDIIESPQLPQGQTSSRMLKRLYQRACRGAYVI 248
           +NP LS  N+  LM I         +T  R  KRLY RAC  AY I
Sbjct: 234 ENPPLSPANDIALMAIFN------DKTMDRRFKRLYMRACARAYTI 273

>TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.266
           YLR091W
          Length = 249

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 91/226 (40%), Gaps = 47/226 (20%)

Query: 8   LEKLPLDVRTLKLIEKRLER--AESLRFLELARQY-------EAKKDYKTLENIIHHTYF 58
           L +LPL   TL L++K++     ++   +EL   Y       +     K L+ II  T+ 
Sbjct: 25  LNRLPLHPNTLDLLQKQVHTKLTKNSELIELLFDYNNAFINKQKPGQLKCLQRIIFKTHL 84

Query: 59  SWENEIPQ--HIKAFREHYNELRDFWPYECHRTILGMQS--PKSQSIRFLWSAGNPRVLA 114
            + N      H+KAF+  YN L   WPYE H  +       P+++++ +LW+  N   LA
Sbjct: 85  IFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETKALEYLWNNCNSDNLA 144

Query: 115 AM--------------RYGSYG----------WNX---XXXXXXXXXXXXXXXFHEIFQH 147
            M              +Y + G          +N                   F E+F+ 
Sbjct: 145 FMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEIIDEKEIEINLFGELFKQ 204

Query: 148 FLFLQRRPQLCKNRKHLSVPIVEIPMKPLGQNIADVRIKNLFKRKV 193
             ++    +       L +PIV +P+  LG  I   R+ N FK+K+
Sbjct: 205 LHYINTINK-------LQIPIVILPLNALGLKIPKSRLYNKFKKKL 243

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
           YHL035C (REAL)
          Length = 1599

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 8/73 (10%)

Query: 7   VLEKLPLDVRTLKLIEKRLERAESLRFLELARQYEAKKDYKTLENIIHHTYFSWENEIPQ 66
           +L   PL+ R  +L+ K  + A     L+   +  AK + + L+NI    YF+WEN I +
Sbjct: 500 ILMMFPLNFRLAELLGKFQKSA-----LQCTDKRIAKLN-ECLQNIRIVKYFAWENNISK 553

Query: 67  HIKAFREHYNELR 79
            IK+ R+  NELR
Sbjct: 554 DIKSIRQ--NELR 564

>CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q12393 Saccharomyces cerevisiae
           YLR091w
          Length = 278

 Score = 33.1 bits (74), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 166 VPIVEIPMKPLGQNIADVRIKNLFKRKVAYVWRILAVDNPALS 208
            P+    + PLG   ++ + KN  +  V  +WR+LAV +P LS
Sbjct: 174 CPLTIRELTPLGALESEAKFKNRVRSDVHSLWRLLAVQHPPLS 216

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 53  IHHTYFSWENEIPQHIKAFREHYNELRDFWPYECHRTIL-GMQSPKSQSIRF 103
           +HH   +  NE+P H++ ++  Y+ L   WP    R IL  M+  K  ++R 
Sbjct: 62  VHHV-LAPMNELPAHLRQYQSEYHALVASWPTVTERQILDAMELGKGMAVRI 112

>YBL055C Chr2 complement(115573..116829) [1257 bp, 418 aa] {ON}
           3'-->5' exonuclease and endonuclease with a possible
           role in apoptosis; has similarity to mammalian and C.
           elegans apoptotic nucleases
          Length = 418

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 9/54 (16%)

Query: 201 AVDNPALS-AENESLLMDIIESPQLPQGQTSSRMLKRLYQRACRGAYVIKPHPT 253
           ++DNP++  A NESL   +I +P   QG+     LK LY    + A   KPH T
Sbjct: 133 SIDNPSMDEAYNESLYAKVISNPSFAQGK-----LKELYDLMNQQA---KPHDT 178

>TPHA0M00410 Chr13 complement(79537..80919) [1383 bp, 460 aa] {ON}
           Anc_3.149 YOL069W
          Length = 460

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 2/80 (2%)

Query: 180 IADVRIKNLFKRKVAYVWRIL-AVDNPA-LSAENESLLMDIIESPQLPQGQTSSRMLKRL 237
           + D  I +L+K     V R+L AV N A    E      DIIE   +   + +S   K  
Sbjct: 99  VTDFNIMDLYKPDHLRVQRLLSAVVNFARFRVEKMEDCTDIIEKSGVLLDELTSTFHKFN 158

Query: 238 YQRACRGAYVIKPHPTLGLE 257
           Y +  +  YVIK HP+  L+
Sbjct: 159 YLQNIKNQYVIKSHPSNELD 178

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,982,262
Number of extensions: 1002790
Number of successful extensions: 2678
Number of sequences better than 10.0: 25
Number of HSP's gapped: 2701
Number of HSP's successfully gapped: 35
Length of query: 267
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 159
Effective length of database: 41,097,471
Effective search space: 6534497889
Effective search space used: 6534497889
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)